diff -Naur mxml-2.6/ANNOUNCEMENT mxml-2.6-haiku/ANNOUNCEMENT --- mxml-2.6/ANNOUNCEMENT 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/ANNOUNCEMENT 2007-11-23 02:15:07.000000000 +0000 @@ -0,0 +1,7 @@ +Mini-XML 2.4 is now available for download from: + + http://www.easysw.com/~mike/mxml/software.php + +Mini-XML 2.4 fixes some build and XML parsing bugs, adds support +for the apos character entity, and adds per-thread global settings. + diff -Naur mxml-2.6/CHANGES mxml-2.6-haiku/CHANGES --- mxml-2.6/CHANGES 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/CHANGES 2009-05-17 17:31:51.000000000 +0000 @@ -0,0 +1,323 @@ +CHANGES - 2009-05-17 +-------------------- + +CHANGES IN Mini-XML 2.6 + + - Documentation fixes (STR #91, STR #92) + - The mxmldoc program did not handle typedef comments properly (STR #72) + - Added support for "long long" printf formats. + - The XML parser now ignores BOMs in UTF-8 XML files (STR #89) + - The mxmldoc program now supports generating Xcode documentation sets. + - mxmlSave*() did not output UTF-8 correctly on some platforms. + - mxmlNewXML() now adds encoding="utf-8" in the ?xml directive to avoid + problems with non-conformant XML parsers that assume something other + than UTF-8 as the default encoding. + - Wrapping was not disabled when mxmlSetWrapMargin(0) was called, and + "" was always followed by a newline (STR #76) + - The mxml.pc.in file was broken (STR #79) + - The mxmldoc program now handles "typedef enum name {} name" correctly + (STR #72) + + +CHANGES IN Mini-XML 2.5 + + - The mxmldoc program now makes greater use of CSS and + supports a --css option to embed an alternate stylesheet. + - The mxmldoc program now supports --header and --footer + options to insert documentation content before and + after the generated content. + - The mxmldoc program now supports a --framed option to + generate framed HTML output. + - The mxmldoc program now creates a table of contents + including any headings in the --intro file when + generating HTML output. + - The man pages and man page output from mxmldoc did + not use "\-" for dashes (STR #68) + - The debug version of the Mini-XML DLL could not be + built (STR #65) + - Processing instructions and directives did not work + when not at the top level of a document (STR #67) + - Spaces around the "=" in attributes were not supported + (STR #67) + + +CHANGES IN Mini-XML 2.4 + + - Fixed shared library build problems on HP-UX and Mac OS X. + - The mxmldoc program did not output argument descriptions + for functions properly. + - All global settings (custom, error, and entity callbacks + and the wrap margin) are now managed separately for each + thread. + - Added mxmlElementDeleteAttr() function (STR #59) + - mxmlElementSetAttrf() did not work (STR #57) + - mxmlLoad*() incorrectly treated declarations as parent + elements (STR #56) + - mxmlLoad*() incorrectly allowed attributes without values + (STR #47) + - Fixed Visual C++ build problems (STR #49) + - mxmlLoad*() did not return NULL when an element contained + an error (STR #46) + - Added support for the apos character entity (STR #54) + - Fixed whitespace detection with Unicode characters (STR + #48) + - mxmlWalkNext() and mxmlWalkPrev() did not work correctly + when called with a node with no children as the top node + (STR #53) + + +CHANGES IN Mini-XML 2.3 + + - Added two exceptions to the LGPL to support static + linking of applications against Mini-XML + - The mxmldoc utility can now generate man pages, too. + - Added a mxmlNewXML() function + - Added a mxmlElementSetAttrf() function (STR #43) + - Added snprintf() emulation function for test program (STR + #32) + - Added the _CRT_SECURE_NO_DEPRECATE definition when + building on VC++ 2005 (STR #36) + - mxmlLoad*() did not detect missing > characters in + elements (STR #41) + - mxmlLoad*() did not detect missing close tags at the end + of an XML document (STR #45) + - Added user_data and ref_count members to mxml_node_t + structure + - Added mxmlReleaseNode() and mxmlRetainNode() APIs for + reference-counted nodes + - Added mxmlSetWrapMargin() to control the wrapping of XML + output + - Added conditional check for EINTR error code for + certain Windows compilers that do not define it (STR + #33) + - The mxmldoc program now generates correct HTML 4.0 + output - previously it generated invalid XHTML + - The mxmldoc program now supports "@deprecated@, + "@private@", and "@since version@" comments + - Fixed function and enumeration type bugs in mxmldoc. + - Fixed the XML schema for mxmldoc + - The mxmldoc program now supports --intro, --section, + and --title options + - The mxmlLoad*() functions could leak a node on an error + (STR #27) + - The mxml_vsnprintf() function could get in an infinite + loop on a buffer overflow (STR #25) + - Added new mxmlNewCDATA() and mxmlSetCDATA() functions + to create and set CDATA nodes, which are really just + special element nodes + - Added new MXML_IGNORE type and MXML_IGNORE_CB callback + to ignore non-element nodes, e.g. whitespace + - mxmlLoad*() crashed when reporting an error in some + invalid XML (STR #23) + + +CHANGES IN Mini-XML 2.2.2 + + - mxmlLoad*() did not treat custom data as opaque, so + whitespace characters would be lost. + + +CHANGES IN Mini-XML 2.2.1 + + - mxmlLoadFd(), mxmlLoadFile(), and mxmlLoadString() now + correctly return NULL on error (STR #21) + - mxmlNewInteger(), mxmlNewOpaque(), mxmlNewReal(), + mxmlNewText(), and mxmlNewTextf() incorrectly required + a parent node (STR #22) + - Fixed an XML output bug in mxmldoc. + - The "make install" target now uses the install command + to set the proper permissions on UNIX/Linux/OSX. + - Fixed a MingW/Cygwin compilation problem (STR #18) + + +CHANGES IN Mini-XML 2.2 + + - Added shared library support (STR #17) + - mxmlLoad*() now returns an error when an XML stream + contains illegal control characters (STR #10) + - mxmlLoad*() now returns an error when an element + contains two attributes with the same name in + conformance with the XML spec (STR #16) + - Added support for CDATA (STR #14, STR #15) + - Updated comment and processing instruction handling - + no entity support per XML specification. + - Added checking for invalid comment termination ("--->" + is not allowed) + + +CHANGES IN Mini-XML 2.1 + + - Added support for custom data nodes (STR #6) + - Now treat UTF-8 sequences which are longer than + necessary as an error (STR #4) + - Fixed entity number support (STR #8) + - Fixed mxmlLoadString() bug with UTF-8 (STR #7) + - Fixed entity lookup bug (STR #5) + - Added mxmlLoadFd() and mxmlSaveFd() functions. + - Fixed multi-word UTF-16 handling. + + +CHANGES IN Mini-XML 2.0 + + - New programmers manual. + - Added Visual C++ project files for Microsoft Windows + users. + - Added optimizations to mxmldoc, mxmlSaveFile(), and + mxmlIndexNew() (STR #2) + - mxmlEntityAddCallback() now returns an integer status + (STR #2) + - Added UTF-16 support (input only; all output is UTF-8) + - Added index functions to build a searchable index of + XML nodes. + - Added character entity callback interface to support + additional character entities beyond those defined in + the XHTML specification. + - Added support for XHTML character entities. + - The mxmldoc utility now produces XML output which + conforms to an updated XML schema, described in the file + "doc/mxmldoc.xsd". + - Changed the whitespace callback interface to return + strings instead of a single character, allowing for + greater control over the formatting of XML files + written using Mini-XML. THIS CHANGE WILL REQUIRE + CHANGES TO YOUR 1.x CODE IF YOU USE WHITESPACE + CALLBACKS. + - The mxmldoc utility is now capable of documenting C++ + classes, functions, and structures, and correctly + handles C++ comments. + - Added new modular tests for mxmldoc. + - Updated the mxmldoc output to be more compatible with + embedding in manuals produced with HTMLDOC. + - The makefile incorrectly included a "/" separator + between the destination path and install path. This + caused problems when building and installing with + MingW. + + +CHANGES IN Mini-XML 1.3 + + - Fixes for mxmldoc. + - Added support for reading standard HTML entity names. + - mxmlLoadString/File() did not decode character + entities in element names, attribute names, or + attribute values. + - mxmlLoadString/File() would crash when loading non- + conformant XML data under an existing parent (top) + node. + - Fixed several bugs in the mxmldoc utility. + - Added new error callback function to catch a variety + of errors and log them to someplace other than stderr. + - The mxmlElementSetAttr() function now allows for NULL + attribute values. + - The load and save functions now properly handle quoted + element and attribute name strings properly, e.g. for + !DOCTYPE declarations. + + +CHANGES IN Mini-XML 1.2 + + - Added new "set" methods to set the value of a node. + - Added new formatted text methods mxmlNewTextf() and + mxmlSetTextf() to create/set a text node value using + printf-style formats. + - Added new standard callbacks for use with the mxmlLoad + functions. + - Updated the HTML documentation to include examples of + the walk and load function output. + - Added --with/without-ansi configure option to control + the strdup() function check. + - Added --with/without-snprintf configure option to + control the snprintf() and vsnprintf() function + checks. + + +CHANGES IN Mini-XML 1.1.2 + + - The mxml(3) man page wasn't updated for the string + functions. + - mxmlSaveString() returned the wrong number of + characters. + - mxml_add_char() updated the buffer pointer in the + wrong place. + + +CHANGES IN Mini-XML 1.1.1 + + - The private mxml_add_ch() function did not update the + start-of-buffer pointer which could cause a crash when + using mxmlSaveString(). + - The private mxml_write_ws() function called putc() + instead of using the proper callback which could cause + a crash when using mxmlSaveString(). + - Added a mxmlSaveAllocString() convenience function for + saving an XML node tree to an allocated string. + + +CHANGES IN Mini-XML 1.1 + + - The mxmlLoadFile() function now uses dynamically + allocated string buffers for element names, attribute + names, and attribute values. Previously they were + capped at 16383, 255, and 255 bytes, respectively. + - Added a new mxmlLoadString() function for loading an + XML node tree from a string. + - Added a new mxmlSaveString() function for saving an + XML node tree to a string. + - Add emulation of strdup() if the local platform does + not provide the function. + + +CHANGES IN Mini-XML 1.0 + + - The mxmldoc program now handles function arguments, + structures, unions, enumerations, classes, and + typedefs properly. + - Documentation provided via mxmldoc and more in-line + comments in the code. + - Added man pages and packaging files. + + +CHANGES IN Mini-XML 0.93 + + - New mxmldoc example program that is also used to + create and update code documentation using XML and + produce HTML reference pages. + - Added mxmlAdd() and mxmlRemove() functions to add and + remove nodes from a tree. This provides more + flexibility over where the nodes are inserted and + allows nodes to be moved within the tree as needed. + - mxmlLoadFile() now correctly handles comments. + - mxmlLoadFile() now supports the required "gt", "quot", + and "nbsp" character entities. + - mxmlSaveFile() now uses newlines as whitespace + when valid to do so. + - mxmlFindElement() now also takes attribute name and + attribute value string arguments to limit the search + to specific elements with attributes and/or values. + NULL pointers can be used as "wildcards". + - Added uninstall target to makefile, and auto-reconfig + if Makefile.in or configure.in are changed. + - mxmlFindElement(), mxmlWalkNext(), and mxmlWalkPrev() + now all provide "descend" arguments to control whether + they descend into child nodes in the tree. + - Fixed some whitespace issues in mxmlLoadFile(). + - Fixed Unicode output and whitespace issues in + mxmlSaveFile(). + - mxmlSaveFile() now supports a whitespace callback to + provide more human-readable XML output under program + control. + + +CHANGES IN Mini-XML 0.92 + + - mxmlSaveFile() didn't return a value on success. + + +CHANGES IN Mini-XML 0.91 + + - mxmlWalkNext() would go into an infinite loop. + + +CHANGES IN Mini-XML 0.9 + + - Initial public release. diff -Naur mxml-2.6/COPYING mxml-2.6-haiku/COPYING --- mxml-2.6/COPYING 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/COPYING 2005-10-18 19:26:08.000000000 +0000 @@ -0,0 +1,507 @@ + Mini-XML License + October 18, 2005 + + +The Mini-XML library and included programs are provided under the +terms of the GNU Library General Public License (LGPL) with the +following exceptions: + + 1. Static linking of applications to the Mini-XML library + does not constitute a derivative work and does not require + the author to provide source code for the application, use + the shared Mini-XML libraries, or link their applications + against a user-supplied version of Mini-XML. + + If you link the application to a modified version of + Mini-XML, then the changes to Mini-XML must be provided + under the terms of the LGPL in sections 1, 2, and 4. + + 2. You do not have to provide a copy of the Mini-XML license + with programs that are linked to the Mini-XML library, nor + do you have to identify the Mini-XML license in your + program or documentation as required by section 6 of the + LGPL. + + + GNU LIBRARY GENERAL PUBLIC LICENSE + Version 2, June 1991 + + Copyright (C) 1991 Free Software Foundation, Inc. + 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA + + Everyone is permitted to copy and distribute verbatim copies + of this license document, but changing it is not allowed. + + [This is the first released version of the library GPL. It is + numbered 2 because it goes with version 2 of the ordinary GPL.] + + Preamble + + The licenses for most software are designed to take away your +freedom to share and change it. By contrast, the GNU General Public +Licenses are intended to guarantee your freedom to share and change +free software--to make sure the software is free for all its users. + + This license, the Library General Public License, applies to some +specially designated Free Software Foundation software, and to any +other libraries whose authors decide to use it. You can use it for +your libraries, too. + + When we speak of free software, we are referring to freedom, not +price. Our General Public Licenses are designed to make sure that you +have the freedom to distribute copies of free software (and charge for +this service if you wish), that you receive source code or can get it +if you want it, that you can change the software or use pieces of it +in new free programs; and that you know you can do these things. + + To protect your rights, we need to make restrictions that forbid +anyone to deny you these rights or to ask you to surrender the rights. +These restrictions translate to certain responsibilities for you if +you distribute copies of the library, or if you modify it. + + For example, if you distribute copies of the library, whether gratis +or for a fee, you must give the recipients all the rights that we gave +you. You must make sure that they, too, receive or can get the source +code. If you link a program with the library, you must provide +complete object files to the recipients so that they can relink them +with the library, after making changes to the library and recompiling +it. And you must show them these terms so they know their rights. + + Our method of protecting your rights has two steps: (1) copyright +the library, and (2) offer you this license which gives you legal +permission to copy, distribute and/or modify the library. + + Also, for each distributor's protection, we want to make certain +that everyone understands that there is no warranty for this free +library. If the library is modified by someone else and passed on, we +want its recipients to know that what they have is not the original +version, so that any problems introduced by others will not reflect on +the original authors' reputations. + + Finally, any free program is threatened constantly by software +patents. We wish to avoid the danger that companies distributing free +software will individually obtain patent licenses, thus in effect +transforming the program into proprietary software. To prevent this, +we have made it clear that any patent must be licensed for everyone's +free use or not licensed at all. + + Most GNU software, including some libraries, is covered by the ordinary +GNU General Public License, which was designed for utility programs. This +license, the GNU Library General Public License, applies to certain +designated libraries. This license is quite different from the ordinary +one; be sure to read it in full, and don't assume that anything in it is +the same as in the ordinary license. + + The reason we have a separate public license for some libraries is that +they blur the distinction we usually make between modifying or adding to a +program and simply using it. Linking a program with a library, without +changing the library, is in some sense simply using the library, and is +analogous to running a utility program or application program. However, in +a textual and legal sense, the linked executable is a combined work, a +derivative of the original library, and the ordinary General Public License +treats it as such. + + Because of this blurred distinction, using the ordinary General +Public License for libraries did not effectively promote software +sharing, because most developers did not use the libraries. We +concluded that weaker conditions might promote sharing better. + + However, unrestricted linking of non-free programs would deprive the +users of those programs of all benefit from the free status of the +libraries themselves. This Library General Public License is intended to +permit developers of non-free programs to use free libraries, while +preserving your freedom as a user of such programs to change the free +libraries that are incorporated in them. (We have not seen how to achieve +this as regards changes in header files, but we have achieved it as regards +changes in the actual functions of the Library.) The hope is that this +will lead to faster development of free libraries. + + The precise terms and conditions for copying, distribution and +modification follow. Pay close attention to the difference between a +"work based on the library" and a "work that uses the library". The +former contains code derived from the library, while the latter only +works together with the library. + + Note that it is possible for a library to be covered by the ordinary +General Public License rather than by this special one. + + GNU LIBRARY GENERAL PUBLIC LICENSE + TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION + + 0. This License Agreement applies to any software library which +contains a notice placed by the copyright holder or other authorized +party saying it may be distributed under the terms of this Library +General Public License (also called "this License"). Each licensee is +addressed as "you". + + A "library" means a collection of software functions and/or data +prepared so as to be conveniently linked with application programs +(which use some of those functions and data) to form executables. + + The "Library", below, refers to any such software library or work +which has been distributed under these terms. A "work based on the +Library" means either the Library or any derivative work under +copyright law: that is to say, a work containing the Library or a +portion of it, either verbatim or with modifications and/or translated +straightforwardly into another language. (Hereinafter, translation is +included without limitation in the term "modification".) + + "Source code" for a work means the preferred form of the work for +making modifications to it. For a library, complete source code means +all the source code for all modules it contains, plus any associated +interface definition files, plus the scripts used to control compilation +and installation of the library. + + Activities other than copying, distribution and modification are not +covered by this License; they are outside its scope. The act of +running a program using the Library is not restricted, and output from +such a program is covered only if its contents constitute a work based +on the Library (independent of the use of the Library in a tool for +writing it). Whether that is true depends on what the Library does +and what the program that uses the Library does. + + 1. You may copy and distribute verbatim copies of the Library's +complete source code as you receive it, in any medium, provided that +you conspicuously and appropriately publish on each copy an +appropriate copyright notice and disclaimer of warranty; keep intact +all the notices that refer to this License and to the absence of any +warranty; and distribute a copy of this License along with the +Library. + + You may charge a fee for the physical act of transferring a copy, +and you may at your option offer warranty protection in exchange for a +fee. + + 2. You may modify your copy or copies of the Library or any portion +of it, thus forming a work based on the Library, and copy and +distribute such modifications or work under the terms of Section 1 +above, provided that you also meet all of these conditions: + + a) The modified work must itself be a software library. + + b) You must cause the files modified to carry prominent notices + stating that you changed the files and the date of any change. + + c) You must cause the whole of the work to be licensed at no + charge to all third parties under the terms of this License. + + d) If a facility in the modified Library refers to a function or a + table of data to be supplied by an application program that uses + the facility, other than as an argument passed when the facility + is invoked, then you must make a good faith effort to ensure that, + in the event an application does not supply such function or + table, the facility still operates, and performs whatever part of + its purpose remains meaningful. + + (For example, a function in a library to compute square roots has + a purpose that is entirely well-defined independent of the + application. Therefore, Subsection 2d requires that any + application-supplied function or table used by this function must + be optional: if the application does not supply it, the square + root function must still compute square roots.) + +These requirements apply to the modified work as a whole. If +identifiable sections of that work are not derived from the Library, +and can be reasonably considered independent and separate works in +themselves, then this License, and its terms, do not apply to those +sections when you distribute them as separate works. But when you +distribute the same sections as part of a whole which is a work based +on the Library, the distribution of the whole must be on the terms of +this License, whose permissions for other licensees extend to the +entire whole, and thus to each and every part regardless of who wrote +it. + +Thus, it is not the intent of this section to claim rights or contest +your rights to work written entirely by you; rather, the intent is to +exercise the right to control the distribution of derivative or +collective works based on the Library. + +In addition, mere aggregation of another work not based on the Library +with the Library (or with a work based on the Library) on a volume of +a storage or distribution medium does not bring the other work under +the scope of this License. + + 3. You may opt to apply the terms of the ordinary GNU General Public +License instead of this License to a given copy of the Library. To do +this, you must alter all the notices that refer to this License, so +that they refer to the ordinary GNU General Public License, version 2, +instead of to this License. (If a newer version than version 2 of the +ordinary GNU General Public License has appeared, then you can specify +that version instead if you wish.) Do not make any other change in +these notices. + + Once this change is made in a given copy, it is irreversible for +that copy, so the ordinary GNU General Public License applies to all +subsequent copies and derivative works made from that copy. + + This option is useful when you wish to copy part of the code of +the Library into a program that is not a library. + + 4. You may copy and distribute the Library (or a portion or +derivative of it, under Section 2) in object code or executable form +under the terms of Sections 1 and 2 above provided that you accompany +it with the complete corresponding machine-readable source code, which +must be distributed under the terms of Sections 1 and 2 above on a +medium customarily used for software interchange. + + If distribution of object code is made by offering access to copy +from a designated place, then offering equivalent access to copy the +source code from the same place satisfies the requirement to +distribute the source code, even though third parties are not +compelled to copy the source along with the object code. + + 5. A program that contains no derivative of any portion of the +Library, but is designed to work with the Library by being compiled or +linked with it, is called a "work that uses the Library". Such a +work, in isolation, is not a derivative work of the Library, and +therefore falls outside the scope of this License. + + However, linking a "work that uses the Library" with the Library +creates an executable that is a derivative of the Library (because it +contains portions of the Library), rather than a "work that uses the +library". The executable is therefore covered by this License. +Section 6 states terms for distribution of such executables. + + When a "work that uses the Library" uses material from a header file +that is part of the Library, the object code for the work may be a +derivative work of the Library even though the source code is not. +Whether this is true is especially significant if the work can be +linked without the Library, or if the work is itself a library. The +threshold for this to be true is not precisely defined by law. + + If such an object file uses only numerical parameters, data +structure layouts and accessors, and small macros and small inline +functions (ten lines or less in length), then the use of the object +file is unrestricted, regardless of whether it is legally a derivative +work. (Executables containing this object code plus portions of the +Library will still fall under Section 6.) + + Otherwise, if the work is a derivative of the Library, you may +distribute the object code for the work under the terms of Section 6. +Any executables containing that work also fall under Section 6, +whether or not they are linked directly with the Library itself. + + 6. As an exception to the Sections above, you may also compile or +link a "work that uses the Library" with the Library to produce a +work containing portions of the Library, and distribute that work +under terms of your choice, provided that the terms permit +modification of the work for the customer's own use and reverse +engineering for debugging such modifications. + + You must give prominent notice with each copy of the work that the +Library is used in it and that the Library and its use are covered by +this License. You must supply a copy of this License. If the work +during execution displays copyright notices, you must include the +copyright notice for the Library among them, as well as a reference +directing the user to the copy of this License. Also, you must do one +of these things: + + a) Accompany the work with the complete corresponding + machine-readable source code for the Library including whatever + changes were used in the work (which must be distributed under + Sections 1 and 2 above); and, if the work is an executable linked + with the Library, with the complete machine-readable "work that + uses the Library", as object code and/or source code, so that the + user can modify the Library and then relink to produce a modified + executable containing the modified Library. (It is understood + that the user who changes the contents of definitions files in the + Library will not necessarily be able to recompile the application + to use the modified definitions.) + + b) Accompany the work with a written offer, valid for at + least three years, to give the same user the materials + specified in Subsection 6a, above, for a charge no more + than the cost of performing this distribution. + + c) If distribution of the work is made by offering access to copy + from a designated place, offer equivalent access to copy the above + specified materials from the same place. + + d) Verify that the user has already received a copy of these + materials or that you have already sent this user a copy. + + For an executable, the required form of the "work that uses the +Library" must include any data and utility programs needed for +reproducing the executable from it. However, as a special exception, +the source code distributed need not include anything that is normally +distributed (in either source or binary form) with the major +components (compiler, kernel, and so on) of the operating system on +which the executable runs, unless that component itself accompanies +the executable. + + It may happen that this requirement contradicts the license +restrictions of other proprietary libraries that do not normally +accompany the operating system. Such a contradiction means you cannot +use both them and the Library together in an executable that you +distribute. + + 7. You may place library facilities that are a work based on the +Library side-by-side in a single library together with other library +facilities not covered by this License, and distribute such a combined +library, provided that the separate distribution of the work based on +the Library and of the other library facilities is otherwise +permitted, and provided that you do these two things: + + a) Accompany the combined library with a copy of the same work + based on the Library, uncombined with any other library + facilities. This must be distributed under the terms of the + Sections above. + + b) Give prominent notice with the combined library of the fact + that part of it is a work based on the Library, and explaining + where to find the accompanying uncombined form of the same work. + + 8. You may not copy, modify, sublicense, link with, or distribute +the Library except as expressly provided under this License. Any +attempt otherwise to copy, modify, sublicense, link with, or +distribute the Library is void, and will automatically terminate your +rights under this License. However, parties who have received copies, +or rights, from you under this License will not have their licenses +terminated so long as such parties remain in full compliance. + + 9. You are not required to accept this License, since you have not +signed it. However, nothing else grants you permission to modify or +distribute the Library or its derivative works. These actions are +prohibited by law if you do not accept this License. Therefore, by +modifying or distributing the Library (or any work based on the +Library), you indicate your acceptance of this License to do so, and +all its terms and conditions for copying, distributing or modifying +the Library or works based on it. + + 10. Each time you redistribute the Library (or any work based on the +Library), the recipient automatically receives a license from the +original licensor to copy, distribute, link with or modify the Library +subject to these terms and conditions. You may not impose any further +restrictions on the recipients' exercise of the rights granted herein. +You are not responsible for enforcing compliance by third parties to +this License. + + 11. If, as a consequence of a court judgment or allegation of patent +infringement or for any other reason (not limited to patent issues), +conditions are imposed on you (whether by court order, agreement or +otherwise) that contradict the conditions of this License, they do not +excuse you from the conditions of this License. If you cannot +distribute so as to satisfy simultaneously your obligations under this +License and any other pertinent obligations, then as a consequence you +may not distribute the Library at all. For example, if a patent +license would not permit royalty-free redistribution of the Library by +all those who receive copies directly or indirectly through you, then +the only way you could satisfy both it and this License would be to +refrain entirely from distribution of the Library. + +If any portion of this section is held invalid or unenforceable under any +particular circumstance, the balance of the section is intended to apply, +and the section as a whole is intended to apply in other circumstances. + +It is not the purpose of this section to induce you to infringe any +patents or other property right claims or to contest validity of any +such claims; this section has the sole purpose of protecting the +integrity of the free software distribution system which is +implemented by public license practices. Many people have made +generous contributions to the wide range of software distributed +through that system in reliance on consistent application of that +system; it is up to the author/donor to decide if he or she is willing +to distribute software through any other system and a licensee cannot +impose that choice. + +This section is intended to make thoroughly clear what is believed to +be a consequence of the rest of this License. + + 12. If the distribution and/or use of the Library is restricted in +certain countries either by patents or by copyrighted interfaces, the +original copyright holder who places the Library under this License may add +an explicit geographical distribution limitation excluding those countries, +so that distribution is permitted only in or among countries not thus +excluded. In such case, this License incorporates the limitation as if +written in the body of this License. + + 13. The Free Software Foundation may publish revised and/or new +versions of the Library General Public License from time to time. +Such new versions will be similar in spirit to the present version, +but may differ in detail to address new problems or concerns. + +Each version is given a distinguishing version number. If the Library +specifies a version number of this License which applies to it and +"any later version", you have the option of following the terms and +conditions either of that version or of any later version published by +the Free Software Foundation. If the Library does not specify a +license version number, you may choose any version ever published by +the Free Software Foundation. + + 14. If you wish to incorporate parts of the Library into other free +programs whose distribution conditions are incompatible with these, +write to the author to ask for permission. For software which is +copyrighted by the Free Software Foundation, write to the Free +Software Foundation; we sometimes make exceptions for this. Our +decision will be guided by the two goals of preserving the free status +of all derivatives of our free software and of promoting the sharing +and reuse of software generally. + + NO WARRANTY + + 15. BECAUSE THE LIBRARY IS LICENSED FREE OF CHARGE, THERE IS NO +WARRANTY FOR THE LIBRARY, TO THE EXTENT PERMITTED BY APPLICABLE LAW. +EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR +OTHER PARTIES PROVIDE THE LIBRARY "AS IS" WITHOUT WARRANTY OF ANY +KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE +IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR +PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE +LIBRARY IS WITH YOU. SHOULD THE LIBRARY PROVE DEFECTIVE, YOU ASSUME +THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. + + 16. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN +WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY +AND/OR REDISTRIBUTE THE LIBRARY AS PERMITTED ABOVE, BE LIABLE TO YOU +FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR +CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE +LIBRARY (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING +RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A +FAILURE OF THE LIBRARY TO OPERATE WITH ANY OTHER SOFTWARE), EVEN IF +SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH +DAMAGES. + + END OF TERMS AND CONDITIONS + + Appendix: How to Apply These Terms to Your New Libraries + + If you develop a new library, and you want it to be of the greatest +possible use to the public, we recommend making it free software that +everyone can redistribute and change. You can do so by permitting +redistribution under these terms (or, alternatively, under the terms of the +ordinary General Public License). + + To apply these terms, attach the following notices to the library. It is +safest to attach them to the start of each source file to most effectively +convey the exclusion of warranty; and each file should have at least the +"copyright" line and a pointer to where the full notice is found. + + + Copyright (C) + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Library General Public + License as published by the Free Software Foundation; either + version 2 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Library General Public License for more details. + + You should have received a copy of the GNU Library General Public + License along with this library; if not, write to the Free + Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. + +Also add information on how to contact you by electronic and paper mail. + +You should also get your employer (if you work as a programmer) or your +school, if any, to sign a "copyright disclaimer" for the library, if +necessary. Here is a sample; alter the names: + + Yoyodyne, Inc., hereby disclaims all copyright interest in the + library `Frob' (a library for tweaking knobs) written by James Random Hacker. + + , 1 April 1990 + Ty Coon, President of Vice + +That's all there is to it! diff -Naur mxml-2.6/Makefile.in mxml-2.6-haiku/Makefile.in --- mxml-2.6/Makefile.in 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/Makefile.in 2008-12-06 04:20:38.000000000 +0000 @@ -0,0 +1,380 @@ +# +# "$Id: Makefile.in 370 2008-12-06 04:20:38Z mike $" +# +# Makefile for Mini-XML, a small XML-like file parsing library. +# +# Copyright 2003-2008 by Michael Sweet. +# +# This program is free software; you can redistribute it and/or +# modify it under the terms of the GNU Library General Public +# License as published by the Free Software Foundation; either +# version 2, or (at your option) any later version. +# +# This program is distributed in the hope that it will be useful, +# but WITHOUT ANY WARRANTY; without even the implied warranty of +# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +# GNU General Public License for more details. +# + +# +# Compiler tools definitions... +# + +AR = @AR@ +ARFLAGS = @ARFLAGS@ +ARCHFLAGS = @ARCHFLAGS@ +CC = @CC@ +CFLAGS = $(OPTIM) $(ARCHFLAGS) @CFLAGS@ @CPPFLAGS@ @PTHREAD_FLAGS@ +CP = @CP@ +DSO = @DSO@ +DSOFLAGS = @DSOFLAGS@ +LDFLAGS = $(OPTIM) $(ARCHFLAGS) @LDFLAGS@ +INSTALL = @INSTALL@ +LIBMXML = @LIBMXML@ +LIBS = @LIBS@ @PTHREAD_LIBS@ +LN = @LN@ -s +MKDIR = @MKDIR@ +OPTIM = @OPTIM@ +RANLIB = @RANLIB@ +RM = @RM@ -f +SHELL = /bin/sh + + +# +# Configured directories... +# + +prefix = @prefix@ +exec_prefix = @exec_prefix@ +bindir = @bindir@ +datarootdir = @datarootdir@ +includedir = @includedir@ +libdir = @libdir@ +mandir = @mandir@ +docdir = @docdir@ +BUILDROOT = $(DSTROOT) + + +# +# Install commands... +# + +INSTALL_BIN = $(LIBTOOL) $(INSTALL) -m 755 -s +INSTALL_DATA = $(INSTALL) -m 644 +INSTALL_DIR = $(INSTALL) -d +INSTALL_LIB = $(LIBTOOL) $(INSTALL) -m 755 +INSTALL_MAN = $(INSTALL) -m 644 +INSTALL_SCRIPT = $(INSTALL) -m 755 + + +# +# Rules... +# + +.SUFFIXES: .c .man .o +.c.o: + $(CC) $(CFLAGS) -c $< + + +# +# Targets... +# + +DOCFILES = doc/0.gif doc/1.gif doc/2.gif doc/3.gif doc/4.gif \ + doc/A.gif doc/B.gif doc/C.gif doc/D.gif \ + doc/mxml.html doc/mxmldoc.xsd \ + README COPYING CHANGES +PUBLIBOBJS = mxml-attr.o mxml-entity.o mxml-file.o mxml-index.o \ + mxml-node.o mxml-search.o mxml-set.o +LIBOBJS = $(PUBLIBOBJS) mxml-private.o mxml-string.o +OBJS = mxmldoc.o testmxml.o $(LIBOBJS) +TARGETS = $(LIBMXML) mxmldoc testmxml mxml.xml doc/mxml.man + + +# +# Make everything... +# + +all: Makefile config.h $(TARGETS) + + +# +# Clean everything... +# + +clean: + $(RM) $(OBJS) $(TARGETS) + $(RM) mxmldoc-static libmxml.a + + +# +# Really clean everything... +# + +distclean: clean + $(RM) config.cache config.log config.status + $(RM) Makefile config.h + $(RM) -r autom4te*.cache + $(RM) *.bck *.bak + $(RM) -r clang + + +# +# Run the clang.llvm.org static code analysis tool on the C sources. +# + +.PHONY: clang +clang: + $(RM) -r clang + scan-build -k -V -o `pwd`/clang $(MAKE) $(MFLAGS) CC=ccc-analyzer clean all + + +# +# Install everything... +# + +install: $(TARGETS) install-$(LIBMXML) install-libmxml.a + $(INSTALL_DIR) $(BUILDROOT)$(bindir) + $(INSTALL_BIN) mxmldoc $(BUILDROOT)$(bindir) + $(INSTALL_DIR) $(BUILDROOT)$(docdir) + for file in $(DOCFILES); do \ + $(INSTALL_MAN) $$file $(BUILDROOT)$(docdir); \ + done + $(INSTALL_DIR) $(BUILDROOT)$(includedir) + $(INSTALL_DATA) mxml.h $(BUILDROOT)$(includedir) + $(INSTALL_DIR) $(BUILDROOT)$(libdir)/pkgconfig + $(INSTALL_DATA) mxml.pc $(BUILDROOT)$(libdir)/pkgconfig + $(INSTALL_DIR) $(BUILDROOT)$(mandir)/man1 + $(INSTALL_MAN) doc/mxmldoc.man $(BUILDROOT)$(mandir)/man1/mxmldoc.1 + $(INSTALL_DIR) $(BUILDROOT)$(mandir)/man3 + $(INSTALL_MAN) doc/mxml.man $(BUILDROOT)$(mandir)/man3/mxml.3 + +install-libmxml.a: + $(INSTALL_DIR) $(BUILDROOT)$(libdir) + $(INSTALL_LIB) libmxml.a $(BUILDROOT)$(libdir) + $(RANLIB) $(BUILDROOT)$(libdir)/libmxml.a + +install-libmxml.so.1.4: + $(INSTALL_DIR) $(BUILDROOT)$(libdir) + $(INSTALL_LIB) libmxml.so.1.4 $(BUILDROOT)$(libdir) + $(RM) $(BUILDROOT)$(libdir)/libmxml.so + $(LN) libmxml.so.1.4 $(BUILDROOT)$(libdir)/libmxml.so + $(RM) $(BUILDROOT)$(libdir)/libmxml.so.1 + $(LN) libmxml.so.1.4 $(BUILDROOT)$(libdir)/libmxml.so.1 + +install-libmxml.sl.1: + $(INSTALL_DIR) $(BUILDROOT)$(libdir) + $(INSTALL_LIB) libmxml.sl.1 $(BUILDROOT)$(libdir) + $(RM) $(BUILDROOT)$(libdir)/libmxml.so + $(LN) libmxml.sl.1 $(BUILDROOT)$(libdir)/libmxml.sl + +install-libmxml.1.dylib: + $(INSTALL_DIR) $(BUILDROOT)$(libdir) + $(INSTALL_LIB) libmxml.1.dylib $(BUILDROOT)$(libdir) + $(RM) $(BUILDROOT)$(libdir)/libmxml.dylib + $(LN) libmxml.1.dylib $(BUILDROOT)$(libdir)/libmxml.dylib + + +# +# Uninstall everything... +# + +uninstall: uninstall-$(LIBMXML) uninstall-libmxml.a + $(RM) $(BUILDROOT)$(bindir)/mxmldoc + $(RM) -r $(BUILDROOT)$(docdir) + $(RM) $(BUILDROOT)$(includedir)/mxml.h + $(RM) $(BUILDROOT)$(libdir)/pkgconfig/mxml.pc + $(RM) $(BUILDROOT)$(mandir)/man1/mxmldoc.1 + $(RM) $(BUILDROOT)$(mandir)/man3/mxml.3 + +uninstall-libmxml.a: + $(RM) $(BUILDROOT)$(libdir)/libmxml.a + +uninstall-libmxml.so.1.4: + $(RM) $(BUILDROOT)$(libdir)/libmxml.so + $(RM) $(BUILDROOT)$(libdir)/libmxml.so.1 + $(RM) $(BUILDROOT)$(libdir)/libmxml.so.1.4 + +uninstall-libmxml.sl.1: + $(RM) $(BUILDROOT)$(libdir)/libmxml.sl + $(RM) $(BUILDROOT)$(libdir)/libmxml.sl.1 + +uninstall-libmxml.1.dylib: + $(RM) $(BUILDROOT)$(libdir)/libmxml.dylib + $(RM) $(BUILDROOT)$(libdir)/libmxml.1.dylib + + +# +# Make packages using EPM (http://www.easysw.com/epm/) +# + +epm: all + epm --output-dir dist -v -f native mxml + epm --output-dir dist -v -f portable mxml + + +# +# autoconf stuff... +# + +Makefile: configure Makefile.in + if test -f config.status; then \ + ./config.status --recheck; \ + ./config.status; \ + else \ + ./configure; \ + fi + touch config.h + + +config.h: configure config.h.in + autoconf + if test -f config.status; then \ + ./config.status --recheck; \ + ./config.status; \ + else \ + ./configure; \ + fi + touch config.h + + +# +# libmxml.a +# + +libmxml.a: $(LIBOBJS) + $(RM) $@ + $(AR) $(ARFLAGS) $@ $(LIBOBJS) + $(RANLIB) $@ + +$(LIBOBJS): mxml.h +mxml-entity.o mxml-file.o mxml-private.o: mxml-private.h + + +# +# libmxml.so.1.4 +# + +libmxml.so.1.4: $(LIBOBJS) + $(DSO) $(DSOFLAGS) -o libmxml.so.1.4 $(LIBOBJS) + $(RM) libmxml.so libmxml.so.1 + $(LN) libmxml.so.1.4 libmxml.so + $(LN) libmxml.so.1.4 libmxml.so.1 + + +# +# libmxml.sl.1 +# + +libmxml.sl.1: $(LIBOBJS) + $(DSO) $(DSOFLAGS) -o libmxml.sl.1 $(LIBOBJS) + $(RM) libmxml.sl + $(LN) libmxml.sl.1 libmxml.sl + + +# +# libmxml.1.dylib +# + +libmxml.1.dylib: $(LIBOBJS) + $(DSO) $(DSOFLAGS) -o libmxml.1.dylib \ + -install_name $(libdir)/libmxml.dylib \ + -current_version 1.4.0 \ + -compatibility_version 1.0.0 \ + $(LIBOBJS) + $(RM) libmxml.dylib + $(LN) libmxml.1.dylib libmxml.dylib + + +# +# mxmldoc +# + +mxmldoc: $(LIBMXML) mxmldoc.o + $(CC) -L. $(LDFLAGS) -o $@ mxmldoc.o -lmxml $(LIBS) + +mxmldoc-static: libmxml.a mxmldoc.o + $(CC) $(LDFLAGS) -o $@ mxmldoc.o libmxml.a $(LIBS) + +mxmldoc.o: mxml.h + + +# +# testmxml +# + +testmxml: libmxml.a testmxml.o + $(CC) $(LDFLAGS) -o $@ testmxml.o libmxml.a $(LIBS) + @echo Testing library... + ./testmxml test.xml >temp1.xml 2>temp1s.xml + ./testmxml temp1.xml >temp2.xml 2>temp2s.xml + @if cmp temp1.xml temp2.xml; then \ + echo Stdio file test passed!; \ + $(RM) temp2.xml temp2s.xml; \ + else \ + echo Stdio file test failed!; \ + fi + @if cmp temp1.xml temp1s.xml; then \ + echo String test passed!; \ + $(RM) temp1.xml temp1s.xml; \ + else \ + echo String test failed!; \ + fi + @if cmp test.xml test.xmlfd; then \ + echo File descriptor test passed!; \ + $(RM) test.xmlfd; \ + else \ + echo File descriptor test failed!; \ + fi + +testmxml.o: mxml.h + + +# +# mxml.xml +# + +mxml.xml: mxmldoc-static mxml.h $(PUBLIBOBJS:.o=.c) + $(RM) mxml.xml + ./mxmldoc-static --header doc/reference.heading mxml.xml mxml.h $(PUBLIBOBJS:.o=.c) >doc/reference.html + if test "x`uname`" = xDarwin; then \ + ./mxmldoc-static --docset org.minixml.docset \ + --docversion @VERSION@ --feedname minixml.org \ + --feedurl http://www.minixml.org/org.minixml.atom \ + --header doc/docset.header --intro doc/docset.intro \ + --css doc/docset.css --title "Mini-XML API Reference" \ + mxml.xml || exit 1; \ + /Developer/usr/bin/docsetutil package --output org.minixml.xar \ + --atom org.minixml.atom \ + --download-url http://www.minixml.org/org.minixml.xar \ + org.minixml.docset || exit 1; \ + fi + +valgrind: mxmldoc-static + $(RM) valgrind.xml + valgrind --tool=memcheck --leak-check=yes ./mxmldoc-static \ + valgrind.xml mxml.h $(PUBLIBOBJS:.o=.c) \ + >valgrind.html 2>valgrind.out + + +# +# doc/mxml.man +# + +doc/mxml.man: mxmldoc-static mxml.xml + $(RM) doc/mxml.man + ./mxmldoc-static --man mxml --title "Mini-XML API" \ + --intro doc/intro.man --footer doc/footer.man \ + mxml.xml >doc/mxml.man + + +# +# All object files depend on the makefile... +# + +$(OBJS): Makefile config.h + + +# +# End of "$Id: Makefile.in 370 2008-12-06 04:20:38Z mike $". +# diff -Naur mxml-2.6/README mxml-2.6-haiku/README --- mxml-2.6/README 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/README 2009-05-17 17:17:46.000000000 +0000 @@ -0,0 +1,177 @@ +README - 2009-05-17 +------------------- + + +INTRODUCTION + + This README file describes the Mini-XML library version 2.6. + + Mini-XML is a small XML parsing library that you can use to read XML and + XML-like data files in your application without requiring large non-standard + libraries. Mini-XML only requires an ANSI C compatible compiler (GCC works, + as do most vendors' ANSI C compilers) and a "make" program. + + Mini-XML provides the following functionality: + + - Reading of UTF-8 and UTF-16 and writing of UTF-8 encoded XML files and + strings. + - Data is stored in a linked-list tree structure, preserving the XML + data hierarchy. + - Supports arbitrary element names, attributes, and attribute values + with no preset limits, just available memory. + - Supports integer, real, opaque ("cdata"), and text data types in + "leaf" nodes. + - Functions for creating and managing trees of data. + - "Find" and "walk" functions for easily locating and navigating trees + of data. + + Mini-XML doesn't do validation or other types of processing on the data + based upon schema files or other sources of definition information. + + +BUILDING Mini-XML + + Mini-XML comes with an autoconf-based configure script; just type the + following command to get things going: + + ./configure + + The default install prefix is /usr/local, which can be overridden using the + --prefix option: + + ./configure --prefix=/foo + + Other configure options can be found using the --help option: + + ./configure --help + + Once you have configured the software, type "make" to do the build and run + the test program to verify that things are working, as follows: + + make + + If you are using Mini-XML under Microsoft Windows with Visual C++ 2008, use + the included project files in the "vcnet" subdirectory to build the library + instead. + + +INSTALLING Mini-XML + + The "install" target will install Mini-XML in the lib and include + directories: + + make install + + Once you have installed it, use the "-lmxml" option to link your application + against it. + + +DOCUMENTATION + + The documentation is available in the "doc" subdirectory in the files + "mxml.html" (HTML) and "mxml.pdf" (PDF). You can also look at the + "testmxml.c" and "mxmldoc.c" source files for examples of using Mini-XML. + + Mini-XML provides a single header file which you include: + + #include + + Nodes are defined by the "mxml_node_t" structure; the "type" member defines + the node type (element, integer, opaque, real, or text) which determines + which value you want to look at in the "value" union. New nodes can be + created using the "mxmlNewElement()", "mxmlNewInteger()", "mxmlNewOpaque()", + "mxmlNewReal()", and "mxmlNewText()" functions. Only elements can have + child nodes, and the top node must be an element, usually "?xml". + + You load an XML file using the "mxmlLoadFile()" function: + + FILE *fp; + mxml_node_t *tree; + + fp = fopen("filename.xml", "r"); + tree = mxmlLoadFile(NULL, fp, MXML_NO_CALLBACK); + fclose(fp); + + Similarly, you save an XML file using the "mxmlSaveFile()" function: + + FILE *fp; + mxml_node_t *tree; + + fp = fopen("filename.xml", "w"); + mxmlSaveFile(tree, fp, MXML_NO_CALLBACK); + fclose(fp); + + The "mxmlLoadString()", "mxmlSaveAllocString()", and "mxmlSaveString()" + functions load XML node trees from and save XML node trees to strings: + + char buffer[8192]; + char *ptr; + mxml_node_t *tree; + + ... + tree = mxmlLoadString(NULL, buffer, MXML_NO_CALLBACK); + + ... + mxmlSaveString(tree, buffer, sizeof(buffer), MXML_NO_CALLBACK); + + ... + ptr = mxmlSaveAllocString(tree, MXML_NO_CALLBACK); + + You can find a named element/node using the "mxmlFindElement()" function: + + mxml_node_t *node = mxmlFindElement(tree, tree, "name", "attr", + "value", MXML_DESCEND); + + The "name", "attr", and "value" arguments can be passed as NULL to act as + wildcards, e.g.: + + /* Find the first "a" element */ + node = mxmlFindElement(tree, tree, "a", NULL, NULL, MXML_DESCEND); + + /* Find the first "a" element with "href" attribute */ + node = mxmlFindElement(tree, tree, "a", "href", NULL, MXML_DESCEND); + + /* Find the first "a" element with "href" to a URL */ + node = mxmlFindElement(tree, tree, "a", "href", + "http://www.easysw.com/~mike/mxml/", + MXML_DESCEND); + + /* Find the first element with a "src" attribute*/ + node = mxmlFindElement(tree, tree, NULL, "src", NULL, MXML_DESCEND); + + /* Find the first element with a "src" = "foo.jpg" */ + node = mxmlFindElement(tree, tree, NULL, "src", "foo.jpg", + MXML_DESCEND); + + You can also iterate with the same function: + + mxml_node_t *node; + + for (node = mxmlFindElement(tree, tree, "name", NULL, NULL, + MXML_DESCEND); + node != NULL; + node = mxmlFindElement(node, tree, "name", NULL, NULL, + MXML_DESCEND)) + { + ... do something ... + } + + Finally, once you are done with the XML data, use the "mxmlDelete()" + function to recursively free the memory that is used for a particular node + or the entire tree: + + mxmlDelete(tree); + + +GETTING HELP AND REPORTING PROBLEMS + + The Mini-XML web site provides access to a discussion forum and bug + reporting page: + + http://www.minixml.org/ + + +LEGAL STUFF + + The Mini-XML library is Copyright 2003-2009 by Michael Sweet. License terms + are described in the file "COPYING". diff -Naur mxml-2.6/config.h.in mxml-2.6-haiku/config.h.in --- mxml-2.6/config.h.in 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/config.h.in 2009-04-18 17:05:52.000000000 +0000 @@ -0,0 +1,97 @@ +/* + * "$Id: config.h.in 387 2009-04-18 17:05:52Z mike $" + * + * Configuration file for Mini-XML, a small XML-like file parsing library. + * + * Copyright 2003-2009 by Michael Sweet. + * + * This program is free software; you can redistribute it and/or + * modify it under the terms of the GNU Library General Public + * License as published by the Free Software Foundation; either + * version 2, or (at your option) any later version. + * + * This program is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU General Public License for more details. + */ + +/* + * Include necessary headers... + */ + +#include +#include +#include +#include +#include + + +/* + * Version number... + */ + +#define MXML_VERSION "" + + +/* + * Inline function support... + */ + +#define inline + + +/* + * Long long support... + */ + +#undef HAVE_LONG_LONG + + +/* + * Do we have the snprintf() and vsnprintf() functions? + */ + +#undef HAVE_SNPRINTF +#undef HAVE_VSNPRINTF + + +/* + * Do we have the strXXX() functions? + */ + +#undef HAVE_STRDUP + + +/* + * Do we have threading support? + */ + +#undef HAVE_PTHREAD_H + + +/* + * Define prototypes for string functions as needed... + */ + +# ifndef HAVE_STRDUP +extern char *_mxml_strdup(const char *); +# define strdup _mxml_strdup +# endif /* !HAVE_STRDUP */ + +extern char *_mxml_strdupf(const char *, ...); +extern char *_mxml_vstrdupf(const char *, va_list); + +# ifndef HAVE_SNPRINTF +extern int _mxml_snprintf(char *, size_t, const char *, ...); +# define snprintf _mxml_snprintf +# endif /* !HAVE_SNPRINTF */ + +# ifndef HAVE_VSNPRINTF +extern int _mxml_vsnprintf(char *, size_t, const char *, va_list); +# define vsnprintf _mxml_vsnprintf +# endif /* !HAVE_VSNPRINTF */ + +/* + * End of "$Id: config.h.in 387 2009-04-18 17:05:52Z mike $". + */ diff -Naur mxml-2.6/configure mxml-2.6-haiku/configure --- mxml-2.6/configure 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/configure 2009-04-18 17:05:52.000000000 +0000 @@ -0,0 +1,5974 @@ +#! /bin/sh +# Guess values for system-dependent variables and create Makefiles. +# Generated by GNU Autoconf 2.61. +# +# Copyright (C) 1992, 1993, 1994, 1995, 1996, 1998, 1999, 2000, 2001, +# 2002, 2003, 2004, 2005, 2006 Free Software Foundation, Inc. +# This configure script is free software; the Free Software Foundation +# gives unlimited permission to copy, distribute and modify it. +## --------------------- ## +## M4sh Initialization. ## +## --------------------- ## + +# Be more Bourne compatible +DUALCASE=1; export DUALCASE # for MKS sh +if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then + emulate sh + NULLCMD=: + # Zsh 3.x and 4.x performs word splitting on ${1+"$@"}, which + # is contrary to our usage. Disable this feature. + alias -g '${1+"$@"}'='"$@"' + setopt NO_GLOB_SUBST +else + case `(set -o) 2>/dev/null` in + *posix*) set -o posix ;; +esac + +fi + + + + +# PATH needs CR +# Avoid depending upon Character Ranges. +as_cr_letters='abcdefghijklmnopqrstuvwxyz' +as_cr_LETTERS='ABCDEFGHIJKLMNOPQRSTUVWXYZ' +as_cr_Letters=$as_cr_letters$as_cr_LETTERS +as_cr_digits='0123456789' +as_cr_alnum=$as_cr_Letters$as_cr_digits + +# The user is always right. +if test "${PATH_SEPARATOR+set}" != set; then + echo "#! /bin/sh" >conf$$.sh + echo "exit 0" >>conf$$.sh + chmod +x conf$$.sh + if (PATH="/nonexistent;."; conf$$.sh) >/dev/null 2>&1; then + PATH_SEPARATOR=';' + else + PATH_SEPARATOR=: + fi + rm -f conf$$.sh +fi + +# Support unset when possible. +if ( (MAIL=60; unset MAIL) || exit) >/dev/null 2>&1; then + as_unset=unset +else + as_unset=false +fi + + +# IFS +# We need space, tab and new line, in precisely that order. Quoting is +# there to prevent editors from complaining about space-tab. +# (If _AS_PATH_WALK were called with IFS unset, it would disable word +# splitting by setting IFS to empty value.) +as_nl=' +' +IFS=" "" $as_nl" + +# Find who we are. Look in the path if we contain no directory separator. +case $0 in + *[\\/]* ) as_myself=$0 ;; + *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in $PATH +do + IFS=$as_save_IFS + test -z "$as_dir" && as_dir=. + test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break +done +IFS=$as_save_IFS + + ;; +esac +# We did not find ourselves, most probably we were run as `sh COMMAND' +# in which case we are not to be found in the path. +if test "x$as_myself" = x; then + as_myself=$0 +fi +if test ! -f "$as_myself"; then + echo "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2 + { (exit 1); exit 1; } +fi + +# Work around bugs in pre-3.0 UWIN ksh. +for as_var in ENV MAIL MAILPATH +do ($as_unset $as_var) >/dev/null 2>&1 && $as_unset $as_var +done +PS1='$ ' +PS2='> ' +PS4='+ ' + +# NLS nuisances. +for as_var in \ + LANG LANGUAGE LC_ADDRESS LC_ALL LC_COLLATE LC_CTYPE LC_IDENTIFICATION \ + LC_MEASUREMENT LC_MESSAGES LC_MONETARY LC_NAME LC_NUMERIC LC_PAPER \ + LC_TELEPHONE LC_TIME +do + if (set +x; test -z "`(eval $as_var=C; export $as_var) 2>&1`"); then + eval $as_var=C; export $as_var + else + ($as_unset $as_var) >/dev/null 2>&1 && $as_unset $as_var + fi +done + +# Required to use basename. +if expr a : '\(a\)' >/dev/null 2>&1 && + test "X`expr 00001 : '.*\(...\)'`" = X001; then + as_expr=expr +else + as_expr=false +fi + +if (basename -- /) >/dev/null 2>&1 && test "X`basename -- / 2>&1`" = "X/"; then + as_basename=basename +else + as_basename=false +fi + + +# Name of the executable. +as_me=`$as_basename -- "$0" || +$as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \ + X"$0" : 'X\(//\)$' \| \ + X"$0" : 'X\(/\)' \| . 2>/dev/null || +echo X/"$0" | + sed '/^.*\/\([^/][^/]*\)\/*$/{ + s//\1/ + q + } + /^X\/\(\/\/\)$/{ + s//\1/ + q + } + /^X\/\(\/\).*/{ + s//\1/ + q + } + s/.*/./; q'` + +# CDPATH. +$as_unset CDPATH + + +if test "x$CONFIG_SHELL" = x; then + if (eval ":") 2>/dev/null; then + as_have_required=yes +else + as_have_required=no +fi + + if test $as_have_required = yes && (eval ": +(as_func_return () { + (exit \$1) +} +as_func_success () { + as_func_return 0 +} +as_func_failure () { + as_func_return 1 +} +as_func_ret_success () { + return 0 +} +as_func_ret_failure () { + return 1 +} + +exitcode=0 +if as_func_success; then + : +else + exitcode=1 + echo as_func_success failed. +fi + +if as_func_failure; then + exitcode=1 + echo as_func_failure succeeded. +fi + +if as_func_ret_success; then + : +else + exitcode=1 + echo as_func_ret_success failed. +fi + +if as_func_ret_failure; then + exitcode=1 + echo as_func_ret_failure succeeded. +fi + +if ( set x; as_func_ret_success y && test x = \"\$1\" ); then + : +else + exitcode=1 + echo positional parameters were not saved. +fi + +test \$exitcode = 0) || { (exit 1); exit 1; } + +( + as_lineno_1=\$LINENO + as_lineno_2=\$LINENO + test \"x\$as_lineno_1\" != \"x\$as_lineno_2\" && + test \"x\`expr \$as_lineno_1 + 1\`\" = \"x\$as_lineno_2\") || { (exit 1); exit 1; } +") 2> /dev/null; then + : +else + as_candidate_shells= + as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in /bin$PATH_SEPARATOR/usr/bin$PATH_SEPARATOR$PATH +do + IFS=$as_save_IFS + test -z "$as_dir" && as_dir=. + case $as_dir in + /*) + for as_base in sh bash ksh sh5; do + as_candidate_shells="$as_candidate_shells $as_dir/$as_base" + done;; + esac +done +IFS=$as_save_IFS + + + for as_shell in $as_candidate_shells $SHELL; do + # Try only shells that exist, to save several forks. + if { test -f "$as_shell" || test -f "$as_shell.exe"; } && + { ("$as_shell") 2> /dev/null <<\_ASEOF +if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then + emulate sh + NULLCMD=: + # Zsh 3.x and 4.x performs word splitting on ${1+"$@"}, which + # is contrary to our usage. Disable this feature. + alias -g '${1+"$@"}'='"$@"' + setopt NO_GLOB_SUBST +else + case `(set -o) 2>/dev/null` in + *posix*) set -o posix ;; +esac + +fi + + +: +_ASEOF +}; then + CONFIG_SHELL=$as_shell + as_have_required=yes + if { "$as_shell" 2> /dev/null <<\_ASEOF +if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then + emulate sh + NULLCMD=: + # Zsh 3.x and 4.x performs word splitting on ${1+"$@"}, which + # is contrary to our usage. Disable this feature. + alias -g '${1+"$@"}'='"$@"' + setopt NO_GLOB_SUBST +else + case `(set -o) 2>/dev/null` in + *posix*) set -o posix ;; +esac + +fi + + +: +(as_func_return () { + (exit $1) +} +as_func_success () { + as_func_return 0 +} +as_func_failure () { + as_func_return 1 +} +as_func_ret_success () { + return 0 +} +as_func_ret_failure () { + return 1 +} + +exitcode=0 +if as_func_success; then + : +else + exitcode=1 + echo as_func_success failed. +fi + +if as_func_failure; then + exitcode=1 + echo as_func_failure succeeded. +fi + +if as_func_ret_success; then + : +else + exitcode=1 + echo as_func_ret_success failed. +fi + +if as_func_ret_failure; then + exitcode=1 + echo as_func_ret_failure succeeded. +fi + +if ( set x; as_func_ret_success y && test x = "$1" ); then + : +else + exitcode=1 + echo positional parameters were not saved. +fi + +test $exitcode = 0) || { (exit 1); exit 1; } + +( + as_lineno_1=$LINENO + as_lineno_2=$LINENO + test "x$as_lineno_1" != "x$as_lineno_2" && + test "x`expr $as_lineno_1 + 1`" = "x$as_lineno_2") || { (exit 1); exit 1; } + +_ASEOF +}; then + break +fi + +fi + + done + + if test "x$CONFIG_SHELL" != x; then + for as_var in BASH_ENV ENV + do ($as_unset $as_var) >/dev/null 2>&1 && $as_unset $as_var + done + export CONFIG_SHELL + exec "$CONFIG_SHELL" "$as_myself" ${1+"$@"} +fi + + + if test $as_have_required = no; then + echo This script requires a shell more modern than all the + echo shells that I found on your system. Please install a + echo modern shell, or manually run the script under such a + echo shell if you do have one. + { (exit 1); exit 1; } +fi + + +fi + +fi + + + +(eval "as_func_return () { + (exit \$1) +} +as_func_success () { + as_func_return 0 +} +as_func_failure () { + as_func_return 1 +} +as_func_ret_success () { + return 0 +} +as_func_ret_failure () { + return 1 +} + +exitcode=0 +if as_func_success; then + : +else + exitcode=1 + echo as_func_success failed. +fi + +if as_func_failure; then + exitcode=1 + echo as_func_failure succeeded. +fi + +if as_func_ret_success; then + : +else + exitcode=1 + echo as_func_ret_success failed. +fi + +if as_func_ret_failure; then + exitcode=1 + echo as_func_ret_failure succeeded. +fi + +if ( set x; as_func_ret_success y && test x = \"\$1\" ); then + : +else + exitcode=1 + echo positional parameters were not saved. +fi + +test \$exitcode = 0") || { + echo No shell found that supports shell functions. + echo Please tell autoconf@gnu.org about your system, + echo including any error possibly output before this + echo message +} + + + + as_lineno_1=$LINENO + as_lineno_2=$LINENO + test "x$as_lineno_1" != "x$as_lineno_2" && + test "x`expr $as_lineno_1 + 1`" = "x$as_lineno_2" || { + + # Create $as_me.lineno as a copy of $as_myself, but with $LINENO + # uniformly replaced by the line number. The first 'sed' inserts a + # line-number line after each line using $LINENO; the second 'sed' + # does the real work. The second script uses 'N' to pair each + # line-number line with the line containing $LINENO, and appends + # trailing '-' during substitution so that $LINENO is not a special + # case at line end. + # (Raja R Harinath suggested sed '=', and Paul Eggert wrote the + # scripts with optimization help from Paolo Bonzini. Blame Lee + # E. McMahon (1931-1989) for sed's syntax. :-) + sed -n ' + p + /[$]LINENO/= + ' <$as_myself | + sed ' + s/[$]LINENO.*/&-/ + t lineno + b + :lineno + N + :loop + s/[$]LINENO\([^'$as_cr_alnum'_].*\n\)\(.*\)/\2\1\2/ + t loop + s/-\n.*// + ' >$as_me.lineno && + chmod +x "$as_me.lineno" || + { echo "$as_me: error: cannot create $as_me.lineno; rerun with a POSIX shell" >&2 + { (exit 1); exit 1; }; } + + # Don't try to exec as it changes $[0], causing all sort of problems + # (the dirname of $[0] is not the place where we might find the + # original and so on. Autoconf is especially sensitive to this). + . "./$as_me.lineno" + # Exit status is that of the last command. + exit +} + + +if (as_dir=`dirname -- /` && test "X$as_dir" = X/) >/dev/null 2>&1; then + as_dirname=dirname +else + as_dirname=false +fi + +ECHO_C= ECHO_N= ECHO_T= +case `echo -n x` in +-n*) + case `echo 'x\c'` in + *c*) ECHO_T=' ';; # ECHO_T is single tab character. + *) ECHO_C='\c';; + esac;; +*) + ECHO_N='-n';; +esac + +if expr a : '\(a\)' >/dev/null 2>&1 && + test "X`expr 00001 : '.*\(...\)'`" = X001; then + as_expr=expr +else + as_expr=false +fi + +rm -f conf$$ conf$$.exe conf$$.file +if test -d conf$$.dir; then + rm -f conf$$.dir/conf$$.file +else + rm -f conf$$.dir + mkdir conf$$.dir +fi +echo >conf$$.file +if ln -s conf$$.file conf$$ 2>/dev/null; then + as_ln_s='ln -s' + # ... but there are two gotchas: + # 1) On MSYS, both `ln -s file dir' and `ln file dir' fail. + # 2) DJGPP < 2.04 has no symlinks; `ln -s' creates a wrapper executable. + # In both cases, we have to default to `cp -p'. + ln -s conf$$.file conf$$.dir 2>/dev/null && test ! -f conf$$.exe || + as_ln_s='cp -p' +elif ln conf$$.file conf$$ 2>/dev/null; then + as_ln_s=ln +else + as_ln_s='cp -p' +fi +rm -f conf$$ conf$$.exe conf$$.dir/conf$$.file conf$$.file +rmdir conf$$.dir 2>/dev/null + +if mkdir -p . 2>/dev/null; then + as_mkdir_p=: +else + test -d ./-p && rmdir ./-p + as_mkdir_p=false +fi + +if test -x / >/dev/null 2>&1; then + as_test_x='test -x' +else + if ls -dL / >/dev/null 2>&1; then + as_ls_L_option=L + else + as_ls_L_option= + fi + as_test_x=' + eval sh -c '\'' + if test -d "$1"; then + test -d "$1/."; + else + case $1 in + -*)set "./$1";; + esac; + case `ls -ld'$as_ls_L_option' "$1" 2>/dev/null` in + ???[sx]*):;;*)false;;esac;fi + '\'' sh + ' +fi +as_executable_p=$as_test_x + +# Sed expression to map a string onto a valid CPP name. +as_tr_cpp="eval sed 'y%*$as_cr_letters%P$as_cr_LETTERS%;s%[^_$as_cr_alnum]%_%g'" + +# Sed expression to map a string onto a valid variable name. +as_tr_sh="eval sed 'y%*+%pp%;s%[^_$as_cr_alnum]%_%g'" + + + +exec 7<&0 &1 + +# Name of the host. +# hostname on some systems (SVR3.2, Linux) returns a bogus exit status, +# so uname gets run too. +ac_hostname=`(hostname || uname -n) 2>/dev/null | sed 1q` + +# +# Initializations. +# +ac_default_prefix=/usr/local +ac_clean_files= +ac_config_libobj_dir=. +LIBOBJS= +cross_compiling=no +subdirs= +MFLAGS= +MAKEFLAGS= +SHELL=${CONFIG_SHELL-/bin/sh} + +# Identity of this package. +PACKAGE_NAME= +PACKAGE_TARNAME= +PACKAGE_VERSION= +PACKAGE_STRING= +PACKAGE_BUGREPORT= + +ac_unique_file="mxml.h" +# Factoring default headers for most tests. +ac_includes_default="\ +#include +#ifdef HAVE_SYS_TYPES_H +# include +#endif +#ifdef HAVE_SYS_STAT_H +# include +#endif +#ifdef STDC_HEADERS +# include +# include +#else +# ifdef HAVE_STDLIB_H +# include +# endif +#endif +#ifdef HAVE_STRING_H +# if !defined STDC_HEADERS && defined HAVE_MEMORY_H +# include +# endif +# include +#endif +#ifdef HAVE_STRINGS_H +# include +#endif +#ifdef HAVE_INTTYPES_H +# include +#endif +#ifdef HAVE_STDINT_H +# include +#endif +#ifdef HAVE_UNISTD_H +# include +#endif" + +ac_subst_vars='SHELL +PATH_SEPARATOR +PACKAGE_NAME +PACKAGE_TARNAME +PACKAGE_VERSION +PACKAGE_STRING +PACKAGE_BUGREPORT +exec_prefix +prefix +program_transform_name +bindir +sbindir +libexecdir +datarootdir +datadir +sysconfdir +sharedstatedir +localstatedir +includedir +oldincludedir +docdir +infodir +htmldir +dvidir +pdfdir +psdir +libdir +localedir +mandir +DEFS +ECHO_C +ECHO_N +ECHO_T +LIBS +build_alias +host_alias +target_alias +VERSION +LDFLAGS +OPTIM +ARCHFLAGS +CC +CFLAGS +CPPFLAGS +ac_ct_CC +EXEEXT +OBJEXT +CXX +CXXFLAGS +ac_ct_CXX +INSTALL_PROGRAM +INSTALL_SCRIPT +INSTALL_DATA +RANLIB +AR +CP +LN +MKDIR +RM +ARFLAGS +CPP +GREP +EGREP +PTHREAD_FLAGS +PTHREAD_LIBS +DSO +DSOFLAGS +LIBMXML +PICFLAG +PC_CFLAGS +PC_LIBS +LIBOBJS +LTLIBOBJS' +ac_subst_files='' + ac_precious_vars='build_alias +host_alias +target_alias +CC +CFLAGS +LDFLAGS +LIBS +CPPFLAGS +CXX +CXXFLAGS +CCC +CPP' + + +# Initialize some variables set by options. +ac_init_help= +ac_init_version=false +# The variables have the same names as the options, with +# dashes changed to underlines. +cache_file=/dev/null +exec_prefix=NONE +no_create= +no_recursion= +prefix=NONE +program_prefix=NONE +program_suffix=NONE +program_transform_name=s,x,x, +silent= +site= +srcdir= +verbose= +x_includes=NONE +x_libraries=NONE + +# Installation directory options. +# These are left unexpanded so users can "make install exec_prefix=/foo" +# and all the variables that are supposed to be based on exec_prefix +# by default will actually change. +# Use braces instead of parens because sh, perl, etc. also accept them. +# (The list follows the same order as the GNU Coding Standards.) +bindir='${exec_prefix}/bin' +sbindir='${exec_prefix}/sbin' +libexecdir='${exec_prefix}/libexec' +datarootdir='${prefix}/share' +datadir='${datarootdir}' +sysconfdir='${prefix}/etc' +sharedstatedir='${prefix}/com' +localstatedir='${prefix}/var' +includedir='${prefix}/include' +oldincludedir='/usr/include' +docdir='${datarootdir}/doc/${PACKAGE}' +infodir='${datarootdir}/info' +htmldir='${docdir}' +dvidir='${docdir}' +pdfdir='${docdir}' +psdir='${docdir}' +libdir='${exec_prefix}/lib' +localedir='${datarootdir}/locale' +mandir='${datarootdir}/man' + +ac_prev= +ac_dashdash= +for ac_option +do + # If the previous option needs an argument, assign it. + if test -n "$ac_prev"; then + eval $ac_prev=\$ac_option + ac_prev= + continue + fi + + case $ac_option in + *=*) ac_optarg=`expr "X$ac_option" : '[^=]*=\(.*\)'` ;; + *) ac_optarg=yes ;; + esac + + # Accept the important Cygnus configure options, so we can diagnose typos. + + case $ac_dashdash$ac_option in + --) + ac_dashdash=yes ;; + + -bindir | --bindir | --bindi | --bind | --bin | --bi) + ac_prev=bindir ;; + -bindir=* | --bindir=* | --bindi=* | --bind=* | --bin=* | --bi=*) + bindir=$ac_optarg ;; + + -build | --build | --buil | --bui | --bu) + ac_prev=build_alias ;; + -build=* | --build=* | --buil=* | --bui=* | --bu=*) + build_alias=$ac_optarg ;; + + -cache-file | --cache-file | --cache-fil | --cache-fi \ + | --cache-f | --cache- | --cache | --cach | --cac | --ca | --c) + ac_prev=cache_file ;; + -cache-file=* | --cache-file=* | --cache-fil=* | --cache-fi=* \ + | --cache-f=* | --cache-=* | --cache=* | --cach=* | --cac=* | --ca=* | --c=*) + cache_file=$ac_optarg ;; + + --config-cache | -C) + cache_file=config.cache ;; + + -datadir | --datadir | --datadi | --datad) + ac_prev=datadir ;; + -datadir=* | --datadir=* | --datadi=* | --datad=*) + datadir=$ac_optarg ;; + + -datarootdir | --datarootdir | --datarootdi | --datarootd | --dataroot \ + | --dataroo | --dataro | --datar) + ac_prev=datarootdir ;; + -datarootdir=* | --datarootdir=* | --datarootdi=* | --datarootd=* \ + | --dataroot=* | --dataroo=* | --dataro=* | --datar=*) + datarootdir=$ac_optarg ;; + + -disable-* | --disable-*) + ac_feature=`expr "x$ac_option" : 'x-*disable-\(.*\)'` + # Reject names that are not valid shell variable names. + expr "x$ac_feature" : ".*[^-._$as_cr_alnum]" >/dev/null && + { echo "$as_me: error: invalid feature name: $ac_feature" >&2 + { (exit 1); exit 1; }; } + ac_feature=`echo $ac_feature | sed 's/[-.]/_/g'` + eval enable_$ac_feature=no ;; + + -docdir | --docdir | --docdi | --doc | --do) + ac_prev=docdir ;; + -docdir=* | --docdir=* | --docdi=* | --doc=* | --do=*) + docdir=$ac_optarg ;; + + -dvidir | --dvidir | --dvidi | --dvid | --dvi | --dv) + ac_prev=dvidir ;; + -dvidir=* | --dvidir=* | --dvidi=* | --dvid=* | --dvi=* | --dv=*) + dvidir=$ac_optarg ;; + + -enable-* | --enable-*) + ac_feature=`expr "x$ac_option" : 'x-*enable-\([^=]*\)'` + # Reject names that are not valid shell variable names. + expr "x$ac_feature" : ".*[^-._$as_cr_alnum]" >/dev/null && + { echo "$as_me: error: invalid feature name: $ac_feature" >&2 + { (exit 1); exit 1; }; } + ac_feature=`echo $ac_feature | sed 's/[-.]/_/g'` + eval enable_$ac_feature=\$ac_optarg ;; + + -exec-prefix | --exec_prefix | --exec-prefix | --exec-prefi \ + | --exec-pref | --exec-pre | --exec-pr | --exec-p | --exec- \ + | --exec | --exe | --ex) + ac_prev=exec_prefix ;; + -exec-prefix=* | --exec_prefix=* | --exec-prefix=* | --exec-prefi=* \ + | --exec-pref=* | --exec-pre=* | --exec-pr=* | --exec-p=* | --exec-=* \ + | --exec=* | --exe=* | --ex=*) + exec_prefix=$ac_optarg ;; + + -gas | --gas | --ga | --g) + # Obsolete; use --with-gas. + with_gas=yes ;; + + -help | --help | --hel | --he | -h) + ac_init_help=long ;; + -help=r* | --help=r* | --hel=r* | --he=r* | -hr*) + ac_init_help=recursive ;; + -help=s* | --help=s* | --hel=s* | --he=s* | -hs*) + ac_init_help=short ;; + + -host | --host | --hos | --ho) + ac_prev=host_alias ;; + -host=* | --host=* | --hos=* | --ho=*) + host_alias=$ac_optarg ;; + + -htmldir | --htmldir | --htmldi | --htmld | --html | --htm | --ht) + ac_prev=htmldir ;; + -htmldir=* | --htmldir=* | --htmldi=* | --htmld=* | --html=* | --htm=* \ + | --ht=*) + htmldir=$ac_optarg ;; + + -includedir | --includedir | --includedi | --included | --include \ + | --includ | --inclu | --incl | --inc) + ac_prev=includedir ;; + -includedir=* | --includedir=* | --includedi=* | --included=* | --include=* \ + | --includ=* | --inclu=* | --incl=* | --inc=*) + includedir=$ac_optarg ;; + + -infodir | --infodir | --infodi | --infod | --info | --inf) + ac_prev=infodir ;; + -infodir=* | --infodir=* | --infodi=* | --infod=* | --info=* | --inf=*) + infodir=$ac_optarg ;; + + -libdir | --libdir | --libdi | --libd) + ac_prev=libdir ;; + -libdir=* | --libdir=* | --libdi=* | --libd=*) + libdir=$ac_optarg ;; + + -libexecdir | --libexecdir | --libexecdi | --libexecd | --libexec \ + | --libexe | --libex | --libe) + ac_prev=libexecdir ;; + -libexecdir=* | --libexecdir=* | --libexecdi=* | --libexecd=* | --libexec=* \ + | --libexe=* | --libex=* | --libe=*) + libexecdir=$ac_optarg ;; + + -localedir | --localedir | --localedi | --localed | --locale) + ac_prev=localedir ;; + -localedir=* | --localedir=* | --localedi=* | --localed=* | --locale=*) + localedir=$ac_optarg ;; + + -localstatedir | --localstatedir | --localstatedi | --localstated \ + | --localstate | --localstat | --localsta | --localst | --locals) + ac_prev=localstatedir ;; + -localstatedir=* | --localstatedir=* | --localstatedi=* | --localstated=* \ + | --localstate=* | --localstat=* | --localsta=* | --localst=* | --locals=*) + localstatedir=$ac_optarg ;; + + -mandir | --mandir | --mandi | --mand | --man | --ma | --m) + ac_prev=mandir ;; + -mandir=* | --mandir=* | --mandi=* | --mand=* | --man=* | --ma=* | --m=*) + mandir=$ac_optarg ;; + + -nfp | --nfp | --nf) + # Obsolete; use --without-fp. + with_fp=no ;; + + -no-create | --no-create | --no-creat | --no-crea | --no-cre \ + | --no-cr | --no-c | -n) + no_create=yes ;; + + -no-recursion | --no-recursion | --no-recursio | --no-recursi \ + | --no-recurs | --no-recur | --no-recu | --no-rec | --no-re | --no-r) + no_recursion=yes ;; + + -oldincludedir | --oldincludedir | --oldincludedi | --oldincluded \ + | --oldinclude | --oldinclud | --oldinclu | --oldincl | --oldinc \ + | --oldin | --oldi | --old | --ol | --o) + ac_prev=oldincludedir ;; + -oldincludedir=* | --oldincludedir=* | --oldincludedi=* | --oldincluded=* \ + | --oldinclude=* | --oldinclud=* | --oldinclu=* | --oldincl=* | --oldinc=* \ + | --oldin=* | --oldi=* | --old=* | --ol=* | --o=*) + oldincludedir=$ac_optarg ;; + + -prefix | --prefix | --prefi | --pref | --pre | --pr | --p) + ac_prev=prefix ;; + -prefix=* | --prefix=* | --prefi=* | --pref=* | --pre=* | --pr=* | --p=*) + prefix=$ac_optarg ;; + + -program-prefix | --program-prefix | --program-prefi | --program-pref \ + | --program-pre | --program-pr | --program-p) + ac_prev=program_prefix ;; + -program-prefix=* | --program-prefix=* | --program-prefi=* \ + | --program-pref=* | --program-pre=* | --program-pr=* | --program-p=*) + program_prefix=$ac_optarg ;; + + -program-suffix | --program-suffix | --program-suffi | --program-suff \ + | --program-suf | --program-su | --program-s) + ac_prev=program_suffix ;; + -program-suffix=* | --program-suffix=* | --program-suffi=* \ + | --program-suff=* | --program-suf=* | --program-su=* | --program-s=*) + program_suffix=$ac_optarg ;; + + -program-transform-name | --program-transform-name \ + | --program-transform-nam | --program-transform-na \ + | --program-transform-n | --program-transform- \ + | --program-transform | --program-transfor \ + | --program-transfo | --program-transf \ + | --program-trans | --program-tran \ + | --progr-tra | --program-tr | --program-t) + ac_prev=program_transform_name ;; + -program-transform-name=* | --program-transform-name=* \ + | --program-transform-nam=* | --program-transform-na=* \ + | --program-transform-n=* | --program-transform-=* \ + | --program-transform=* | --program-transfor=* \ + | --program-transfo=* | --program-transf=* \ + | --program-trans=* | --program-tran=* \ + | --progr-tra=* | --program-tr=* | --program-t=*) + program_transform_name=$ac_optarg ;; + + -pdfdir | --pdfdir | --pdfdi | --pdfd | --pdf | --pd) + ac_prev=pdfdir ;; + -pdfdir=* | --pdfdir=* | --pdfdi=* | --pdfd=* | --pdf=* | --pd=*) + pdfdir=$ac_optarg ;; + + -psdir | --psdir | --psdi | --psd | --ps) + ac_prev=psdir ;; + -psdir=* | --psdir=* | --psdi=* | --psd=* | --ps=*) + psdir=$ac_optarg ;; + + -q | -quiet | --quiet | --quie | --qui | --qu | --q \ + | -silent | --silent | --silen | --sile | --sil) + silent=yes ;; + + -sbindir | --sbindir | --sbindi | --sbind | --sbin | --sbi | --sb) + ac_prev=sbindir ;; + -sbindir=* | --sbindir=* | --sbindi=* | --sbind=* | --sbin=* \ + | --sbi=* | --sb=*) + sbindir=$ac_optarg ;; + + -sharedstatedir | --sharedstatedir | --sharedstatedi \ + | --sharedstated | --sharedstate | --sharedstat | --sharedsta \ + | --sharedst | --shareds | --shared | --share | --shar \ + | --sha | --sh) + ac_prev=sharedstatedir ;; + -sharedstatedir=* | --sharedstatedir=* | --sharedstatedi=* \ + | --sharedstated=* | --sharedstate=* | --sharedstat=* | --sharedsta=* \ + | --sharedst=* | --shareds=* | --shared=* | --share=* | --shar=* \ + | --sha=* | --sh=*) + sharedstatedir=$ac_optarg ;; + + -site | --site | --sit) + ac_prev=site ;; + -site=* | --site=* | --sit=*) + site=$ac_optarg ;; + + -srcdir | --srcdir | --srcdi | --srcd | --src | --sr) + ac_prev=srcdir ;; + -srcdir=* | --srcdir=* | --srcdi=* | --srcd=* | --src=* | --sr=*) + srcdir=$ac_optarg ;; + + -sysconfdir | --sysconfdir | --sysconfdi | --sysconfd | --sysconf \ + | --syscon | --sysco | --sysc | --sys | --sy) + ac_prev=sysconfdir ;; + -sysconfdir=* | --sysconfdir=* | --sysconfdi=* | --sysconfd=* | --sysconf=* \ + | --syscon=* | --sysco=* | --sysc=* | --sys=* | --sy=*) + sysconfdir=$ac_optarg ;; + + -target | --target | --targe | --targ | --tar | --ta | --t) + ac_prev=target_alias ;; + -target=* | --target=* | --targe=* | --targ=* | --tar=* | --ta=* | --t=*) + target_alias=$ac_optarg ;; + + -v | -verbose | --verbose | --verbos | --verbo | --verb) + verbose=yes ;; + + -version | --version | --versio | --versi | --vers | -V) + ac_init_version=: ;; + + -with-* | --with-*) + ac_package=`expr "x$ac_option" : 'x-*with-\([^=]*\)'` + # Reject names that are not valid shell variable names. + expr "x$ac_package" : ".*[^-._$as_cr_alnum]" >/dev/null && + { echo "$as_me: error: invalid package name: $ac_package" >&2 + { (exit 1); exit 1; }; } + ac_package=`echo $ac_package | sed 's/[-.]/_/g'` + eval with_$ac_package=\$ac_optarg ;; + + -without-* | --without-*) + ac_package=`expr "x$ac_option" : 'x-*without-\(.*\)'` + # Reject names that are not valid shell variable names. + expr "x$ac_package" : ".*[^-._$as_cr_alnum]" >/dev/null && + { echo "$as_me: error: invalid package name: $ac_package" >&2 + { (exit 1); exit 1; }; } + ac_package=`echo $ac_package | sed 's/[-.]/_/g'` + eval with_$ac_package=no ;; + + --x) + # Obsolete; use --with-x. + with_x=yes ;; + + -x-includes | --x-includes | --x-include | --x-includ | --x-inclu \ + | --x-incl | --x-inc | --x-in | --x-i) + ac_prev=x_includes ;; + -x-includes=* | --x-includes=* | --x-include=* | --x-includ=* | --x-inclu=* \ + | --x-incl=* | --x-inc=* | --x-in=* | --x-i=*) + x_includes=$ac_optarg ;; + + -x-libraries | --x-libraries | --x-librarie | --x-librari \ + | --x-librar | --x-libra | --x-libr | --x-lib | --x-li | --x-l) + ac_prev=x_libraries ;; + -x-libraries=* | --x-libraries=* | --x-librarie=* | --x-librari=* \ + | --x-librar=* | --x-libra=* | --x-libr=* | --x-lib=* | --x-li=* | --x-l=*) + x_libraries=$ac_optarg ;; + + -*) { echo "$as_me: error: unrecognized option: $ac_option +Try \`$0 --help' for more information." >&2 + { (exit 1); exit 1; }; } + ;; + + *=*) + ac_envvar=`expr "x$ac_option" : 'x\([^=]*\)='` + # Reject names that are not valid shell variable names. + expr "x$ac_envvar" : ".*[^_$as_cr_alnum]" >/dev/null && + { echo "$as_me: error: invalid variable name: $ac_envvar" >&2 + { (exit 1); exit 1; }; } + eval $ac_envvar=\$ac_optarg + export $ac_envvar ;; + + *) + # FIXME: should be removed in autoconf 3.0. + echo "$as_me: WARNING: you should use --build, --host, --target" >&2 + expr "x$ac_option" : ".*[^-._$as_cr_alnum]" >/dev/null && + echo "$as_me: WARNING: invalid host type: $ac_option" >&2 + : ${build_alias=$ac_option} ${host_alias=$ac_option} ${target_alias=$ac_option} + ;; + + esac +done + +if test -n "$ac_prev"; then + ac_option=--`echo $ac_prev | sed 's/_/-/g'` + { echo "$as_me: error: missing argument to $ac_option" >&2 + { (exit 1); exit 1; }; } +fi + +# Be sure to have absolute directory names. +for ac_var in exec_prefix prefix bindir sbindir libexecdir datarootdir \ + datadir sysconfdir sharedstatedir localstatedir includedir \ + oldincludedir docdir infodir htmldir dvidir pdfdir psdir \ + libdir localedir mandir +do + eval ac_val=\$$ac_var + case $ac_val in + [\\/$]* | ?:[\\/]* ) continue;; + NONE | '' ) case $ac_var in *prefix ) continue;; esac;; + esac + { echo "$as_me: error: expected an absolute directory name for --$ac_var: $ac_val" >&2 + { (exit 1); exit 1; }; } +done + +# There might be people who depend on the old broken behavior: `$host' +# used to hold the argument of --host etc. +# FIXME: To remove some day. +build=$build_alias +host=$host_alias +target=$target_alias + +# FIXME: To remove some day. +if test "x$host_alias" != x; then + if test "x$build_alias" = x; then + cross_compiling=maybe + echo "$as_me: WARNING: If you wanted to set the --build type, don't use --host. + If a cross compiler is detected then cross compile mode will be used." >&2 + elif test "x$build_alias" != "x$host_alias"; then + cross_compiling=yes + fi +fi + +ac_tool_prefix= +test -n "$host_alias" && ac_tool_prefix=$host_alias- + +test "$silent" = yes && exec 6>/dev/null + + +ac_pwd=`pwd` && test -n "$ac_pwd" && +ac_ls_di=`ls -di .` && +ac_pwd_ls_di=`cd "$ac_pwd" && ls -di .` || + { echo "$as_me: error: Working directory cannot be determined" >&2 + { (exit 1); exit 1; }; } +test "X$ac_ls_di" = "X$ac_pwd_ls_di" || + { echo "$as_me: error: pwd does not report name of working directory" >&2 + { (exit 1); exit 1; }; } + + +# Find the source files, if location was not specified. +if test -z "$srcdir"; then + ac_srcdir_defaulted=yes + # Try the directory containing this script, then the parent directory. + ac_confdir=`$as_dirname -- "$0" || +$as_expr X"$0" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ + X"$0" : 'X\(//\)[^/]' \| \ + X"$0" : 'X\(//\)$' \| \ + X"$0" : 'X\(/\)' \| . 2>/dev/null || +echo X"$0" | + sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ + s//\1/ + q + } + /^X\(\/\/\)[^/].*/{ + s//\1/ + q + } + /^X\(\/\/\)$/{ + s//\1/ + q + } + /^X\(\/\).*/{ + s//\1/ + q + } + s/.*/./; q'` + srcdir=$ac_confdir + if test ! -r "$srcdir/$ac_unique_file"; then + srcdir=.. + fi +else + ac_srcdir_defaulted=no +fi +if test ! -r "$srcdir/$ac_unique_file"; then + test "$ac_srcdir_defaulted" = yes && srcdir="$ac_confdir or .." + { echo "$as_me: error: cannot find sources ($ac_unique_file) in $srcdir" >&2 + { (exit 1); exit 1; }; } +fi +ac_msg="sources are in $srcdir, but \`cd $srcdir' does not work" +ac_abs_confdir=`( + cd "$srcdir" && test -r "./$ac_unique_file" || { echo "$as_me: error: $ac_msg" >&2 + { (exit 1); exit 1; }; } + pwd)` +# When building in place, set srcdir=. +if test "$ac_abs_confdir" = "$ac_pwd"; then + srcdir=. +fi +# Remove unnecessary trailing slashes from srcdir. +# Double slashes in file names in object file debugging info +# mess up M-x gdb in Emacs. +case $srcdir in +*/) srcdir=`expr "X$srcdir" : 'X\(.*[^/]\)' \| "X$srcdir" : 'X\(.*\)'`;; +esac +for ac_var in $ac_precious_vars; do + eval ac_env_${ac_var}_set=\${${ac_var}+set} + eval ac_env_${ac_var}_value=\$${ac_var} + eval ac_cv_env_${ac_var}_set=\${${ac_var}+set} + eval ac_cv_env_${ac_var}_value=\$${ac_var} +done + +# +# Report the --help message. +# +if test "$ac_init_help" = "long"; then + # Omit some internal or obsolete options to make the list less imposing. + # This message is too long to be a string in the A/UX 3.1 sh. + cat <<_ACEOF +\`configure' configures this package to adapt to many kinds of systems. + +Usage: $0 [OPTION]... [VAR=VALUE]... + +To assign environment variables (e.g., CC, CFLAGS...), specify them as +VAR=VALUE. See below for descriptions of some of the useful variables. + +Defaults for the options are specified in brackets. + +Configuration: + -h, --help display this help and exit + --help=short display options specific to this package + --help=recursive display the short help of all the included packages + -V, --version display version information and exit + -q, --quiet, --silent do not print \`checking...' messages + --cache-file=FILE cache test results in FILE [disabled] + -C, --config-cache alias for \`--cache-file=config.cache' + -n, --no-create do not create output files + --srcdir=DIR find the sources in DIR [configure dir or \`..'] + +Installation directories: + --prefix=PREFIX install architecture-independent files in PREFIX + [$ac_default_prefix] + --exec-prefix=EPREFIX install architecture-dependent files in EPREFIX + [PREFIX] + +By default, \`make install' will install all the files in +\`$ac_default_prefix/bin', \`$ac_default_prefix/lib' etc. You can specify +an installation prefix other than \`$ac_default_prefix' using \`--prefix', +for instance \`--prefix=\$HOME'. + +For better control, use the options below. + +Fine tuning of the installation directories: + --bindir=DIR user executables [EPREFIX/bin] + --sbindir=DIR system admin executables [EPREFIX/sbin] + --libexecdir=DIR program executables [EPREFIX/libexec] + --sysconfdir=DIR read-only single-machine data [PREFIX/etc] + --sharedstatedir=DIR modifiable architecture-independent data [PREFIX/com] + --localstatedir=DIR modifiable single-machine data [PREFIX/var] + --libdir=DIR object code libraries [EPREFIX/lib] + --includedir=DIR C header files [PREFIX/include] + --oldincludedir=DIR C header files for non-gcc [/usr/include] + --datarootdir=DIR read-only arch.-independent data root [PREFIX/share] + --datadir=DIR read-only architecture-independent data [DATAROOTDIR] + --infodir=DIR info documentation [DATAROOTDIR/info] + --localedir=DIR locale-dependent data [DATAROOTDIR/locale] + --mandir=DIR man documentation [DATAROOTDIR/man] + --docdir=DIR documentation root [DATAROOTDIR/doc/PACKAGE] + --htmldir=DIR html documentation [DOCDIR] + --dvidir=DIR dvi documentation [DOCDIR] + --pdfdir=DIR pdf documentation [DOCDIR] + --psdir=DIR ps documentation [DOCDIR] +_ACEOF + + cat <<\_ACEOF +_ACEOF +fi + +if test -n "$ac_init_help"; then + + cat <<\_ACEOF + +Optional Features: + --disable-FEATURE do not include FEATURE (same as --enable-FEATURE=no) + --enable-FEATURE[=ARG] include FEATURE [ARG=yes] + --enable-debug turn on debugging, default=no + --enable-threads enable multi-threading support + --enable-shared turn on shared libraries, default=no + +Optional Packages: + --with-PACKAGE[=ARG] use PACKAGE [ARG=yes] + --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=no) + --with-ansi set full ANSI C mode, default=no + --with-archflags set additional architecture flags, default=none + --with-docdir set directory for documentation, default=${prefix}/share/doc/mxml + --with-vsnprintf use vsnprintf emulation functions, default=auto + +Some influential environment variables: + CC C compiler command + CFLAGS C compiler flags + LDFLAGS linker flags, e.g. -L if you have libraries in a + nonstandard directory + LIBS libraries to pass to the linker, e.g. -l + CPPFLAGS C/C++/Objective C preprocessor flags, e.g. -I if + you have headers in a nonstandard directory + CXX C++ compiler command + CXXFLAGS C++ compiler flags + CPP C preprocessor + +Use these variables to override the choices made by `configure' or to help +it to find libraries and programs with nonstandard names/locations. + +_ACEOF +ac_status=$? +fi + +if test "$ac_init_help" = "recursive"; then + # If there are subdirs, report their specific --help. + for ac_dir in : $ac_subdirs_all; do test "x$ac_dir" = x: && continue + test -d "$ac_dir" || continue + ac_builddir=. + +case "$ac_dir" in +.) ac_dir_suffix= ac_top_builddir_sub=. ac_top_build_prefix= ;; +*) + ac_dir_suffix=/`echo "$ac_dir" | sed 's,^\.[\\/],,'` + # A ".." for each directory in $ac_dir_suffix. + ac_top_builddir_sub=`echo "$ac_dir_suffix" | sed 's,/[^\\/]*,/..,g;s,/,,'` + case $ac_top_builddir_sub in + "") ac_top_builddir_sub=. ac_top_build_prefix= ;; + *) ac_top_build_prefix=$ac_top_builddir_sub/ ;; + esac ;; +esac +ac_abs_top_builddir=$ac_pwd +ac_abs_builddir=$ac_pwd$ac_dir_suffix +# for backward compatibility: +ac_top_builddir=$ac_top_build_prefix + +case $srcdir in + .) # We are building in place. + ac_srcdir=. + ac_top_srcdir=$ac_top_builddir_sub + ac_abs_top_srcdir=$ac_pwd ;; + [\\/]* | ?:[\\/]* ) # Absolute name. + ac_srcdir=$srcdir$ac_dir_suffix; + ac_top_srcdir=$srcdir + ac_abs_top_srcdir=$srcdir ;; + *) # Relative name. + ac_srcdir=$ac_top_build_prefix$srcdir$ac_dir_suffix + ac_top_srcdir=$ac_top_build_prefix$srcdir + ac_abs_top_srcdir=$ac_pwd/$srcdir ;; +esac +ac_abs_srcdir=$ac_abs_top_srcdir$ac_dir_suffix + + cd "$ac_dir" || { ac_status=$?; continue; } + # Check for guested configure. + if test -f "$ac_srcdir/configure.gnu"; then + echo && + $SHELL "$ac_srcdir/configure.gnu" --help=recursive + elif test -f "$ac_srcdir/configure"; then + echo && + $SHELL "$ac_srcdir/configure" --help=recursive + else + echo "$as_me: WARNING: no configuration information is in $ac_dir" >&2 + fi || ac_status=$? + cd "$ac_pwd" || { ac_status=$?; break; } + done +fi + +test -n "$ac_init_help" && exit $ac_status +if $ac_init_version; then + cat <<\_ACEOF +configure +generated by GNU Autoconf 2.61 + +Copyright (C) 1992, 1993, 1994, 1995, 1996, 1998, 1999, 2000, 2001, +2002, 2003, 2004, 2005, 2006 Free Software Foundation, Inc. +This configure script is free software; the Free Software Foundation +gives unlimited permission to copy, distribute and modify it. +_ACEOF + exit +fi +cat >config.log <<_ACEOF +This file contains any messages produced by compilers while +running configure, to aid debugging if configure makes a mistake. + +It was created by $as_me, which was +generated by GNU Autoconf 2.61. Invocation command line was + + $ $0 $@ + +_ACEOF +exec 5>>config.log +{ +cat <<_ASUNAME +## --------- ## +## Platform. ## +## --------- ## + +hostname = `(hostname || uname -n) 2>/dev/null | sed 1q` +uname -m = `(uname -m) 2>/dev/null || echo unknown` +uname -r = `(uname -r) 2>/dev/null || echo unknown` +uname -s = `(uname -s) 2>/dev/null || echo unknown` +uname -v = `(uname -v) 2>/dev/null || echo unknown` + +/usr/bin/uname -p = `(/usr/bin/uname -p) 2>/dev/null || echo unknown` +/bin/uname -X = `(/bin/uname -X) 2>/dev/null || echo unknown` + +/bin/arch = `(/bin/arch) 2>/dev/null || echo unknown` +/usr/bin/arch -k = `(/usr/bin/arch -k) 2>/dev/null || echo unknown` +/usr/convex/getsysinfo = `(/usr/convex/getsysinfo) 2>/dev/null || echo unknown` +/usr/bin/hostinfo = `(/usr/bin/hostinfo) 2>/dev/null || echo unknown` +/bin/machine = `(/bin/machine) 2>/dev/null || echo unknown` +/usr/bin/oslevel = `(/usr/bin/oslevel) 2>/dev/null || echo unknown` +/bin/universe = `(/bin/universe) 2>/dev/null || echo unknown` + +_ASUNAME + +as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in $PATH +do + IFS=$as_save_IFS + test -z "$as_dir" && as_dir=. + echo "PATH: $as_dir" +done +IFS=$as_save_IFS + +} >&5 + +cat >&5 <<_ACEOF + + +## ----------- ## +## Core tests. ## +## ----------- ## + +_ACEOF + + +# Keep a trace of the command line. +# Strip out --no-create and --no-recursion so they do not pile up. +# Strip out --silent because we don't want to record it for future runs. +# Also quote any args containing shell meta-characters. +# Make two passes to allow for proper duplicate-argument suppression. +ac_configure_args= +ac_configure_args0= +ac_configure_args1= +ac_must_keep_next=false +for ac_pass in 1 2 +do + for ac_arg + do + case $ac_arg in + -no-create | --no-c* | -n | -no-recursion | --no-r*) continue ;; + -q | -quiet | --quiet | --quie | --qui | --qu | --q \ + | -silent | --silent | --silen | --sile | --sil) + continue ;; + *\'*) + ac_arg=`echo "$ac_arg" | sed "s/'/'\\\\\\\\''/g"` ;; + esac + case $ac_pass in + 1) ac_configure_args0="$ac_configure_args0 '$ac_arg'" ;; + 2) + ac_configure_args1="$ac_configure_args1 '$ac_arg'" + if test $ac_must_keep_next = true; then + ac_must_keep_next=false # Got value, back to normal. + else + case $ac_arg in + *=* | --config-cache | -C | -disable-* | --disable-* \ + | -enable-* | --enable-* | -gas | --g* | -nfp | --nf* \ + | -q | -quiet | --q* | -silent | --sil* | -v | -verb* \ + | -with-* | --with-* | -without-* | --without-* | --x) + case "$ac_configure_args0 " in + "$ac_configure_args1"*" '$ac_arg' "* ) continue ;; + esac + ;; + -* ) ac_must_keep_next=true ;; + esac + fi + ac_configure_args="$ac_configure_args '$ac_arg'" + ;; + esac + done +done +$as_unset ac_configure_args0 || test "${ac_configure_args0+set}" != set || { ac_configure_args0=; export ac_configure_args0; } +$as_unset ac_configure_args1 || test "${ac_configure_args1+set}" != set || { ac_configure_args1=; export ac_configure_args1; } + +# When interrupted or exit'd, cleanup temporary files, and complete +# config.log. We remove comments because anyway the quotes in there +# would cause problems or look ugly. +# WARNING: Use '\'' to represent an apostrophe within the trap. +# WARNING: Do not start the trap code with a newline, due to a FreeBSD 4.0 bug. +trap 'exit_status=$? + # Save into config.log some information that might help in debugging. + { + echo + + cat <<\_ASBOX +## ---------------- ## +## Cache variables. ## +## ---------------- ## +_ASBOX + echo + # The following way of writing the cache mishandles newlines in values, +( + for ac_var in `(set) 2>&1 | sed -n '\''s/^\([a-zA-Z_][a-zA-Z0-9_]*\)=.*/\1/p'\''`; do + eval ac_val=\$$ac_var + case $ac_val in #( + *${as_nl}*) + case $ac_var in #( + *_cv_*) { echo "$as_me:$LINENO: WARNING: Cache variable $ac_var contains a newline." >&5 +echo "$as_me: WARNING: Cache variable $ac_var contains a newline." >&2;} ;; + esac + case $ac_var in #( + _ | IFS | as_nl) ;; #( + *) $as_unset $ac_var ;; + esac ;; + esac + done + (set) 2>&1 | + case $as_nl`(ac_space='\'' '\''; set) 2>&1` in #( + *${as_nl}ac_space=\ *) + sed -n \ + "s/'\''/'\''\\\\'\'''\''/g; + s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1='\''\\2'\''/p" + ;; #( + *) + sed -n "/^[_$as_cr_alnum]*_cv_[_$as_cr_alnum]*=/p" + ;; + esac | + sort +) + echo + + cat <<\_ASBOX +## ----------------- ## +## Output variables. ## +## ----------------- ## +_ASBOX + echo + for ac_var in $ac_subst_vars + do + eval ac_val=\$$ac_var + case $ac_val in + *\'\''*) ac_val=`echo "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;; + esac + echo "$ac_var='\''$ac_val'\''" + done | sort + echo + + if test -n "$ac_subst_files"; then + cat <<\_ASBOX +## ------------------- ## +## File substitutions. ## +## ------------------- ## +_ASBOX + echo + for ac_var in $ac_subst_files + do + eval ac_val=\$$ac_var + case $ac_val in + *\'\''*) ac_val=`echo "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;; + esac + echo "$ac_var='\''$ac_val'\''" + done | sort + echo + fi + + if test -s confdefs.h; then + cat <<\_ASBOX +## ----------- ## +## confdefs.h. ## +## ----------- ## +_ASBOX + echo + cat confdefs.h + echo + fi + test "$ac_signal" != 0 && + echo "$as_me: caught signal $ac_signal" + echo "$as_me: exit $exit_status" + } >&5 + rm -f core *.core core.conftest.* && + rm -f -r conftest* confdefs* conf$$* $ac_clean_files && + exit $exit_status +' 0 +for ac_signal in 1 2 13 15; do + trap 'ac_signal='$ac_signal'; { (exit 1); exit 1; }' $ac_signal +done +ac_signal=0 + +# confdefs.h avoids OS command line length limits that DEFS can exceed. +rm -f -r conftest* confdefs.h + +# Predefined preprocessor variables. + +cat >>confdefs.h <<_ACEOF +#define PACKAGE_NAME "$PACKAGE_NAME" +_ACEOF + + +cat >>confdefs.h <<_ACEOF +#define PACKAGE_TARNAME "$PACKAGE_TARNAME" +_ACEOF + + +cat >>confdefs.h <<_ACEOF +#define PACKAGE_VERSION "$PACKAGE_VERSION" +_ACEOF + + +cat >>confdefs.h <<_ACEOF +#define PACKAGE_STRING "$PACKAGE_STRING" +_ACEOF + + +cat >>confdefs.h <<_ACEOF +#define PACKAGE_BUGREPORT "$PACKAGE_BUGREPORT" +_ACEOF + + +# Let the site file select an alternate cache file if it wants to. +# Prefer explicitly selected file to automatically selected ones. +if test -n "$CONFIG_SITE"; then + set x "$CONFIG_SITE" +elif test "x$prefix" != xNONE; then + set x "$prefix/share/config.site" "$prefix/etc/config.site" +else + set x "$ac_default_prefix/share/config.site" \ + "$ac_default_prefix/etc/config.site" +fi +shift +for ac_site_file +do + if test -r "$ac_site_file"; then + { echo "$as_me:$LINENO: loading site script $ac_site_file" >&5 +echo "$as_me: loading site script $ac_site_file" >&6;} + sed 's/^/| /' "$ac_site_file" >&5 + . "$ac_site_file" + fi +done + +if test -r "$cache_file"; then + # Some versions of bash will fail to source /dev/null (special + # files actually), so we avoid doing that. + if test -f "$cache_file"; then + { echo "$as_me:$LINENO: loading cache $cache_file" >&5 +echo "$as_me: loading cache $cache_file" >&6;} + case $cache_file in + [\\/]* | ?:[\\/]* ) . "$cache_file";; + *) . "./$cache_file";; + esac + fi +else + { echo "$as_me:$LINENO: creating cache $cache_file" >&5 +echo "$as_me: creating cache $cache_file" >&6;} + >$cache_file +fi + +# Check that the precious variables saved in the cache have kept the same +# value. +ac_cache_corrupted=false +for ac_var in $ac_precious_vars; do + eval ac_old_set=\$ac_cv_env_${ac_var}_set + eval ac_new_set=\$ac_env_${ac_var}_set + eval ac_old_val=\$ac_cv_env_${ac_var}_value + eval ac_new_val=\$ac_env_${ac_var}_value + case $ac_old_set,$ac_new_set in + set,) + { echo "$as_me:$LINENO: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&5 +echo "$as_me: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&2;} + ac_cache_corrupted=: ;; + ,set) + { echo "$as_me:$LINENO: error: \`$ac_var' was not set in the previous run" >&5 +echo "$as_me: error: \`$ac_var' was not set in the previous run" >&2;} + ac_cache_corrupted=: ;; + ,);; + *) + if test "x$ac_old_val" != "x$ac_new_val"; then + { echo "$as_me:$LINENO: error: \`$ac_var' has changed since the previous run:" >&5 +echo "$as_me: error: \`$ac_var' has changed since the previous run:" >&2;} + { echo "$as_me:$LINENO: former value: $ac_old_val" >&5 +echo "$as_me: former value: $ac_old_val" >&2;} + { echo "$as_me:$LINENO: current value: $ac_new_val" >&5 +echo "$as_me: current value: $ac_new_val" >&2;} + ac_cache_corrupted=: + fi;; + esac + # Pass precious variables to config.status. + if test "$ac_new_set" = set; then + case $ac_new_val in + *\'*) ac_arg=$ac_var=`echo "$ac_new_val" | sed "s/'/'\\\\\\\\''/g"` ;; + *) ac_arg=$ac_var=$ac_new_val ;; + esac + case " $ac_configure_args " in + *" '$ac_arg' "*) ;; # Avoid dups. Use of quotes ensures accuracy. + *) ac_configure_args="$ac_configure_args '$ac_arg'" ;; + esac + fi +done +if $ac_cache_corrupted; then + { echo "$as_me:$LINENO: error: changes in the environment can compromise the build" >&5 +echo "$as_me: error: changes in the environment can compromise the build" >&2;} + { { echo "$as_me:$LINENO: error: run \`make distclean' and/or \`rm $cache_file' and start over" >&5 +echo "$as_me: error: run \`make distclean' and/or \`rm $cache_file' and start over" >&2;} + { (exit 1); exit 1; }; } +fi + + + + + + + + + + + + + + + + + +ac_ext=c +ac_cpp='$CPP $CPPFLAGS' +ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' +ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' +ac_compiler_gnu=$ac_cv_c_compiler_gnu + + + +ac_config_headers="$ac_config_headers config.h" + + +VERSION=2.6 + +cat >>confdefs.h <<_ACEOF +#define MXML_VERSION "Mini-XML v$VERSION" +_ACEOF + + +CFLAGS="${CFLAGS:=}" +CXXFLAGS="${CXXFLAGS:=}" +LDFLAGS="${LDFLAGS:=}" + +OPTIM="" + + + +# Check whether --with-ansi was given. +if test "${with_ansi+set}" = set; then + withval=$with_ansi; use_ansi="$withval" +else + use_ansi="no" +fi + + + +# Check whether --with-archflags was given. +if test "${with_archflags+set}" = set; then + withval=$with_archflags; ARCHFLAGS="$withval" +else + ARCHFLAGS="" +fi + + + +# Check whether --enable-debug was given. +if test "${enable_debug+set}" = set; then + enableval=$enable_debug; if eval "test x$enable_debug = xyes"; then + OPTIM="-g" +fi +fi + + + +# Check whether --with-docdir was given. +if test "${with_docdir+set}" = set; then + withval=$with_docdir; docdir="$withval" +else + docdir="NONE" +fi + + + + + +# Check whether --with-vsnprintf was given. +if test "${with_vsnprintf+set}" = set; then + withval=$with_vsnprintf; use_vsnprintf="$withval" +else + use_vsnprintf="no" +fi + + +uname=`uname` +uversion=`uname -r | sed -e '1,$s/[^0-9]//g'` +if test x$uname = xIRIX64; then + uname="IRIX" +fi + +ac_ext=c +ac_cpp='$CPP $CPPFLAGS' +ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' +ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' +ac_compiler_gnu=$ac_cv_c_compiler_gnu +if test -n "$ac_tool_prefix"; then + # Extract the first word of "${ac_tool_prefix}gcc", so it can be a program name with args. +set dummy ${ac_tool_prefix}gcc; ac_word=$2 +{ echo "$as_me:$LINENO: checking for $ac_word" >&5 +echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } +if test "${ac_cv_prog_CC+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + if test -n "$CC"; then + ac_cv_prog_CC="$CC" # Let the user override the test. +else +as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in $PATH +do + IFS=$as_save_IFS + test -z "$as_dir" && as_dir=. + for ac_exec_ext in '' $ac_executable_extensions; do + if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then + ac_cv_prog_CC="${ac_tool_prefix}gcc" + echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 + break 2 + fi +done +done +IFS=$as_save_IFS + +fi +fi +CC=$ac_cv_prog_CC +if test -n "$CC"; then + { echo "$as_me:$LINENO: result: $CC" >&5 +echo "${ECHO_T}$CC" >&6; } +else + { echo "$as_me:$LINENO: result: no" >&5 +echo "${ECHO_T}no" >&6; } +fi + + +fi +if test -z "$ac_cv_prog_CC"; then + ac_ct_CC=$CC + # Extract the first word of "gcc", so it can be a program name with args. +set dummy gcc; ac_word=$2 +{ echo "$as_me:$LINENO: checking for $ac_word" >&5 +echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } +if test "${ac_cv_prog_ac_ct_CC+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + if test -n "$ac_ct_CC"; then + ac_cv_prog_ac_ct_CC="$ac_ct_CC" # Let the user override the test. +else +as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in $PATH +do + IFS=$as_save_IFS + test -z "$as_dir" && as_dir=. + for ac_exec_ext in '' $ac_executable_extensions; do + if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then + ac_cv_prog_ac_ct_CC="gcc" + echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 + break 2 + fi +done +done +IFS=$as_save_IFS + +fi +fi +ac_ct_CC=$ac_cv_prog_ac_ct_CC +if test -n "$ac_ct_CC"; then + { echo "$as_me:$LINENO: result: $ac_ct_CC" >&5 +echo "${ECHO_T}$ac_ct_CC" >&6; } +else + { echo "$as_me:$LINENO: result: no" >&5 +echo "${ECHO_T}no" >&6; } +fi + + if test "x$ac_ct_CC" = x; then + CC="" + else + case $cross_compiling:$ac_tool_warned in +yes:) +{ echo "$as_me:$LINENO: WARNING: In the future, Autoconf will not detect cross-tools +whose name does not start with the host triplet. If you think this +configuration is useful to you, please write to autoconf@gnu.org." >&5 +echo "$as_me: WARNING: In the future, Autoconf will not detect cross-tools +whose name does not start with the host triplet. If you think this +configuration is useful to you, please write to autoconf@gnu.org." >&2;} +ac_tool_warned=yes ;; +esac + CC=$ac_ct_CC + fi +else + CC="$ac_cv_prog_CC" +fi + +if test -z "$CC"; then + if test -n "$ac_tool_prefix"; then + # Extract the first word of "${ac_tool_prefix}cc", so it can be a program name with args. +set dummy ${ac_tool_prefix}cc; ac_word=$2 +{ echo "$as_me:$LINENO: checking for $ac_word" >&5 +echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } +if test "${ac_cv_prog_CC+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + if test -n "$CC"; then + ac_cv_prog_CC="$CC" # Let the user override the test. +else +as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in $PATH +do + IFS=$as_save_IFS + test -z "$as_dir" && as_dir=. + for ac_exec_ext in '' $ac_executable_extensions; do + if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then + ac_cv_prog_CC="${ac_tool_prefix}cc" + echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 + break 2 + fi +done +done +IFS=$as_save_IFS + +fi +fi +CC=$ac_cv_prog_CC +if test -n "$CC"; then + { echo "$as_me:$LINENO: result: $CC" >&5 +echo "${ECHO_T}$CC" >&6; } +else + { echo "$as_me:$LINENO: result: no" >&5 +echo "${ECHO_T}no" >&6; } +fi + + + fi +fi +if test -z "$CC"; then + # Extract the first word of "cc", so it can be a program name with args. +set dummy cc; ac_word=$2 +{ echo "$as_me:$LINENO: checking for $ac_word" >&5 +echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } +if test "${ac_cv_prog_CC+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + if test -n "$CC"; then + ac_cv_prog_CC="$CC" # Let the user override the test. +else + ac_prog_rejected=no +as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in $PATH +do + IFS=$as_save_IFS + test -z "$as_dir" && as_dir=. + for ac_exec_ext in '' $ac_executable_extensions; do + if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then + if test "$as_dir/$ac_word$ac_exec_ext" = "/usr/ucb/cc"; then + ac_prog_rejected=yes + continue + fi + ac_cv_prog_CC="cc" + echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 + break 2 + fi +done +done +IFS=$as_save_IFS + +if test $ac_prog_rejected = yes; then + # We found a bogon in the path, so make sure we never use it. + set dummy $ac_cv_prog_CC + shift + if test $# != 0; then + # We chose a different compiler from the bogus one. + # However, it has the same basename, so the bogon will be chosen + # first if we set CC to just the basename; use the full file name. + shift + ac_cv_prog_CC="$as_dir/$ac_word${1+' '}$@" + fi +fi +fi +fi +CC=$ac_cv_prog_CC +if test -n "$CC"; then + { echo "$as_me:$LINENO: result: $CC" >&5 +echo "${ECHO_T}$CC" >&6; } +else + { echo "$as_me:$LINENO: result: no" >&5 +echo "${ECHO_T}no" >&6; } +fi + + +fi +if test -z "$CC"; then + if test -n "$ac_tool_prefix"; then + for ac_prog in cl.exe + do + # Extract the first word of "$ac_tool_prefix$ac_prog", so it can be a program name with args. +set dummy $ac_tool_prefix$ac_prog; ac_word=$2 +{ echo "$as_me:$LINENO: checking for $ac_word" >&5 +echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } +if test "${ac_cv_prog_CC+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + if test -n "$CC"; then + ac_cv_prog_CC="$CC" # Let the user override the test. +else +as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in $PATH +do + IFS=$as_save_IFS + test -z "$as_dir" && as_dir=. + for ac_exec_ext in '' $ac_executable_extensions; do + if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then + ac_cv_prog_CC="$ac_tool_prefix$ac_prog" + echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 + break 2 + fi +done +done +IFS=$as_save_IFS + +fi +fi +CC=$ac_cv_prog_CC +if test -n "$CC"; then + { echo "$as_me:$LINENO: result: $CC" >&5 +echo "${ECHO_T}$CC" >&6; } +else + { echo "$as_me:$LINENO: result: no" >&5 +echo "${ECHO_T}no" >&6; } +fi + + + test -n "$CC" && break + done +fi +if test -z "$CC"; then + ac_ct_CC=$CC + for ac_prog in cl.exe +do + # Extract the first word of "$ac_prog", so it can be a program name with args. +set dummy $ac_prog; ac_word=$2 +{ echo "$as_me:$LINENO: checking for $ac_word" >&5 +echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } +if test "${ac_cv_prog_ac_ct_CC+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + if test -n "$ac_ct_CC"; then + ac_cv_prog_ac_ct_CC="$ac_ct_CC" # Let the user override the test. +else +as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in $PATH +do + IFS=$as_save_IFS + test -z "$as_dir" && as_dir=. + for ac_exec_ext in '' $ac_executable_extensions; do + if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then + ac_cv_prog_ac_ct_CC="$ac_prog" + echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 + break 2 + fi +done +done +IFS=$as_save_IFS + +fi +fi +ac_ct_CC=$ac_cv_prog_ac_ct_CC +if test -n "$ac_ct_CC"; then + { echo "$as_me:$LINENO: result: $ac_ct_CC" >&5 +echo "${ECHO_T}$ac_ct_CC" >&6; } +else + { echo "$as_me:$LINENO: result: no" >&5 +echo "${ECHO_T}no" >&6; } +fi + + + test -n "$ac_ct_CC" && break +done + + if test "x$ac_ct_CC" = x; then + CC="" + else + case $cross_compiling:$ac_tool_warned in +yes:) +{ echo "$as_me:$LINENO: WARNING: In the future, Autoconf will not detect cross-tools +whose name does not start with the host triplet. If you think this +configuration is useful to you, please write to autoconf@gnu.org." >&5 +echo "$as_me: WARNING: In the future, Autoconf will not detect cross-tools +whose name does not start with the host triplet. If you think this +configuration is useful to you, please write to autoconf@gnu.org." >&2;} +ac_tool_warned=yes ;; +esac + CC=$ac_ct_CC + fi +fi + +fi + + +test -z "$CC" && { { echo "$as_me:$LINENO: error: no acceptable C compiler found in \$PATH +See \`config.log' for more details." >&5 +echo "$as_me: error: no acceptable C compiler found in \$PATH +See \`config.log' for more details." >&2;} + { (exit 1); exit 1; }; } + +# Provide some information about the compiler. +echo "$as_me:$LINENO: checking for C compiler version" >&5 +ac_compiler=`set X $ac_compile; echo $2` +{ (ac_try="$ac_compiler --version >&5" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_compiler --version >&5") 2>&5 + ac_status=$? + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } +{ (ac_try="$ac_compiler -v >&5" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_compiler -v >&5") 2>&5 + ac_status=$? + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } +{ (ac_try="$ac_compiler -V >&5" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_compiler -V >&5") 2>&5 + ac_status=$? + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } + +cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ + +int +main () +{ + + ; + return 0; +} +_ACEOF +ac_clean_files_save=$ac_clean_files +ac_clean_files="$ac_clean_files a.out a.exe b.out" +# Try to create an executable without -o first, disregard a.out. +# It will help us diagnose broken compilers, and finding out an intuition +# of exeext. +{ echo "$as_me:$LINENO: checking for C compiler default output file name" >&5 +echo $ECHO_N "checking for C compiler default output file name... $ECHO_C" >&6; } +ac_link_default=`echo "$ac_link" | sed 's/ -o *conftest[^ ]*//'` +# +# List of possible output files, starting from the most likely. +# The algorithm is not robust to junk in `.', hence go to wildcards (a.*) +# only as a last resort. b.out is created by i960 compilers. +ac_files='a_out.exe a.exe conftest.exe a.out conftest a.* conftest.* b.out' +# +# The IRIX 6 linker writes into existing files which may not be +# executable, retaining their permissions. Remove them first so a +# subsequent execution test works. +ac_rmfiles= +for ac_file in $ac_files +do + case $ac_file in + *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.map | *.inf | *.o | *.obj ) ;; + * ) ac_rmfiles="$ac_rmfiles $ac_file";; + esac +done +rm -f $ac_rmfiles + +if { (ac_try="$ac_link_default" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_link_default") 2>&5 + ac_status=$? + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); }; then + # Autoconf-2.13 could set the ac_cv_exeext variable to `no'. +# So ignore a value of `no', otherwise this would lead to `EXEEXT = no' +# in a Makefile. We should not override ac_cv_exeext if it was cached, +# so that the user can short-circuit this test for compilers unknown to +# Autoconf. +for ac_file in $ac_files '' +do + test -f "$ac_file" || continue + case $ac_file in + *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.map | *.inf | *.o | *.obj ) + ;; + [ab].out ) + # We found the default executable, but exeext='' is most + # certainly right. + break;; + *.* ) + if test "${ac_cv_exeext+set}" = set && test "$ac_cv_exeext" != no; + then :; else + ac_cv_exeext=`expr "$ac_file" : '[^.]*\(\..*\)'` + fi + # We set ac_cv_exeext here because the later test for it is not + # safe: cross compilers may not add the suffix if given an `-o' + # argument, so we may need to know it at that point already. + # Even if this section looks crufty: it has the advantage of + # actually working. + break;; + * ) + break;; + esac +done +test "$ac_cv_exeext" = no && ac_cv_exeext= + +else + ac_file='' +fi + +{ echo "$as_me:$LINENO: result: $ac_file" >&5 +echo "${ECHO_T}$ac_file" >&6; } +if test -z "$ac_file"; then + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + +{ { echo "$as_me:$LINENO: error: C compiler cannot create executables +See \`config.log' for more details." >&5 +echo "$as_me: error: C compiler cannot create executables +See \`config.log' for more details." >&2;} + { (exit 77); exit 77; }; } +fi + +ac_exeext=$ac_cv_exeext + +# Check that the compiler produces executables we can run. If not, either +# the compiler is broken, or we cross compile. +{ echo "$as_me:$LINENO: checking whether the C compiler works" >&5 +echo $ECHO_N "checking whether the C compiler works... $ECHO_C" >&6; } +# FIXME: These cross compiler hacks should be removed for Autoconf 3.0 +# If not cross compiling, check that we can run a simple program. +if test "$cross_compiling" != yes; then + if { ac_try='./$ac_file' + { (case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_try") 2>&5 + ac_status=$? + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); }; }; then + cross_compiling=no + else + if test "$cross_compiling" = maybe; then + cross_compiling=yes + else + { { echo "$as_me:$LINENO: error: cannot run C compiled programs. +If you meant to cross compile, use \`--host'. +See \`config.log' for more details." >&5 +echo "$as_me: error: cannot run C compiled programs. +If you meant to cross compile, use \`--host'. +See \`config.log' for more details." >&2;} + { (exit 1); exit 1; }; } + fi + fi +fi +{ echo "$as_me:$LINENO: result: yes" >&5 +echo "${ECHO_T}yes" >&6; } + +rm -f a.out a.exe conftest$ac_cv_exeext b.out +ac_clean_files=$ac_clean_files_save +# Check that the compiler produces executables we can run. If not, either +# the compiler is broken, or we cross compile. +{ echo "$as_me:$LINENO: checking whether we are cross compiling" >&5 +echo $ECHO_N "checking whether we are cross compiling... $ECHO_C" >&6; } +{ echo "$as_me:$LINENO: result: $cross_compiling" >&5 +echo "${ECHO_T}$cross_compiling" >&6; } + +{ echo "$as_me:$LINENO: checking for suffix of executables" >&5 +echo $ECHO_N "checking for suffix of executables... $ECHO_C" >&6; } +if { (ac_try="$ac_link" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_link") 2>&5 + ac_status=$? + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); }; then + # If both `conftest.exe' and `conftest' are `present' (well, observable) +# catch `conftest.exe'. For instance with Cygwin, `ls conftest' will +# work properly (i.e., refer to `conftest.exe'), while it won't with +# `rm'. +for ac_file in conftest.exe conftest conftest.*; do + test -f "$ac_file" || continue + case $ac_file in + *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.map | *.inf | *.o | *.obj ) ;; + *.* ) ac_cv_exeext=`expr "$ac_file" : '[^.]*\(\..*\)'` + break;; + * ) break;; + esac +done +else + { { echo "$as_me:$LINENO: error: cannot compute suffix of executables: cannot compile and link +See \`config.log' for more details." >&5 +echo "$as_me: error: cannot compute suffix of executables: cannot compile and link +See \`config.log' for more details." >&2;} + { (exit 1); exit 1; }; } +fi + +rm -f conftest$ac_cv_exeext +{ echo "$as_me:$LINENO: result: $ac_cv_exeext" >&5 +echo "${ECHO_T}$ac_cv_exeext" >&6; } + +rm -f conftest.$ac_ext +EXEEXT=$ac_cv_exeext +ac_exeext=$EXEEXT +{ echo "$as_me:$LINENO: checking for suffix of object files" >&5 +echo $ECHO_N "checking for suffix of object files... $ECHO_C" >&6; } +if test "${ac_cv_objext+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ + +int +main () +{ + + ; + return 0; +} +_ACEOF +rm -f conftest.o conftest.obj +if { (ac_try="$ac_compile" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_compile") 2>&5 + ac_status=$? + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); }; then + for ac_file in conftest.o conftest.obj conftest.*; do + test -f "$ac_file" || continue; + case $ac_file in + *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.map | *.inf ) ;; + *) ac_cv_objext=`expr "$ac_file" : '.*\.\(.*\)'` + break;; + esac +done +else + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + +{ { echo "$as_me:$LINENO: error: cannot compute suffix of object files: cannot compile +See \`config.log' for more details." >&5 +echo "$as_me: error: cannot compute suffix of object files: cannot compile +See \`config.log' for more details." >&2;} + { (exit 1); exit 1; }; } +fi + +rm -f conftest.$ac_cv_objext conftest.$ac_ext +fi +{ echo "$as_me:$LINENO: result: $ac_cv_objext" >&5 +echo "${ECHO_T}$ac_cv_objext" >&6; } +OBJEXT=$ac_cv_objext +ac_objext=$OBJEXT +{ echo "$as_me:$LINENO: checking whether we are using the GNU C compiler" >&5 +echo $ECHO_N "checking whether we are using the GNU C compiler... $ECHO_C" >&6; } +if test "${ac_cv_c_compiler_gnu+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ + +int +main () +{ +#ifndef __GNUC__ + choke me +#endif + + ; + return 0; +} +_ACEOF +rm -f conftest.$ac_objext +if { (ac_try="$ac_compile" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_compile") 2>conftest.er1 + ac_status=$? + grep -v '^ *+' conftest.er1 >conftest.err + rm -f conftest.er1 + cat conftest.err >&5 + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } && { + test -z "$ac_c_werror_flag" || + test ! -s conftest.err + } && test -s conftest.$ac_objext; then + ac_compiler_gnu=yes +else + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + + ac_compiler_gnu=no +fi + +rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext +ac_cv_c_compiler_gnu=$ac_compiler_gnu + +fi +{ echo "$as_me:$LINENO: result: $ac_cv_c_compiler_gnu" >&5 +echo "${ECHO_T}$ac_cv_c_compiler_gnu" >&6; } +GCC=`test $ac_compiler_gnu = yes && echo yes` +ac_test_CFLAGS=${CFLAGS+set} +ac_save_CFLAGS=$CFLAGS +{ echo "$as_me:$LINENO: checking whether $CC accepts -g" >&5 +echo $ECHO_N "checking whether $CC accepts -g... $ECHO_C" >&6; } +if test "${ac_cv_prog_cc_g+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + ac_save_c_werror_flag=$ac_c_werror_flag + ac_c_werror_flag=yes + ac_cv_prog_cc_g=no + CFLAGS="-g" + cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ + +int +main () +{ + + ; + return 0; +} +_ACEOF +rm -f conftest.$ac_objext +if { (ac_try="$ac_compile" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_compile") 2>conftest.er1 + ac_status=$? + grep -v '^ *+' conftest.er1 >conftest.err + rm -f conftest.er1 + cat conftest.err >&5 + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } && { + test -z "$ac_c_werror_flag" || + test ! -s conftest.err + } && test -s conftest.$ac_objext; then + ac_cv_prog_cc_g=yes +else + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + + CFLAGS="" + cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ + +int +main () +{ + + ; + return 0; +} +_ACEOF +rm -f conftest.$ac_objext +if { (ac_try="$ac_compile" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_compile") 2>conftest.er1 + ac_status=$? + grep -v '^ *+' conftest.er1 >conftest.err + rm -f conftest.er1 + cat conftest.err >&5 + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } && { + test -z "$ac_c_werror_flag" || + test ! -s conftest.err + } && test -s conftest.$ac_objext; then + : +else + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + + ac_c_werror_flag=$ac_save_c_werror_flag + CFLAGS="-g" + cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ + +int +main () +{ + + ; + return 0; +} +_ACEOF +rm -f conftest.$ac_objext +if { (ac_try="$ac_compile" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_compile") 2>conftest.er1 + ac_status=$? + grep -v '^ *+' conftest.er1 >conftest.err + rm -f conftest.er1 + cat conftest.err >&5 + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } && { + test -z "$ac_c_werror_flag" || + test ! -s conftest.err + } && test -s conftest.$ac_objext; then + ac_cv_prog_cc_g=yes +else + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + + +fi + +rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext +fi + +rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext +fi + +rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext + ac_c_werror_flag=$ac_save_c_werror_flag +fi +{ echo "$as_me:$LINENO: result: $ac_cv_prog_cc_g" >&5 +echo "${ECHO_T}$ac_cv_prog_cc_g" >&6; } +if test "$ac_test_CFLAGS" = set; then + CFLAGS=$ac_save_CFLAGS +elif test $ac_cv_prog_cc_g = yes; then + if test "$GCC" = yes; then + CFLAGS="-g -O2" + else + CFLAGS="-g" + fi +else + if test "$GCC" = yes; then + CFLAGS="-O2" + else + CFLAGS= + fi +fi +{ echo "$as_me:$LINENO: checking for $CC option to accept ISO C89" >&5 +echo $ECHO_N "checking for $CC option to accept ISO C89... $ECHO_C" >&6; } +if test "${ac_cv_prog_cc_c89+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + ac_cv_prog_cc_c89=no +ac_save_CC=$CC +cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ +#include +#include +#include +#include +/* Most of the following tests are stolen from RCS 5.7's src/conf.sh. */ +struct buf { int x; }; +FILE * (*rcsopen) (struct buf *, struct stat *, int); +static char *e (p, i) + char **p; + int i; +{ + return p[i]; +} +static char *f (char * (*g) (char **, int), char **p, ...) +{ + char *s; + va_list v; + va_start (v,p); + s = g (p, va_arg (v,int)); + va_end (v); + return s; +} + +/* OSF 4.0 Compaq cc is some sort of almost-ANSI by default. It has + function prototypes and stuff, but not '\xHH' hex character constants. + These don't provoke an error unfortunately, instead are silently treated + as 'x'. The following induces an error, until -std is added to get + proper ANSI mode. Curiously '\x00'!='x' always comes out true, for an + array size at least. It's necessary to write '\x00'==0 to get something + that's true only with -std. */ +int osf4_cc_array ['\x00' == 0 ? 1 : -1]; + +/* IBM C 6 for AIX is almost-ANSI by default, but it replaces macro parameters + inside strings and character constants. */ +#define FOO(x) 'x' +int xlc6_cc_array[FOO(a) == 'x' ? 1 : -1]; + +int test (int i, double x); +struct s1 {int (*f) (int a);}; +struct s2 {int (*f) (double a);}; +int pairnames (int, char **, FILE *(*)(struct buf *, struct stat *, int), int, int); +int argc; +char **argv; +int +main () +{ +return f (e, argv, 0) != argv[0] || f (e, argv, 1) != argv[1]; + ; + return 0; +} +_ACEOF +for ac_arg in '' -qlanglvl=extc89 -qlanglvl=ansi -std \ + -Ae "-Aa -D_HPUX_SOURCE" "-Xc -D__EXTENSIONS__" +do + CC="$ac_save_CC $ac_arg" + rm -f conftest.$ac_objext +if { (ac_try="$ac_compile" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_compile") 2>conftest.er1 + ac_status=$? + grep -v '^ *+' conftest.er1 >conftest.err + rm -f conftest.er1 + cat conftest.err >&5 + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } && { + test -z "$ac_c_werror_flag" || + test ! -s conftest.err + } && test -s conftest.$ac_objext; then + ac_cv_prog_cc_c89=$ac_arg +else + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + + +fi + +rm -f core conftest.err conftest.$ac_objext + test "x$ac_cv_prog_cc_c89" != "xno" && break +done +rm -f conftest.$ac_ext +CC=$ac_save_CC + +fi +# AC_CACHE_VAL +case "x$ac_cv_prog_cc_c89" in + x) + { echo "$as_me:$LINENO: result: none needed" >&5 +echo "${ECHO_T}none needed" >&6; } ;; + xno) + { echo "$as_me:$LINENO: result: unsupported" >&5 +echo "${ECHO_T}unsupported" >&6; } ;; + *) + CC="$CC $ac_cv_prog_cc_c89" + { echo "$as_me:$LINENO: result: $ac_cv_prog_cc_c89" >&5 +echo "${ECHO_T}$ac_cv_prog_cc_c89" >&6; } ;; +esac + + +ac_ext=c +ac_cpp='$CPP $CPPFLAGS' +ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' +ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' +ac_compiler_gnu=$ac_cv_c_compiler_gnu + +ac_ext=cpp +ac_cpp='$CXXCPP $CPPFLAGS' +ac_compile='$CXX -c $CXXFLAGS $CPPFLAGS conftest.$ac_ext >&5' +ac_link='$CXX -o conftest$ac_exeext $CXXFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' +ac_compiler_gnu=$ac_cv_cxx_compiler_gnu +if test -z "$CXX"; then + if test -n "$CCC"; then + CXX=$CCC + else + if test -n "$ac_tool_prefix"; then + for ac_prog in g++ c++ gpp aCC CC cxx cc++ cl.exe FCC KCC RCC xlC_r xlC + do + # Extract the first word of "$ac_tool_prefix$ac_prog", so it can be a program name with args. +set dummy $ac_tool_prefix$ac_prog; ac_word=$2 +{ echo "$as_me:$LINENO: checking for $ac_word" >&5 +echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } +if test "${ac_cv_prog_CXX+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + if test -n "$CXX"; then + ac_cv_prog_CXX="$CXX" # Let the user override the test. +else +as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in $PATH +do + IFS=$as_save_IFS + test -z "$as_dir" && as_dir=. + for ac_exec_ext in '' $ac_executable_extensions; do + if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then + ac_cv_prog_CXX="$ac_tool_prefix$ac_prog" + echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 + break 2 + fi +done +done +IFS=$as_save_IFS + +fi +fi +CXX=$ac_cv_prog_CXX +if test -n "$CXX"; then + { echo "$as_me:$LINENO: result: $CXX" >&5 +echo "${ECHO_T}$CXX" >&6; } +else + { echo "$as_me:$LINENO: result: no" >&5 +echo "${ECHO_T}no" >&6; } +fi + + + test -n "$CXX" && break + done +fi +if test -z "$CXX"; then + ac_ct_CXX=$CXX + for ac_prog in g++ c++ gpp aCC CC cxx cc++ cl.exe FCC KCC RCC xlC_r xlC +do + # Extract the first word of "$ac_prog", so it can be a program name with args. +set dummy $ac_prog; ac_word=$2 +{ echo "$as_me:$LINENO: checking for $ac_word" >&5 +echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } +if test "${ac_cv_prog_ac_ct_CXX+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + if test -n "$ac_ct_CXX"; then + ac_cv_prog_ac_ct_CXX="$ac_ct_CXX" # Let the user override the test. +else +as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in $PATH +do + IFS=$as_save_IFS + test -z "$as_dir" && as_dir=. + for ac_exec_ext in '' $ac_executable_extensions; do + if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then + ac_cv_prog_ac_ct_CXX="$ac_prog" + echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 + break 2 + fi +done +done +IFS=$as_save_IFS + +fi +fi +ac_ct_CXX=$ac_cv_prog_ac_ct_CXX +if test -n "$ac_ct_CXX"; then + { echo "$as_me:$LINENO: result: $ac_ct_CXX" >&5 +echo "${ECHO_T}$ac_ct_CXX" >&6; } +else + { echo "$as_me:$LINENO: result: no" >&5 +echo "${ECHO_T}no" >&6; } +fi + + + test -n "$ac_ct_CXX" && break +done + + if test "x$ac_ct_CXX" = x; then + CXX="g++" + else + case $cross_compiling:$ac_tool_warned in +yes:) +{ echo "$as_me:$LINENO: WARNING: In the future, Autoconf will not detect cross-tools +whose name does not start with the host triplet. If you think this +configuration is useful to you, please write to autoconf@gnu.org." >&5 +echo "$as_me: WARNING: In the future, Autoconf will not detect cross-tools +whose name does not start with the host triplet. If you think this +configuration is useful to you, please write to autoconf@gnu.org." >&2;} +ac_tool_warned=yes ;; +esac + CXX=$ac_ct_CXX + fi +fi + + fi +fi +# Provide some information about the compiler. +echo "$as_me:$LINENO: checking for C++ compiler version" >&5 +ac_compiler=`set X $ac_compile; echo $2` +{ (ac_try="$ac_compiler --version >&5" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_compiler --version >&5") 2>&5 + ac_status=$? + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } +{ (ac_try="$ac_compiler -v >&5" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_compiler -v >&5") 2>&5 + ac_status=$? + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } +{ (ac_try="$ac_compiler -V >&5" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_compiler -V >&5") 2>&5 + ac_status=$? + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } + +{ echo "$as_me:$LINENO: checking whether we are using the GNU C++ compiler" >&5 +echo $ECHO_N "checking whether we are using the GNU C++ compiler... $ECHO_C" >&6; } +if test "${ac_cv_cxx_compiler_gnu+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ + +int +main () +{ +#ifndef __GNUC__ + choke me +#endif + + ; + return 0; +} +_ACEOF +rm -f conftest.$ac_objext +if { (ac_try="$ac_compile" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_compile") 2>conftest.er1 + ac_status=$? + grep -v '^ *+' conftest.er1 >conftest.err + rm -f conftest.er1 + cat conftest.err >&5 + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } && { + test -z "$ac_cxx_werror_flag" || + test ! -s conftest.err + } && test -s conftest.$ac_objext; then + ac_compiler_gnu=yes +else + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + + ac_compiler_gnu=no +fi + +rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext +ac_cv_cxx_compiler_gnu=$ac_compiler_gnu + +fi +{ echo "$as_me:$LINENO: result: $ac_cv_cxx_compiler_gnu" >&5 +echo "${ECHO_T}$ac_cv_cxx_compiler_gnu" >&6; } +GXX=`test $ac_compiler_gnu = yes && echo yes` +ac_test_CXXFLAGS=${CXXFLAGS+set} +ac_save_CXXFLAGS=$CXXFLAGS +{ echo "$as_me:$LINENO: checking whether $CXX accepts -g" >&5 +echo $ECHO_N "checking whether $CXX accepts -g... $ECHO_C" >&6; } +if test "${ac_cv_prog_cxx_g+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + ac_save_cxx_werror_flag=$ac_cxx_werror_flag + ac_cxx_werror_flag=yes + ac_cv_prog_cxx_g=no + CXXFLAGS="-g" + cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ + +int +main () +{ + + ; + return 0; +} +_ACEOF +rm -f conftest.$ac_objext +if { (ac_try="$ac_compile" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_compile") 2>conftest.er1 + ac_status=$? + grep -v '^ *+' conftest.er1 >conftest.err + rm -f conftest.er1 + cat conftest.err >&5 + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } && { + test -z "$ac_cxx_werror_flag" || + test ! -s conftest.err + } && test -s conftest.$ac_objext; then + ac_cv_prog_cxx_g=yes +else + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + + CXXFLAGS="" + cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ + +int +main () +{ + + ; + return 0; +} +_ACEOF +rm -f conftest.$ac_objext +if { (ac_try="$ac_compile" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_compile") 2>conftest.er1 + ac_status=$? + grep -v '^ *+' conftest.er1 >conftest.err + rm -f conftest.er1 + cat conftest.err >&5 + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } && { + test -z "$ac_cxx_werror_flag" || + test ! -s conftest.err + } && test -s conftest.$ac_objext; then + : +else + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + + ac_cxx_werror_flag=$ac_save_cxx_werror_flag + CXXFLAGS="-g" + cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ + +int +main () +{ + + ; + return 0; +} +_ACEOF +rm -f conftest.$ac_objext +if { (ac_try="$ac_compile" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_compile") 2>conftest.er1 + ac_status=$? + grep -v '^ *+' conftest.er1 >conftest.err + rm -f conftest.er1 + cat conftest.err >&5 + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } && { + test -z "$ac_cxx_werror_flag" || + test ! -s conftest.err + } && test -s conftest.$ac_objext; then + ac_cv_prog_cxx_g=yes +else + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + + +fi + +rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext +fi + +rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext +fi + +rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext + ac_cxx_werror_flag=$ac_save_cxx_werror_flag +fi +{ echo "$as_me:$LINENO: result: $ac_cv_prog_cxx_g" >&5 +echo "${ECHO_T}$ac_cv_prog_cxx_g" >&6; } +if test "$ac_test_CXXFLAGS" = set; then + CXXFLAGS=$ac_save_CXXFLAGS +elif test $ac_cv_prog_cxx_g = yes; then + if test "$GXX" = yes; then + CXXFLAGS="-g -O2" + else + CXXFLAGS="-g" + fi +else + if test "$GXX" = yes; then + CXXFLAGS="-O2" + else + CXXFLAGS= + fi +fi +ac_ext=c +ac_cpp='$CPP $CPPFLAGS' +ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' +ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' +ac_compiler_gnu=$ac_cv_c_compiler_gnu + +ac_aux_dir= +for ac_dir in "$srcdir" "$srcdir/.." "$srcdir/../.."; do + if test -f "$ac_dir/install-sh"; then + ac_aux_dir=$ac_dir + ac_install_sh="$ac_aux_dir/install-sh -c" + break + elif test -f "$ac_dir/install.sh"; then + ac_aux_dir=$ac_dir + ac_install_sh="$ac_aux_dir/install.sh -c" + break + elif test -f "$ac_dir/shtool"; then + ac_aux_dir=$ac_dir + ac_install_sh="$ac_aux_dir/shtool install -c" + break + fi +done +if test -z "$ac_aux_dir"; then + { { echo "$as_me:$LINENO: error: cannot find install-sh or install.sh in \"$srcdir\" \"$srcdir/..\" \"$srcdir/../..\"" >&5 +echo "$as_me: error: cannot find install-sh or install.sh in \"$srcdir\" \"$srcdir/..\" \"$srcdir/../..\"" >&2;} + { (exit 1); exit 1; }; } +fi + +# These three variables are undocumented and unsupported, +# and are intended to be withdrawn in a future Autoconf release. +# They can cause serious problems if a builder's source tree is in a directory +# whose full name contains unusual characters. +ac_config_guess="$SHELL $ac_aux_dir/config.guess" # Please don't use this var. +ac_config_sub="$SHELL $ac_aux_dir/config.sub" # Please don't use this var. +ac_configure="$SHELL $ac_aux_dir/configure" # Please don't use this var. + + +# Find a good install program. We prefer a C program (faster), +# so one script is as good as another. But avoid the broken or +# incompatible versions: +# SysV /etc/install, /usr/sbin/install +# SunOS /usr/etc/install +# IRIX /sbin/install +# AIX /bin/install +# AmigaOS /C/install, which installs bootblocks on floppy discs +# AIX 4 /usr/bin/installbsd, which doesn't work without a -g flag +# AFS /usr/afsws/bin/install, which mishandles nonexistent args +# SVR4 /usr/ucb/install, which tries to use the nonexistent group "staff" +# OS/2's system install, which has a completely different semantic +# ./install, which can be erroneously created by make from ./install.sh. +{ echo "$as_me:$LINENO: checking for a BSD-compatible install" >&5 +echo $ECHO_N "checking for a BSD-compatible install... $ECHO_C" >&6; } +if test -z "$INSTALL"; then +if test "${ac_cv_path_install+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in $PATH +do + IFS=$as_save_IFS + test -z "$as_dir" && as_dir=. + # Account for people who put trailing slashes in PATH elements. +case $as_dir/ in + ./ | .// | /cC/* | \ + /etc/* | /usr/sbin/* | /usr/etc/* | /sbin/* | /usr/afsws/bin/* | \ + ?:\\/os2\\/install\\/* | ?:\\/OS2\\/INSTALL\\/* | \ + /usr/ucb/* ) ;; + *) + # OSF1 and SCO ODT 3.0 have their own names for install. + # Don't use installbsd from OSF since it installs stuff as root + # by default. + for ac_prog in ginstall scoinst install; do + for ac_exec_ext in '' $ac_executable_extensions; do + if { test -f "$as_dir/$ac_prog$ac_exec_ext" && $as_test_x "$as_dir/$ac_prog$ac_exec_ext"; }; then + if test $ac_prog = install && + grep dspmsg "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then + # AIX install. It has an incompatible calling convention. + : + elif test $ac_prog = install && + grep pwplus "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then + # program-specific install script used by HP pwplus--don't use. + : + else + ac_cv_path_install="$as_dir/$ac_prog$ac_exec_ext -c" + break 3 + fi + fi + done + done + ;; +esac +done +IFS=$as_save_IFS + + +fi + if test "${ac_cv_path_install+set}" = set; then + INSTALL=$ac_cv_path_install + else + # As a last resort, use the slow shell script. Don't cache a + # value for INSTALL within a source directory, because that will + # break other packages using the cache if that directory is + # removed, or if the value is a relative name. + INSTALL=$ac_install_sh + fi +fi +{ echo "$as_me:$LINENO: result: $INSTALL" >&5 +echo "${ECHO_T}$INSTALL" >&6; } + +# Use test -z because SunOS4 sh mishandles braces in ${var-val}. +# It thinks the first close brace ends the variable substitution. +test -z "$INSTALL_PROGRAM" && INSTALL_PROGRAM='${INSTALL}' + +test -z "$INSTALL_SCRIPT" && INSTALL_SCRIPT='${INSTALL}' + +test -z "$INSTALL_DATA" && INSTALL_DATA='${INSTALL} -m 644' + +if test "$INSTALL" = "$ac_install_sh"; then + # Use full path to install-sh script... + INSTALL="`pwd`/install-sh -c" +fi +if test -n "$ac_tool_prefix"; then + # Extract the first word of "${ac_tool_prefix}ranlib", so it can be a program name with args. +set dummy ${ac_tool_prefix}ranlib; ac_word=$2 +{ echo "$as_me:$LINENO: checking for $ac_word" >&5 +echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } +if test "${ac_cv_prog_RANLIB+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + if test -n "$RANLIB"; then + ac_cv_prog_RANLIB="$RANLIB" # Let the user override the test. +else +as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in $PATH +do + IFS=$as_save_IFS + test -z "$as_dir" && as_dir=. + for ac_exec_ext in '' $ac_executable_extensions; do + if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then + ac_cv_prog_RANLIB="${ac_tool_prefix}ranlib" + echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 + break 2 + fi +done +done +IFS=$as_save_IFS + +fi +fi +RANLIB=$ac_cv_prog_RANLIB +if test -n "$RANLIB"; then + { echo "$as_me:$LINENO: result: $RANLIB" >&5 +echo "${ECHO_T}$RANLIB" >&6; } +else + { echo "$as_me:$LINENO: result: no" >&5 +echo "${ECHO_T}no" >&6; } +fi + + +fi +if test -z "$ac_cv_prog_RANLIB"; then + ac_ct_RANLIB=$RANLIB + # Extract the first word of "ranlib", so it can be a program name with args. +set dummy ranlib; ac_word=$2 +{ echo "$as_me:$LINENO: checking for $ac_word" >&5 +echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } +if test "${ac_cv_prog_ac_ct_RANLIB+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + if test -n "$ac_ct_RANLIB"; then + ac_cv_prog_ac_ct_RANLIB="$ac_ct_RANLIB" # Let the user override the test. +else +as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in $PATH +do + IFS=$as_save_IFS + test -z "$as_dir" && as_dir=. + for ac_exec_ext in '' $ac_executable_extensions; do + if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then + ac_cv_prog_ac_ct_RANLIB="ranlib" + echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 + break 2 + fi +done +done +IFS=$as_save_IFS + +fi +fi +ac_ct_RANLIB=$ac_cv_prog_ac_ct_RANLIB +if test -n "$ac_ct_RANLIB"; then + { echo "$as_me:$LINENO: result: $ac_ct_RANLIB" >&5 +echo "${ECHO_T}$ac_ct_RANLIB" >&6; } +else + { echo "$as_me:$LINENO: result: no" >&5 +echo "${ECHO_T}no" >&6; } +fi + + if test "x$ac_ct_RANLIB" = x; then + RANLIB=":" + else + case $cross_compiling:$ac_tool_warned in +yes:) +{ echo "$as_me:$LINENO: WARNING: In the future, Autoconf will not detect cross-tools +whose name does not start with the host triplet. If you think this +configuration is useful to you, please write to autoconf@gnu.org." >&5 +echo "$as_me: WARNING: In the future, Autoconf will not detect cross-tools +whose name does not start with the host triplet. If you think this +configuration is useful to you, please write to autoconf@gnu.org." >&2;} +ac_tool_warned=yes ;; +esac + RANLIB=$ac_ct_RANLIB + fi +else + RANLIB="$ac_cv_prog_RANLIB" +fi + +# Extract the first word of "ar", so it can be a program name with args. +set dummy ar; ac_word=$2 +{ echo "$as_me:$LINENO: checking for $ac_word" >&5 +echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } +if test "${ac_cv_path_AR+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + case $AR in + [\\/]* | ?:[\\/]*) + ac_cv_path_AR="$AR" # Let the user override the test with a path. + ;; + *) + as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in $PATH +do + IFS=$as_save_IFS + test -z "$as_dir" && as_dir=. + for ac_exec_ext in '' $ac_executable_extensions; do + if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then + ac_cv_path_AR="$as_dir/$ac_word$ac_exec_ext" + echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 + break 2 + fi +done +done +IFS=$as_save_IFS + + ;; +esac +fi +AR=$ac_cv_path_AR +if test -n "$AR"; then + { echo "$as_me:$LINENO: result: $AR" >&5 +echo "${ECHO_T}$AR" >&6; } +else + { echo "$as_me:$LINENO: result: no" >&5 +echo "${ECHO_T}no" >&6; } +fi + + +# Extract the first word of "cp", so it can be a program name with args. +set dummy cp; ac_word=$2 +{ echo "$as_me:$LINENO: checking for $ac_word" >&5 +echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } +if test "${ac_cv_path_CP+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + case $CP in + [\\/]* | ?:[\\/]*) + ac_cv_path_CP="$CP" # Let the user override the test with a path. + ;; + *) + as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in $PATH +do + IFS=$as_save_IFS + test -z "$as_dir" && as_dir=. + for ac_exec_ext in '' $ac_executable_extensions; do + if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then + ac_cv_path_CP="$as_dir/$ac_word$ac_exec_ext" + echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 + break 2 + fi +done +done +IFS=$as_save_IFS + + ;; +esac +fi +CP=$ac_cv_path_CP +if test -n "$CP"; then + { echo "$as_me:$LINENO: result: $CP" >&5 +echo "${ECHO_T}$CP" >&6; } +else + { echo "$as_me:$LINENO: result: no" >&5 +echo "${ECHO_T}no" >&6; } +fi + + +# Extract the first word of "ln", so it can be a program name with args. +set dummy ln; ac_word=$2 +{ echo "$as_me:$LINENO: checking for $ac_word" >&5 +echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } +if test "${ac_cv_path_LN+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + case $LN in + [\\/]* | ?:[\\/]*) + ac_cv_path_LN="$LN" # Let the user override the test with a path. + ;; + *) + as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in $PATH +do + IFS=$as_save_IFS + test -z "$as_dir" && as_dir=. + for ac_exec_ext in '' $ac_executable_extensions; do + if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then + ac_cv_path_LN="$as_dir/$ac_word$ac_exec_ext" + echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 + break 2 + fi +done +done +IFS=$as_save_IFS + + ;; +esac +fi +LN=$ac_cv_path_LN +if test -n "$LN"; then + { echo "$as_me:$LINENO: result: $LN" >&5 +echo "${ECHO_T}$LN" >&6; } +else + { echo "$as_me:$LINENO: result: no" >&5 +echo "${ECHO_T}no" >&6; } +fi + + +# Extract the first word of "mkdir", so it can be a program name with args. +set dummy mkdir; ac_word=$2 +{ echo "$as_me:$LINENO: checking for $ac_word" >&5 +echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } +if test "${ac_cv_path_MKDIR+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + case $MKDIR in + [\\/]* | ?:[\\/]*) + ac_cv_path_MKDIR="$MKDIR" # Let the user override the test with a path. + ;; + *) + as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in $PATH +do + IFS=$as_save_IFS + test -z "$as_dir" && as_dir=. + for ac_exec_ext in '' $ac_executable_extensions; do + if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then + ac_cv_path_MKDIR="$as_dir/$ac_word$ac_exec_ext" + echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 + break 2 + fi +done +done +IFS=$as_save_IFS + + ;; +esac +fi +MKDIR=$ac_cv_path_MKDIR +if test -n "$MKDIR"; then + { echo "$as_me:$LINENO: result: $MKDIR" >&5 +echo "${ECHO_T}$MKDIR" >&6; } +else + { echo "$as_me:$LINENO: result: no" >&5 +echo "${ECHO_T}no" >&6; } +fi + + +# Extract the first word of "rm", so it can be a program name with args. +set dummy rm; ac_word=$2 +{ echo "$as_me:$LINENO: checking for $ac_word" >&5 +echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; } +if test "${ac_cv_path_RM+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + case $RM in + [\\/]* | ?:[\\/]*) + ac_cv_path_RM="$RM" # Let the user override the test with a path. + ;; + *) + as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in $PATH +do + IFS=$as_save_IFS + test -z "$as_dir" && as_dir=. + for ac_exec_ext in '' $ac_executable_extensions; do + if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then + ac_cv_path_RM="$as_dir/$ac_word$ac_exec_ext" + echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5 + break 2 + fi +done +done +IFS=$as_save_IFS + + ;; +esac +fi +RM=$ac_cv_path_RM +if test -n "$RM"; then + { echo "$as_me:$LINENO: result: $RM" >&5 +echo "${ECHO_T}$RM" >&6; } +else + { echo "$as_me:$LINENO: result: no" >&5 +echo "${ECHO_T}no" >&6; } +fi + + + +case "$uname" in + Darwin* | *BSD*) + ARFLAGS="-rcv" + ;; + *) + ARFLAGS="crvs" + ;; +esac + + + + +{ echo "$as_me:$LINENO: checking for inline" >&5 +echo $ECHO_N "checking for inline... $ECHO_C" >&6; } +if test "${ac_cv_c_inline+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + ac_cv_c_inline=no +for ac_kw in inline __inline__ __inline; do + cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ +#ifndef __cplusplus +typedef int foo_t; +static $ac_kw foo_t static_foo () {return 0; } +$ac_kw foo_t foo () {return 0; } +#endif + +_ACEOF +rm -f conftest.$ac_objext +if { (ac_try="$ac_compile" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_compile") 2>conftest.er1 + ac_status=$? + grep -v '^ *+' conftest.er1 >conftest.err + rm -f conftest.er1 + cat conftest.err >&5 + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } && { + test -z "$ac_c_werror_flag" || + test ! -s conftest.err + } && test -s conftest.$ac_objext; then + ac_cv_c_inline=$ac_kw +else + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + + +fi + +rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext + test "$ac_cv_c_inline" != no && break +done + +fi +{ echo "$as_me:$LINENO: result: $ac_cv_c_inline" >&5 +echo "${ECHO_T}$ac_cv_c_inline" >&6; } + + +case $ac_cv_c_inline in + inline | yes) ;; + *) + case $ac_cv_c_inline in + no) ac_val=;; + *) ac_val=$ac_cv_c_inline;; + esac + cat >>confdefs.h <<_ACEOF +#ifndef __cplusplus +#define inline $ac_val +#endif +_ACEOF + ;; +esac + + +if test "x$use_ansi" != xyes; then + +for ac_func in strdup +do +as_ac_var=`echo "ac_cv_func_$ac_func" | $as_tr_sh` +{ echo "$as_me:$LINENO: checking for $ac_func" >&5 +echo $ECHO_N "checking for $ac_func... $ECHO_C" >&6; } +if { as_var=$as_ac_var; eval "test \"\${$as_var+set}\" = set"; }; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ +/* Define $ac_func to an innocuous variant, in case declares $ac_func. + For example, HP-UX 11i declares gettimeofday. */ +#define $ac_func innocuous_$ac_func + +/* System header to define __stub macros and hopefully few prototypes, + which can conflict with char $ac_func (); below. + Prefer to if __STDC__ is defined, since + exists even on freestanding compilers. */ + +#ifdef __STDC__ +# include +#else +# include +#endif + +#undef $ac_func + +/* Override any GCC internal prototype to avoid an error. + Use char because int might match the return type of a GCC + builtin and then its argument prototype would still apply. */ +#ifdef __cplusplus +extern "C" +#endif +char $ac_func (); +/* The GNU C library defines this for functions which it implements + to always fail with ENOSYS. Some functions are actually named + something starting with __ and the normal name is an alias. */ +#if defined __stub_$ac_func || defined __stub___$ac_func +choke me +#endif + +int +main () +{ +return $ac_func (); + ; + return 0; +} +_ACEOF +rm -f conftest.$ac_objext conftest$ac_exeext +if { (ac_try="$ac_link" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_link") 2>conftest.er1 + ac_status=$? + grep -v '^ *+' conftest.er1 >conftest.err + rm -f conftest.er1 + cat conftest.err >&5 + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } && { + test -z "$ac_c_werror_flag" || + test ! -s conftest.err + } && test -s conftest$ac_exeext && + $as_test_x conftest$ac_exeext; then + eval "$as_ac_var=yes" +else + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + + eval "$as_ac_var=no" +fi + +rm -f core conftest.err conftest.$ac_objext conftest_ipa8_conftest.oo \ + conftest$ac_exeext conftest.$ac_ext +fi +ac_res=`eval echo '${'$as_ac_var'}'` + { echo "$as_me:$LINENO: result: $ac_res" >&5 +echo "${ECHO_T}$ac_res" >&6; } +if test `eval echo '${'$as_ac_var'}'` = yes; then + cat >>confdefs.h <<_ACEOF +#define `echo "HAVE_$ac_func" | $as_tr_cpp` 1 +_ACEOF + +fi +done + +fi + +if test "x$use_vsnprintf" != xyes; then + + +for ac_func in snprintf vsnprintf +do +as_ac_var=`echo "ac_cv_func_$ac_func" | $as_tr_sh` +{ echo "$as_me:$LINENO: checking for $ac_func" >&5 +echo $ECHO_N "checking for $ac_func... $ECHO_C" >&6; } +if { as_var=$as_ac_var; eval "test \"\${$as_var+set}\" = set"; }; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ +/* Define $ac_func to an innocuous variant, in case declares $ac_func. + For example, HP-UX 11i declares gettimeofday. */ +#define $ac_func innocuous_$ac_func + +/* System header to define __stub macros and hopefully few prototypes, + which can conflict with char $ac_func (); below. + Prefer to if __STDC__ is defined, since + exists even on freestanding compilers. */ + +#ifdef __STDC__ +# include +#else +# include +#endif + +#undef $ac_func + +/* Override any GCC internal prototype to avoid an error. + Use char because int might match the return type of a GCC + builtin and then its argument prototype would still apply. */ +#ifdef __cplusplus +extern "C" +#endif +char $ac_func (); +/* The GNU C library defines this for functions which it implements + to always fail with ENOSYS. Some functions are actually named + something starting with __ and the normal name is an alias. */ +#if defined __stub_$ac_func || defined __stub___$ac_func +choke me +#endif + +int +main () +{ +return $ac_func (); + ; + return 0; +} +_ACEOF +rm -f conftest.$ac_objext conftest$ac_exeext +if { (ac_try="$ac_link" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_link") 2>conftest.er1 + ac_status=$? + grep -v '^ *+' conftest.er1 >conftest.err + rm -f conftest.er1 + cat conftest.err >&5 + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } && { + test -z "$ac_c_werror_flag" || + test ! -s conftest.err + } && test -s conftest$ac_exeext && + $as_test_x conftest$ac_exeext; then + eval "$as_ac_var=yes" +else + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + + eval "$as_ac_var=no" +fi + +rm -f core conftest.err conftest.$ac_objext conftest_ipa8_conftest.oo \ + conftest$ac_exeext conftest.$ac_ext +fi +ac_res=`eval echo '${'$as_ac_var'}'` + { echo "$as_me:$LINENO: result: $ac_res" >&5 +echo "${ECHO_T}$ac_res" >&6; } +if test `eval echo '${'$as_ac_var'}'` = yes; then + cat >>confdefs.h <<_ACEOF +#define `echo "HAVE_$ac_func" | $as_tr_cpp` 1 +_ACEOF + +fi +done + +fi + +{ echo "$as_me:$LINENO: checking for long long int" >&5 +echo $ECHO_N "checking for long long int... $ECHO_C" >&6; } +if test "${ac_cv_c_long_long+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + if test "$GCC" = yes; then + ac_cv_c_long_long=yes + else + cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ + +int +main () +{ +long long int i; + ; + return 0; +} +_ACEOF +rm -f conftest.$ac_objext +if { (ac_try="$ac_compile" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_compile") 2>conftest.er1 + ac_status=$? + grep -v '^ *+' conftest.er1 >conftest.err + rm -f conftest.er1 + cat conftest.err >&5 + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } && { + test -z "$ac_c_werror_flag" || + test ! -s conftest.err + } && test -s conftest.$ac_objext; then + ac_cv_c_long_long=yes +else + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + + ac_cv_c_long_long=no +fi + +rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext + fi +fi +{ echo "$as_me:$LINENO: result: $ac_cv_c_long_long" >&5 +echo "${ECHO_T}$ac_cv_c_long_long" >&6; } + +if test $ac_cv_c_long_long = yes; then + cat >>confdefs.h <<\_ACEOF +#define HAVE_LONG_LONG 1 +_ACEOF + +fi + +# Check whether --enable-threads was given. +if test "${enable_threads+set}" = set; then + enableval=$enable_threads; +fi + + +have_pthread=no +PTHREAD_FLAGS="" +PTHREAD_LIBS="" + +if test "x$enable_threads" != xno; then + ac_ext=c +ac_cpp='$CPP $CPPFLAGS' +ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' +ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' +ac_compiler_gnu=$ac_cv_c_compiler_gnu +{ echo "$as_me:$LINENO: checking how to run the C preprocessor" >&5 +echo $ECHO_N "checking how to run the C preprocessor... $ECHO_C" >&6; } +# On Suns, sometimes $CPP names a directory. +if test -n "$CPP" && test -d "$CPP"; then + CPP= +fi +if test -z "$CPP"; then + if test "${ac_cv_prog_CPP+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + # Double quotes because CPP needs to be expanded + for CPP in "$CC -E" "$CC -E -traditional-cpp" "/lib/cpp" + do + ac_preproc_ok=false +for ac_c_preproc_warn_flag in '' yes +do + # Use a header file that comes with gcc, so configuring glibc + # with a fresh cross-compiler works. + # Prefer to if __STDC__ is defined, since + # exists even on freestanding compilers. + # On the NeXT, cc -E runs the code through the compiler's parser, + # not just through cpp. "Syntax error" is here to catch this case. + cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ +#ifdef __STDC__ +# include +#else +# include +#endif + Syntax error +_ACEOF +if { (ac_try="$ac_cpp conftest.$ac_ext" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_cpp conftest.$ac_ext") 2>conftest.er1 + ac_status=$? + grep -v '^ *+' conftest.er1 >conftest.err + rm -f conftest.er1 + cat conftest.err >&5 + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } >/dev/null && { + test -z "$ac_c_preproc_warn_flag$ac_c_werror_flag" || + test ! -s conftest.err + }; then + : +else + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + + # Broken: fails on valid input. +continue +fi + +rm -f conftest.err conftest.$ac_ext + + # OK, works on sane cases. Now check whether nonexistent headers + # can be detected and how. + cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ +#include +_ACEOF +if { (ac_try="$ac_cpp conftest.$ac_ext" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_cpp conftest.$ac_ext") 2>conftest.er1 + ac_status=$? + grep -v '^ *+' conftest.er1 >conftest.err + rm -f conftest.er1 + cat conftest.err >&5 + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } >/dev/null && { + test -z "$ac_c_preproc_warn_flag$ac_c_werror_flag" || + test ! -s conftest.err + }; then + # Broken: success on invalid input. +continue +else + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + + # Passes both tests. +ac_preproc_ok=: +break +fi + +rm -f conftest.err conftest.$ac_ext + +done +# Because of `break', _AC_PREPROC_IFELSE's cleaning code was skipped. +rm -f conftest.err conftest.$ac_ext +if $ac_preproc_ok; then + break +fi + + done + ac_cv_prog_CPP=$CPP + +fi + CPP=$ac_cv_prog_CPP +else + ac_cv_prog_CPP=$CPP +fi +{ echo "$as_me:$LINENO: result: $CPP" >&5 +echo "${ECHO_T}$CPP" >&6; } +ac_preproc_ok=false +for ac_c_preproc_warn_flag in '' yes +do + # Use a header file that comes with gcc, so configuring glibc + # with a fresh cross-compiler works. + # Prefer to if __STDC__ is defined, since + # exists even on freestanding compilers. + # On the NeXT, cc -E runs the code through the compiler's parser, + # not just through cpp. "Syntax error" is here to catch this case. + cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ +#ifdef __STDC__ +# include +#else +# include +#endif + Syntax error +_ACEOF +if { (ac_try="$ac_cpp conftest.$ac_ext" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_cpp conftest.$ac_ext") 2>conftest.er1 + ac_status=$? + grep -v '^ *+' conftest.er1 >conftest.err + rm -f conftest.er1 + cat conftest.err >&5 + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } >/dev/null && { + test -z "$ac_c_preproc_warn_flag$ac_c_werror_flag" || + test ! -s conftest.err + }; then + : +else + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + + # Broken: fails on valid input. +continue +fi + +rm -f conftest.err conftest.$ac_ext + + # OK, works on sane cases. Now check whether nonexistent headers + # can be detected and how. + cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ +#include +_ACEOF +if { (ac_try="$ac_cpp conftest.$ac_ext" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_cpp conftest.$ac_ext") 2>conftest.er1 + ac_status=$? + grep -v '^ *+' conftest.er1 >conftest.err + rm -f conftest.er1 + cat conftest.err >&5 + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } >/dev/null && { + test -z "$ac_c_preproc_warn_flag$ac_c_werror_flag" || + test ! -s conftest.err + }; then + # Broken: success on invalid input. +continue +else + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + + # Passes both tests. +ac_preproc_ok=: +break +fi + +rm -f conftest.err conftest.$ac_ext + +done +# Because of `break', _AC_PREPROC_IFELSE's cleaning code was skipped. +rm -f conftest.err conftest.$ac_ext +if $ac_preproc_ok; then + : +else + { { echo "$as_me:$LINENO: error: C preprocessor \"$CPP\" fails sanity check +See \`config.log' for more details." >&5 +echo "$as_me: error: C preprocessor \"$CPP\" fails sanity check +See \`config.log' for more details." >&2;} + { (exit 1); exit 1; }; } +fi + +ac_ext=c +ac_cpp='$CPP $CPPFLAGS' +ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5' +ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5' +ac_compiler_gnu=$ac_cv_c_compiler_gnu + + +{ echo "$as_me:$LINENO: checking for grep that handles long lines and -e" >&5 +echo $ECHO_N "checking for grep that handles long lines and -e... $ECHO_C" >&6; } +if test "${ac_cv_path_GREP+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + # Extract the first word of "grep ggrep" to use in msg output +if test -z "$GREP"; then +set dummy grep ggrep; ac_prog_name=$2 +if test "${ac_cv_path_GREP+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + ac_path_GREP_found=false +# Loop through the user's path and test for each of PROGNAME-LIST +as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in $PATH$PATH_SEPARATOR/usr/xpg4/bin +do + IFS=$as_save_IFS + test -z "$as_dir" && as_dir=. + for ac_prog in grep ggrep; do + for ac_exec_ext in '' $ac_executable_extensions; do + ac_path_GREP="$as_dir/$ac_prog$ac_exec_ext" + { test -f "$ac_path_GREP" && $as_test_x "$ac_path_GREP"; } || continue + # Check for GNU ac_path_GREP and select it if it is found. + # Check for GNU $ac_path_GREP +case `"$ac_path_GREP" --version 2>&1` in +*GNU*) + ac_cv_path_GREP="$ac_path_GREP" ac_path_GREP_found=:;; +*) + ac_count=0 + echo $ECHO_N "0123456789$ECHO_C" >"conftest.in" + while : + do + cat "conftest.in" "conftest.in" >"conftest.tmp" + mv "conftest.tmp" "conftest.in" + cp "conftest.in" "conftest.nl" + echo 'GREP' >> "conftest.nl" + "$ac_path_GREP" -e 'GREP$' -e '-(cannot match)-' < "conftest.nl" >"conftest.out" 2>/dev/null || break + diff "conftest.out" "conftest.nl" >/dev/null 2>&1 || break + ac_count=`expr $ac_count + 1` + if test $ac_count -gt ${ac_path_GREP_max-0}; then + # Best one so far, save it but keep looking for a better one + ac_cv_path_GREP="$ac_path_GREP" + ac_path_GREP_max=$ac_count + fi + # 10*(2^10) chars as input seems more than enough + test $ac_count -gt 10 && break + done + rm -f conftest.in conftest.tmp conftest.nl conftest.out;; +esac + + + $ac_path_GREP_found && break 3 + done +done + +done +IFS=$as_save_IFS + + +fi + +GREP="$ac_cv_path_GREP" +if test -z "$GREP"; then + { { echo "$as_me:$LINENO: error: no acceptable $ac_prog_name could be found in $PATH$PATH_SEPARATOR/usr/xpg4/bin" >&5 +echo "$as_me: error: no acceptable $ac_prog_name could be found in $PATH$PATH_SEPARATOR/usr/xpg4/bin" >&2;} + { (exit 1); exit 1; }; } +fi + +else + ac_cv_path_GREP=$GREP +fi + + +fi +{ echo "$as_me:$LINENO: result: $ac_cv_path_GREP" >&5 +echo "${ECHO_T}$ac_cv_path_GREP" >&6; } + GREP="$ac_cv_path_GREP" + + +{ echo "$as_me:$LINENO: checking for egrep" >&5 +echo $ECHO_N "checking for egrep... $ECHO_C" >&6; } +if test "${ac_cv_path_EGREP+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + if echo a | $GREP -E '(a|b)' >/dev/null 2>&1 + then ac_cv_path_EGREP="$GREP -E" + else + # Extract the first word of "egrep" to use in msg output +if test -z "$EGREP"; then +set dummy egrep; ac_prog_name=$2 +if test "${ac_cv_path_EGREP+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + ac_path_EGREP_found=false +# Loop through the user's path and test for each of PROGNAME-LIST +as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in $PATH$PATH_SEPARATOR/usr/xpg4/bin +do + IFS=$as_save_IFS + test -z "$as_dir" && as_dir=. + for ac_prog in egrep; do + for ac_exec_ext in '' $ac_executable_extensions; do + ac_path_EGREP="$as_dir/$ac_prog$ac_exec_ext" + { test -f "$ac_path_EGREP" && $as_test_x "$ac_path_EGREP"; } || continue + # Check for GNU ac_path_EGREP and select it if it is found. + # Check for GNU $ac_path_EGREP +case `"$ac_path_EGREP" --version 2>&1` in +*GNU*) + ac_cv_path_EGREP="$ac_path_EGREP" ac_path_EGREP_found=:;; +*) + ac_count=0 + echo $ECHO_N "0123456789$ECHO_C" >"conftest.in" + while : + do + cat "conftest.in" "conftest.in" >"conftest.tmp" + mv "conftest.tmp" "conftest.in" + cp "conftest.in" "conftest.nl" + echo 'EGREP' >> "conftest.nl" + "$ac_path_EGREP" 'EGREP$' < "conftest.nl" >"conftest.out" 2>/dev/null || break + diff "conftest.out" "conftest.nl" >/dev/null 2>&1 || break + ac_count=`expr $ac_count + 1` + if test $ac_count -gt ${ac_path_EGREP_max-0}; then + # Best one so far, save it but keep looking for a better one + ac_cv_path_EGREP="$ac_path_EGREP" + ac_path_EGREP_max=$ac_count + fi + # 10*(2^10) chars as input seems more than enough + test $ac_count -gt 10 && break + done + rm -f conftest.in conftest.tmp conftest.nl conftest.out;; +esac + + + $ac_path_EGREP_found && break 3 + done +done + +done +IFS=$as_save_IFS + + +fi + +EGREP="$ac_cv_path_EGREP" +if test -z "$EGREP"; then + { { echo "$as_me:$LINENO: error: no acceptable $ac_prog_name could be found in $PATH$PATH_SEPARATOR/usr/xpg4/bin" >&5 +echo "$as_me: error: no acceptable $ac_prog_name could be found in $PATH$PATH_SEPARATOR/usr/xpg4/bin" >&2;} + { (exit 1); exit 1; }; } +fi + +else + ac_cv_path_EGREP=$EGREP +fi + + + fi +fi +{ echo "$as_me:$LINENO: result: $ac_cv_path_EGREP" >&5 +echo "${ECHO_T}$ac_cv_path_EGREP" >&6; } + EGREP="$ac_cv_path_EGREP" + + +{ echo "$as_me:$LINENO: checking for ANSI C header files" >&5 +echo $ECHO_N "checking for ANSI C header files... $ECHO_C" >&6; } +if test "${ac_cv_header_stdc+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ +#include +#include +#include +#include + +int +main () +{ + + ; + return 0; +} +_ACEOF +rm -f conftest.$ac_objext +if { (ac_try="$ac_compile" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_compile") 2>conftest.er1 + ac_status=$? + grep -v '^ *+' conftest.er1 >conftest.err + rm -f conftest.er1 + cat conftest.err >&5 + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } && { + test -z "$ac_c_werror_flag" || + test ! -s conftest.err + } && test -s conftest.$ac_objext; then + ac_cv_header_stdc=yes +else + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + + ac_cv_header_stdc=no +fi + +rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext + +if test $ac_cv_header_stdc = yes; then + # SunOS 4.x string.h does not declare mem*, contrary to ANSI. + cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ +#include + +_ACEOF +if (eval "$ac_cpp conftest.$ac_ext") 2>&5 | + $EGREP "memchr" >/dev/null 2>&1; then + : +else + ac_cv_header_stdc=no +fi +rm -f conftest* + +fi + +if test $ac_cv_header_stdc = yes; then + # ISC 2.0.2 stdlib.h does not declare free, contrary to ANSI. + cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ +#include + +_ACEOF +if (eval "$ac_cpp conftest.$ac_ext") 2>&5 | + $EGREP "free" >/dev/null 2>&1; then + : +else + ac_cv_header_stdc=no +fi +rm -f conftest* + +fi + +if test $ac_cv_header_stdc = yes; then + # /bin/cc in Irix-4.0.5 gets non-ANSI ctype macros unless using -ansi. + if test "$cross_compiling" = yes; then + : +else + cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ +#include +#include +#if ((' ' & 0x0FF) == 0x020) +# define ISLOWER(c) ('a' <= (c) && (c) <= 'z') +# define TOUPPER(c) (ISLOWER(c) ? 'A' + ((c) - 'a') : (c)) +#else +# define ISLOWER(c) \ + (('a' <= (c) && (c) <= 'i') \ + || ('j' <= (c) && (c) <= 'r') \ + || ('s' <= (c) && (c) <= 'z')) +# define TOUPPER(c) (ISLOWER(c) ? ((c) | 0x40) : (c)) +#endif + +#define XOR(e, f) (((e) && !(f)) || (!(e) && (f))) +int +main () +{ + int i; + for (i = 0; i < 256; i++) + if (XOR (islower (i), ISLOWER (i)) + || toupper (i) != TOUPPER (i)) + return 2; + return 0; +} +_ACEOF +rm -f conftest$ac_exeext +if { (ac_try="$ac_link" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_link") 2>&5 + ac_status=$? + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } && { ac_try='./conftest$ac_exeext' + { (case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_try") 2>&5 + ac_status=$? + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); }; }; then + : +else + echo "$as_me: program exited with status $ac_status" >&5 +echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + +( exit $ac_status ) +ac_cv_header_stdc=no +fi +rm -f core *.core core.conftest.* gmon.out bb.out conftest$ac_exeext conftest.$ac_objext conftest.$ac_ext +fi + + +fi +fi +{ echo "$as_me:$LINENO: result: $ac_cv_header_stdc" >&5 +echo "${ECHO_T}$ac_cv_header_stdc" >&6; } +if test $ac_cv_header_stdc = yes; then + +cat >>confdefs.h <<\_ACEOF +#define STDC_HEADERS 1 +_ACEOF + +fi + +# On IRIX 5.3, sys/types and inttypes.h are conflicting. + + + + + + + + + +for ac_header in sys/types.h sys/stat.h stdlib.h string.h memory.h strings.h \ + inttypes.h stdint.h unistd.h +do +as_ac_Header=`echo "ac_cv_header_$ac_header" | $as_tr_sh` +{ echo "$as_me:$LINENO: checking for $ac_header" >&5 +echo $ECHO_N "checking for $ac_header... $ECHO_C" >&6; } +if { as_var=$as_ac_Header; eval "test \"\${$as_var+set}\" = set"; }; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ +$ac_includes_default + +#include <$ac_header> +_ACEOF +rm -f conftest.$ac_objext +if { (ac_try="$ac_compile" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_compile") 2>conftest.er1 + ac_status=$? + grep -v '^ *+' conftest.er1 >conftest.err + rm -f conftest.er1 + cat conftest.err >&5 + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } && { + test -z "$ac_c_werror_flag" || + test ! -s conftest.err + } && test -s conftest.$ac_objext; then + eval "$as_ac_Header=yes" +else + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + + eval "$as_ac_Header=no" +fi + +rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext +fi +ac_res=`eval echo '${'$as_ac_Header'}'` + { echo "$as_me:$LINENO: result: $ac_res" >&5 +echo "${ECHO_T}$ac_res" >&6; } +if test `eval echo '${'$as_ac_Header'}'` = yes; then + cat >>confdefs.h <<_ACEOF +#define `echo "HAVE_$ac_header" | $as_tr_cpp` 1 +_ACEOF + +fi + +done + + +if test "${ac_cv_header_pthread_h+set}" = set; then + { echo "$as_me:$LINENO: checking for pthread.h" >&5 +echo $ECHO_N "checking for pthread.h... $ECHO_C" >&6; } +if test "${ac_cv_header_pthread_h+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +fi +{ echo "$as_me:$LINENO: result: $ac_cv_header_pthread_h" >&5 +echo "${ECHO_T}$ac_cv_header_pthread_h" >&6; } +else + # Is the header compilable? +{ echo "$as_me:$LINENO: checking pthread.h usability" >&5 +echo $ECHO_N "checking pthread.h usability... $ECHO_C" >&6; } +cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ +$ac_includes_default +#include +_ACEOF +rm -f conftest.$ac_objext +if { (ac_try="$ac_compile" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_compile") 2>conftest.er1 + ac_status=$? + grep -v '^ *+' conftest.er1 >conftest.err + rm -f conftest.er1 + cat conftest.err >&5 + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } && { + test -z "$ac_c_werror_flag" || + test ! -s conftest.err + } && test -s conftest.$ac_objext; then + ac_header_compiler=yes +else + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + + ac_header_compiler=no +fi + +rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext +{ echo "$as_me:$LINENO: result: $ac_header_compiler" >&5 +echo "${ECHO_T}$ac_header_compiler" >&6; } + +# Is the header present? +{ echo "$as_me:$LINENO: checking pthread.h presence" >&5 +echo $ECHO_N "checking pthread.h presence... $ECHO_C" >&6; } +cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ +#include +_ACEOF +if { (ac_try="$ac_cpp conftest.$ac_ext" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_cpp conftest.$ac_ext") 2>conftest.er1 + ac_status=$? + grep -v '^ *+' conftest.er1 >conftest.err + rm -f conftest.er1 + cat conftest.err >&5 + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } >/dev/null && { + test -z "$ac_c_preproc_warn_flag$ac_c_werror_flag" || + test ! -s conftest.err + }; then + ac_header_preproc=yes +else + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + + ac_header_preproc=no +fi + +rm -f conftest.err conftest.$ac_ext +{ echo "$as_me:$LINENO: result: $ac_header_preproc" >&5 +echo "${ECHO_T}$ac_header_preproc" >&6; } + +# So? What about this header? +case $ac_header_compiler:$ac_header_preproc:$ac_c_preproc_warn_flag in + yes:no: ) + { echo "$as_me:$LINENO: WARNING: pthread.h: accepted by the compiler, rejected by the preprocessor!" >&5 +echo "$as_me: WARNING: pthread.h: accepted by the compiler, rejected by the preprocessor!" >&2;} + { echo "$as_me:$LINENO: WARNING: pthread.h: proceeding with the compiler's result" >&5 +echo "$as_me: WARNING: pthread.h: proceeding with the compiler's result" >&2;} + ac_header_preproc=yes + ;; + no:yes:* ) + { echo "$as_me:$LINENO: WARNING: pthread.h: present but cannot be compiled" >&5 +echo "$as_me: WARNING: pthread.h: present but cannot be compiled" >&2;} + { echo "$as_me:$LINENO: WARNING: pthread.h: check for missing prerequisite headers?" >&5 +echo "$as_me: WARNING: pthread.h: check for missing prerequisite headers?" >&2;} + { echo "$as_me:$LINENO: WARNING: pthread.h: see the Autoconf documentation" >&5 +echo "$as_me: WARNING: pthread.h: see the Autoconf documentation" >&2;} + { echo "$as_me:$LINENO: WARNING: pthread.h: section \"Present But Cannot Be Compiled\"" >&5 +echo "$as_me: WARNING: pthread.h: section \"Present But Cannot Be Compiled\"" >&2;} + { echo "$as_me:$LINENO: WARNING: pthread.h: proceeding with the preprocessor's result" >&5 +echo "$as_me: WARNING: pthread.h: proceeding with the preprocessor's result" >&2;} + { echo "$as_me:$LINENO: WARNING: pthread.h: in the future, the compiler will take precedence" >&5 +echo "$as_me: WARNING: pthread.h: in the future, the compiler will take precedence" >&2;} + + ;; +esac +{ echo "$as_me:$LINENO: checking for pthread.h" >&5 +echo $ECHO_N "checking for pthread.h... $ECHO_C" >&6; } +if test "${ac_cv_header_pthread_h+set}" = set; then + echo $ECHO_N "(cached) $ECHO_C" >&6 +else + ac_cv_header_pthread_h=$ac_header_preproc +fi +{ echo "$as_me:$LINENO: result: $ac_cv_header_pthread_h" >&5 +echo "${ECHO_T}$ac_cv_header_pthread_h" >&6; } + +fi +if test $ac_cv_header_pthread_h = yes; then + cat >>confdefs.h <<\_ACEOF +#define HAVE_PTHREAD_H 1 +_ACEOF + +fi + + + + if test x$ac_cv_header_pthread_h = xyes; then + for flag in -lpthreads -lpthread -pthread; do + { echo "$as_me:$LINENO: checking for pthread_create using $flag" >&5 +echo $ECHO_N "checking for pthread_create using $flag... $ECHO_C" >&6; } + SAVELIBS="$LIBS" + LIBS="$flag $LIBS" + cat >conftest.$ac_ext <<_ACEOF +/* confdefs.h. */ +_ACEOF +cat confdefs.h >>conftest.$ac_ext +cat >>conftest.$ac_ext <<_ACEOF +/* end confdefs.h. */ +#include +int +main () +{ +pthread_create(0, 0, 0, 0); + ; + return 0; +} +_ACEOF +rm -f conftest.$ac_objext conftest$ac_exeext +if { (ac_try="$ac_link" +case "(($ac_try" in + *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;; + *) ac_try_echo=$ac_try;; +esac +eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5 + (eval "$ac_link") 2>conftest.er1 + ac_status=$? + grep -v '^ *+' conftest.er1 >conftest.err + rm -f conftest.er1 + cat conftest.err >&5 + echo "$as_me:$LINENO: \$? = $ac_status" >&5 + (exit $ac_status); } && { + test -z "$ac_c_werror_flag" || + test ! -s conftest.err + } && test -s conftest$ac_exeext && + $as_test_x conftest$ac_exeext; then + have_pthread=yes +else + echo "$as_me: failed program was:" >&5 +sed 's/^/| /' conftest.$ac_ext >&5 + + +fi + +rm -f core conftest.err conftest.$ac_objext conftest_ipa8_conftest.oo \ + conftest$ac_exeext conftest.$ac_ext + { echo "$as_me:$LINENO: result: $have_pthread" >&5 +echo "${ECHO_T}$have_pthread" >&6; } + LIBS="$SAVELIBS" + + if test $have_pthread = yes; then + PTHREAD_FLAGS="-D_THREAD_SAFE -D_REENTRANT" + PTHREAD_LIBS="$flag" + + # Solaris requires -D_POSIX_PTHREAD_SEMANTICS to + # be POSIX-compliant... :( + if test $uname = SunOS; then + PTHREAD_FLAGS="$PTHREAD_FLAGS -D_POSIX_PTHREAD_SEMANTICS" + fi + break + fi + done + fi +fi + + + + +DSO="${DSO:=:}" +DSOFLAGS="${DSOFLAGS:=}" + +# Check whether --enable-shared was given. +if test "${enable_shared+set}" = set; then + enableval=$enable_shared; +fi + + +if test x$enable_shared = xyes; then + { echo "$as_me:$LINENO: checking for shared library support" >&5 +echo $ECHO_N "checking for shared library support... $ECHO_C" >&6; } + PICFLAG=1 + + case "$uname" in + SunOS* | UNIX_S*) + { echo "$as_me:$LINENO: result: yes" >&5 +echo "${ECHO_T}yes" >&6; } + LIBMXML="libmxml.so.1.4" + DSO="\$(CC)" + DSOFLAGS="$DSOFLAGS -Wl,-h,libmxml.so.1 -G -R\$(libdir) \$(OPTIM)" + LDFLAGS="$LDFLAGS -R\$(libdir)" + ;; + + HP-UX*) + { echo "$as_me:$LINENO: result: yes" >&5 +echo "${ECHO_T}yes" >&6; } + LIBMXML="libmxml.sl.1" + DSO="ld" + DSOFLAGS="$DSOFLAGS -b -z +h libmxml.sl.1 +s +b \$(libdir)" + LDFLAGS="$LDFLAGS -Wl,+s,+b,\$(libdir)" + ;; + + IRIX) + { echo "$as_me:$LINENO: result: yes" >&5 +echo "${ECHO_T}yes" >&6; } + LIBMXML="libmxml.so.1.4" + DSO="\$(CC)" + DSOFLAGS="$DSOFLAGS -Wl,-rpath,\$(libdir),-set_version,sgi1.0,-soname,libmxml.so.1 -shared \$(OPTIM)" + ;; + + OSF1* | Linux | GNU) + { echo "$as_me:$LINENO: result: yes" >&5 +echo "${ECHO_T}yes" >&6; } + LIBMXML="libmxml.so.1.4" + DSO="\$(CC)" + DSOFLAGS="$DSOFLAGS -Wl,-soname,libmxml.so.1,-rpath,\$(libdir) -shared \$(OPTIM)" + LDFLAGS="$LDFLAGS -Wl,-rpath,\$(libdir)" + ;; + + *BSD*) + { echo "$as_me:$LINENO: result: yes" >&5 +echo "${ECHO_T}yes" >&6; } + LIBMXML="libmxml.so.1.4" + DSO="\$(CC)" + DSOFLAGS="$DSOFLAGS -Wl,-soname,libmxml.so.1,-R\$(libdir) -shared \$(OPTIM)" + LDFLAGS="$LDFLAGS -Wl,-R\$(libdir)" + ;; + + Darwin*) + { echo "$as_me:$LINENO: result: yes" >&5 +echo "${ECHO_T}yes" >&6; } + LIBMXML="libmxml.1.dylib" + DSO="\$(CC)" + DSOFLAGS="$DSOFLAGS \$(RC_CFLAGS) -dynamiclib -lc" + ;; + + *) + { echo "$as_me:$LINENO: result: no" >&5 +echo "${ECHO_T}no" >&6; } + { echo "$as_me:$LINENO: WARNING: shared libraries not supported on this platform." >&5 +echo "$as_me: WARNING: shared libraries not supported on this platform." >&2;} + PICFLAG=0 + LIBMXML="libmxml.a" + ;; + esac +else + PICFLAG=0 + LIBMXML="libmxml.a" +fi + + + + + + +if test -n "$GCC"; then + CFLAGS="-Wall $CFLAGS" + + if test "x$OPTIM" = x; then + OPTIM="-Os -g" + fi + + if test "x$use_ansi" = xyes; then + CFLAGS="-ansi -pedantic $CFLAGS" + fi + + if test $PICFLAG = 1 -a $uname != AIX; then + OPTIM="-fPIC $OPTIM" + fi +else + case $uname in + HP-UX*) + CFLAGS="-Ae $CFLAGS" + + if test "x$OPTIM" = x; then + OPTIM="-O" + fi + + OPTIM="+DAportable $OPTIM" + + if test $PICFLAG = 1; then + OPTIM="+z $OPTIM" + fi + ;; + + UNIX_SVR* | SunOS*) + if test "x$OPTIM" = x; then + OPTIM="-O" + fi + + if test $PICFLAG = 1; then + OPTIM="-KPIC $OPTIM" + fi + ;; + + *) + if test "x$OPTIM" = x; then + OPTIM="-O" + fi + ;; + esac +fi + +if test "$prefix" = "NONE"; then + prefix="/usr/local" +fi + +if test "$exec_prefix" = "NONE"; then + exec_prefix="$prefix" +fi + +if test "$docdir" = "NONE"; then + docdir="$datadir/doc/mxml" +fi + +if test "$mandir" = "\${prefix}/man" -a "$prefix" = "/usr"; then + case "$uname" in + *BSD* | Darwin* | Linux*) + # BSD, Darwin (MacOS X), and Linux + mandir="/usr/share/man" + ;; + IRIX*) + # SGI IRIX + mandir="/usr/share/catman/u_man" + ;; + *) + # All others + mandir="/usr/man" + ;; + esac +fi + +if test "$includedir" != /usr/include; then + PC_CFLAGS="-I$includedir" +else + PC_CFLAGS="" +fi + +if test "$libdir" != /usr/lib; then + PC_LIBS="-L$libdir -lmxml" +else + PC_LIBS="-lmxml" +fi + + + + +ac_config_files="$ac_config_files Makefile mxml.list mxml.pc" + +cat >confcache <<\_ACEOF +# This file is a shell script that caches the results of configure +# tests run on this system so they can be shared between configure +# scripts and configure runs, see configure's option --config-cache. +# It is not useful on other systems. If it contains results you don't +# want to keep, you may remove or edit it. +# +# config.status only pays attention to the cache file if you give it +# the --recheck option to rerun configure. +# +# `ac_cv_env_foo' variables (set or unset) will be overridden when +# loading this file, other *unset* `ac_cv_foo' will be assigned the +# following values. + +_ACEOF + +# The following way of writing the cache mishandles newlines in values, +# but we know of no workaround that is simple, portable, and efficient. +# So, we kill variables containing newlines. +# Ultrix sh set writes to stderr and can't be redirected directly, +# and sets the high bit in the cache file unless we assign to the vars. +( + for ac_var in `(set) 2>&1 | sed -n 's/^\([a-zA-Z_][a-zA-Z0-9_]*\)=.*/\1/p'`; do + eval ac_val=\$$ac_var + case $ac_val in #( + *${as_nl}*) + case $ac_var in #( + *_cv_*) { echo "$as_me:$LINENO: WARNING: Cache variable $ac_var contains a newline." >&5 +echo "$as_me: WARNING: Cache variable $ac_var contains a newline." >&2;} ;; + esac + case $ac_var in #( + _ | IFS | as_nl) ;; #( + *) $as_unset $ac_var ;; + esac ;; + esac + done + + (set) 2>&1 | + case $as_nl`(ac_space=' '; set) 2>&1` in #( + *${as_nl}ac_space=\ *) + # `set' does not quote correctly, so add quotes (double-quote + # substitution turns \\\\ into \\, and sed turns \\ into \). + sed -n \ + "s/'/'\\\\''/g; + s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1='\\2'/p" + ;; #( + *) + # `set' quotes correctly as required by POSIX, so do not add quotes. + sed -n "/^[_$as_cr_alnum]*_cv_[_$as_cr_alnum]*=/p" + ;; + esac | + sort +) | + sed ' + /^ac_cv_env_/b end + t clear + :clear + s/^\([^=]*\)=\(.*[{}].*\)$/test "${\1+set}" = set || &/ + t end + s/^\([^=]*\)=\(.*\)$/\1=${\1=\2}/ + :end' >>confcache +if diff "$cache_file" confcache >/dev/null 2>&1; then :; else + if test -w "$cache_file"; then + test "x$cache_file" != "x/dev/null" && + { echo "$as_me:$LINENO: updating cache $cache_file" >&5 +echo "$as_me: updating cache $cache_file" >&6;} + cat confcache >$cache_file + else + { echo "$as_me:$LINENO: not updating unwritable cache $cache_file" >&5 +echo "$as_me: not updating unwritable cache $cache_file" >&6;} + fi +fi +rm -f confcache + +test "x$prefix" = xNONE && prefix=$ac_default_prefix +# Let make expand exec_prefix. +test "x$exec_prefix" = xNONE && exec_prefix='${prefix}' + +DEFS=-DHAVE_CONFIG_H + +ac_libobjs= +ac_ltlibobjs= +for ac_i in : $LIBOBJS; do test "x$ac_i" = x: && continue + # 1. Remove the extension, and $U if already installed. + ac_script='s/\$U\././;s/\.o$//;s/\.obj$//' + ac_i=`echo "$ac_i" | sed "$ac_script"` + # 2. Prepend LIBOBJDIR. When used with automake>=1.10 LIBOBJDIR + # will be set to the directory where LIBOBJS objects are built. + ac_libobjs="$ac_libobjs \${LIBOBJDIR}$ac_i\$U.$ac_objext" + ac_ltlibobjs="$ac_ltlibobjs \${LIBOBJDIR}$ac_i"'$U.lo' +done +LIBOBJS=$ac_libobjs + +LTLIBOBJS=$ac_ltlibobjs + + + +: ${CONFIG_STATUS=./config.status} +ac_clean_files_save=$ac_clean_files +ac_clean_files="$ac_clean_files $CONFIG_STATUS" +{ echo "$as_me:$LINENO: creating $CONFIG_STATUS" >&5 +echo "$as_me: creating $CONFIG_STATUS" >&6;} +cat >$CONFIG_STATUS <<_ACEOF +#! $SHELL +# Generated by $as_me. +# Run this file to recreate the current configuration. +# Compiler output produced by configure, useful for debugging +# configure, is in config.log if it exists. + +debug=false +ac_cs_recheck=false +ac_cs_silent=false +SHELL=\${CONFIG_SHELL-$SHELL} +_ACEOF + +cat >>$CONFIG_STATUS <<\_ACEOF +## --------------------- ## +## M4sh Initialization. ## +## --------------------- ## + +# Be more Bourne compatible +DUALCASE=1; export DUALCASE # for MKS sh +if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then + emulate sh + NULLCMD=: + # Zsh 3.x and 4.x performs word splitting on ${1+"$@"}, which + # is contrary to our usage. Disable this feature. + alias -g '${1+"$@"}'='"$@"' + setopt NO_GLOB_SUBST +else + case `(set -o) 2>/dev/null` in + *posix*) set -o posix ;; +esac + +fi + + + + +# PATH needs CR +# Avoid depending upon Character Ranges. +as_cr_letters='abcdefghijklmnopqrstuvwxyz' +as_cr_LETTERS='ABCDEFGHIJKLMNOPQRSTUVWXYZ' +as_cr_Letters=$as_cr_letters$as_cr_LETTERS +as_cr_digits='0123456789' +as_cr_alnum=$as_cr_Letters$as_cr_digits + +# The user is always right. +if test "${PATH_SEPARATOR+set}" != set; then + echo "#! /bin/sh" >conf$$.sh + echo "exit 0" >>conf$$.sh + chmod +x conf$$.sh + if (PATH="/nonexistent;."; conf$$.sh) >/dev/null 2>&1; then + PATH_SEPARATOR=';' + else + PATH_SEPARATOR=: + fi + rm -f conf$$.sh +fi + +# Support unset when possible. +if ( (MAIL=60; unset MAIL) || exit) >/dev/null 2>&1; then + as_unset=unset +else + as_unset=false +fi + + +# IFS +# We need space, tab and new line, in precisely that order. Quoting is +# there to prevent editors from complaining about space-tab. +# (If _AS_PATH_WALK were called with IFS unset, it would disable word +# splitting by setting IFS to empty value.) +as_nl=' +' +IFS=" "" $as_nl" + +# Find who we are. Look in the path if we contain no directory separator. +case $0 in + *[\\/]* ) as_myself=$0 ;; + *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR +for as_dir in $PATH +do + IFS=$as_save_IFS + test -z "$as_dir" && as_dir=. + test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break +done +IFS=$as_save_IFS + + ;; +esac +# We did not find ourselves, most probably we were run as `sh COMMAND' +# in which case we are not to be found in the path. +if test "x$as_myself" = x; then + as_myself=$0 +fi +if test ! -f "$as_myself"; then + echo "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2 + { (exit 1); exit 1; } +fi + +# Work around bugs in pre-3.0 UWIN ksh. +for as_var in ENV MAIL MAILPATH +do ($as_unset $as_var) >/dev/null 2>&1 && $as_unset $as_var +done +PS1='$ ' +PS2='> ' +PS4='+ ' + +# NLS nuisances. +for as_var in \ + LANG LANGUAGE LC_ADDRESS LC_ALL LC_COLLATE LC_CTYPE LC_IDENTIFICATION \ + LC_MEASUREMENT LC_MESSAGES LC_MONETARY LC_NAME LC_NUMERIC LC_PAPER \ + LC_TELEPHONE LC_TIME +do + if (set +x; test -z "`(eval $as_var=C; export $as_var) 2>&1`"); then + eval $as_var=C; export $as_var + else + ($as_unset $as_var) >/dev/null 2>&1 && $as_unset $as_var + fi +done + +# Required to use basename. +if expr a : '\(a\)' >/dev/null 2>&1 && + test "X`expr 00001 : '.*\(...\)'`" = X001; then + as_expr=expr +else + as_expr=false +fi + +if (basename -- /) >/dev/null 2>&1 && test "X`basename -- / 2>&1`" = "X/"; then + as_basename=basename +else + as_basename=false +fi + + +# Name of the executable. +as_me=`$as_basename -- "$0" || +$as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \ + X"$0" : 'X\(//\)$' \| \ + X"$0" : 'X\(/\)' \| . 2>/dev/null || +echo X/"$0" | + sed '/^.*\/\([^/][^/]*\)\/*$/{ + s//\1/ + q + } + /^X\/\(\/\/\)$/{ + s//\1/ + q + } + /^X\/\(\/\).*/{ + s//\1/ + q + } + s/.*/./; q'` + +# CDPATH. +$as_unset CDPATH + + + + as_lineno_1=$LINENO + as_lineno_2=$LINENO + test "x$as_lineno_1" != "x$as_lineno_2" && + test "x`expr $as_lineno_1 + 1`" = "x$as_lineno_2" || { + + # Create $as_me.lineno as a copy of $as_myself, but with $LINENO + # uniformly replaced by the line number. The first 'sed' inserts a + # line-number line after each line using $LINENO; the second 'sed' + # does the real work. The second script uses 'N' to pair each + # line-number line with the line containing $LINENO, and appends + # trailing '-' during substitution so that $LINENO is not a special + # case at line end. + # (Raja R Harinath suggested sed '=', and Paul Eggert wrote the + # scripts with optimization help from Paolo Bonzini. Blame Lee + # E. McMahon (1931-1989) for sed's syntax. :-) + sed -n ' + p + /[$]LINENO/= + ' <$as_myself | + sed ' + s/[$]LINENO.*/&-/ + t lineno + b + :lineno + N + :loop + s/[$]LINENO\([^'$as_cr_alnum'_].*\n\)\(.*\)/\2\1\2/ + t loop + s/-\n.*// + ' >$as_me.lineno && + chmod +x "$as_me.lineno" || + { echo "$as_me: error: cannot create $as_me.lineno; rerun with a POSIX shell" >&2 + { (exit 1); exit 1; }; } + + # Don't try to exec as it changes $[0], causing all sort of problems + # (the dirname of $[0] is not the place where we might find the + # original and so on. Autoconf is especially sensitive to this). + . "./$as_me.lineno" + # Exit status is that of the last command. + exit +} + + +if (as_dir=`dirname -- /` && test "X$as_dir" = X/) >/dev/null 2>&1; then + as_dirname=dirname +else + as_dirname=false +fi + +ECHO_C= ECHO_N= ECHO_T= +case `echo -n x` in +-n*) + case `echo 'x\c'` in + *c*) ECHO_T=' ';; # ECHO_T is single tab character. + *) ECHO_C='\c';; + esac;; +*) + ECHO_N='-n';; +esac + +if expr a : '\(a\)' >/dev/null 2>&1 && + test "X`expr 00001 : '.*\(...\)'`" = X001; then + as_expr=expr +else + as_expr=false +fi + +rm -f conf$$ conf$$.exe conf$$.file +if test -d conf$$.dir; then + rm -f conf$$.dir/conf$$.file +else + rm -f conf$$.dir + mkdir conf$$.dir +fi +echo >conf$$.file +if ln -s conf$$.file conf$$ 2>/dev/null; then + as_ln_s='ln -s' + # ... but there are two gotchas: + # 1) On MSYS, both `ln -s file dir' and `ln file dir' fail. + # 2) DJGPP < 2.04 has no symlinks; `ln -s' creates a wrapper executable. + # In both cases, we have to default to `cp -p'. + ln -s conf$$.file conf$$.dir 2>/dev/null && test ! -f conf$$.exe || + as_ln_s='cp -p' +elif ln conf$$.file conf$$ 2>/dev/null; then + as_ln_s=ln +else + as_ln_s='cp -p' +fi +rm -f conf$$ conf$$.exe conf$$.dir/conf$$.file conf$$.file +rmdir conf$$.dir 2>/dev/null + +if mkdir -p . 2>/dev/null; then + as_mkdir_p=: +else + test -d ./-p && rmdir ./-p + as_mkdir_p=false +fi + +if test -x / >/dev/null 2>&1; then + as_test_x='test -x' +else + if ls -dL / >/dev/null 2>&1; then + as_ls_L_option=L + else + as_ls_L_option= + fi + as_test_x=' + eval sh -c '\'' + if test -d "$1"; then + test -d "$1/."; + else + case $1 in + -*)set "./$1";; + esac; + case `ls -ld'$as_ls_L_option' "$1" 2>/dev/null` in + ???[sx]*):;;*)false;;esac;fi + '\'' sh + ' +fi +as_executable_p=$as_test_x + +# Sed expression to map a string onto a valid CPP name. +as_tr_cpp="eval sed 'y%*$as_cr_letters%P$as_cr_LETTERS%;s%[^_$as_cr_alnum]%_%g'" + +# Sed expression to map a string onto a valid variable name. +as_tr_sh="eval sed 'y%*+%pp%;s%[^_$as_cr_alnum]%_%g'" + + +exec 6>&1 + +# Save the log message, to keep $[0] and so on meaningful, and to +# report actual input values of CONFIG_FILES etc. instead of their +# values after options handling. +ac_log=" +This file was extended by $as_me, which was +generated by GNU Autoconf 2.61. Invocation command line was + + CONFIG_FILES = $CONFIG_FILES + CONFIG_HEADERS = $CONFIG_HEADERS + CONFIG_LINKS = $CONFIG_LINKS + CONFIG_COMMANDS = $CONFIG_COMMANDS + $ $0 $@ + +on `(hostname || uname -n) 2>/dev/null | sed 1q` +" + +_ACEOF + +cat >>$CONFIG_STATUS <<_ACEOF +# Files that config.status was made for. +config_files="$ac_config_files" +config_headers="$ac_config_headers" + +_ACEOF + +cat >>$CONFIG_STATUS <<\_ACEOF +ac_cs_usage="\ +\`$as_me' instantiates files from templates according to the +current configuration. + +Usage: $0 [OPTIONS] [FILE]... + + -h, --help print this help, then exit + -V, --version print version number and configuration settings, then exit + -q, --quiet do not print progress messages + -d, --debug don't remove temporary files + --recheck update $as_me by reconfiguring in the same conditions + --file=FILE[:TEMPLATE] + instantiate the configuration file FILE + --header=FILE[:TEMPLATE] + instantiate the configuration header FILE + +Configuration files: +$config_files + +Configuration headers: +$config_headers + +Report bugs to ." + +_ACEOF +cat >>$CONFIG_STATUS <<_ACEOF +ac_cs_version="\\ +config.status +configured by $0, generated by GNU Autoconf 2.61, + with options \\"`echo "$ac_configure_args" | sed 's/^ //; s/[\\""\`\$]/\\\\&/g'`\\" + +Copyright (C) 2006 Free Software Foundation, Inc. +This config.status script is free software; the Free Software Foundation +gives unlimited permission to copy, distribute and modify it." + +ac_pwd='$ac_pwd' +srcdir='$srcdir' +INSTALL='$INSTALL' +_ACEOF + +cat >>$CONFIG_STATUS <<\_ACEOF +# If no file are specified by the user, then we need to provide default +# value. By we need to know if files were specified by the user. +ac_need_defaults=: +while test $# != 0 +do + case $1 in + --*=*) + ac_option=`expr "X$1" : 'X\([^=]*\)='` + ac_optarg=`expr "X$1" : 'X[^=]*=\(.*\)'` + ac_shift=: + ;; + *) + ac_option=$1 + ac_optarg=$2 + ac_shift=shift + ;; + esac + + case $ac_option in + # Handling of the options. + -recheck | --recheck | --rechec | --reche | --rech | --rec | --re | --r) + ac_cs_recheck=: ;; + --version | --versio | --versi | --vers | --ver | --ve | --v | -V ) + echo "$ac_cs_version"; exit ;; + --debug | --debu | --deb | --de | --d | -d ) + debug=: ;; + --file | --fil | --fi | --f ) + $ac_shift + CONFIG_FILES="$CONFIG_FILES $ac_optarg" + ac_need_defaults=false;; + --header | --heade | --head | --hea ) + $ac_shift + CONFIG_HEADERS="$CONFIG_HEADERS $ac_optarg" + ac_need_defaults=false;; + --he | --h) + # Conflict between --help and --header + { echo "$as_me: error: ambiguous option: $1 +Try \`$0 --help' for more information." >&2 + { (exit 1); exit 1; }; };; + --help | --hel | -h ) + echo "$ac_cs_usage"; exit ;; + -q | -quiet | --quiet | --quie | --qui | --qu | --q \ + | -silent | --silent | --silen | --sile | --sil | --si | --s) + ac_cs_silent=: ;; + + # This is an error. + -*) { echo "$as_me: error: unrecognized option: $1 +Try \`$0 --help' for more information." >&2 + { (exit 1); exit 1; }; } ;; + + *) ac_config_targets="$ac_config_targets $1" + ac_need_defaults=false ;; + + esac + shift +done + +ac_configure_extra_args= + +if $ac_cs_silent; then + exec 6>/dev/null + ac_configure_extra_args="$ac_configure_extra_args --silent" +fi + +_ACEOF +cat >>$CONFIG_STATUS <<_ACEOF +if \$ac_cs_recheck; then + echo "running CONFIG_SHELL=$SHELL $SHELL $0 "$ac_configure_args \$ac_configure_extra_args " --no-create --no-recursion" >&6 + CONFIG_SHELL=$SHELL + export CONFIG_SHELL + exec $SHELL "$0"$ac_configure_args \$ac_configure_extra_args --no-create --no-recursion +fi + +_ACEOF +cat >>$CONFIG_STATUS <<\_ACEOF +exec 5>>config.log +{ + echo + sed 'h;s/./-/g;s/^.../## /;s/...$/ ##/;p;x;p;x' <<_ASBOX +## Running $as_me. ## +_ASBOX + echo "$ac_log" +} >&5 + +_ACEOF +cat >>$CONFIG_STATUS <<_ACEOF +_ACEOF + +cat >>$CONFIG_STATUS <<\_ACEOF + +# Handling of arguments. +for ac_config_target in $ac_config_targets +do + case $ac_config_target in + "config.h") CONFIG_HEADERS="$CONFIG_HEADERS config.h" ;; + "Makefile") CONFIG_FILES="$CONFIG_FILES Makefile" ;; + "mxml.list") CONFIG_FILES="$CONFIG_FILES mxml.list" ;; + "mxml.pc") CONFIG_FILES="$CONFIG_FILES mxml.pc" ;; + + *) { { echo "$as_me:$LINENO: error: invalid argument: $ac_config_target" >&5 +echo "$as_me: error: invalid argument: $ac_config_target" >&2;} + { (exit 1); exit 1; }; };; + esac +done + + +# If the user did not use the arguments to specify the items to instantiate, +# then the envvar interface is used. Set only those that are not. +# We use the long form for the default assignment because of an extremely +# bizarre bug on SunOS 4.1.3. +if $ac_need_defaults; then + test "${CONFIG_FILES+set}" = set || CONFIG_FILES=$config_files + test "${CONFIG_HEADERS+set}" = set || CONFIG_HEADERS=$config_headers +fi + +# Have a temporary directory for convenience. Make it in the build tree +# simply because there is no reason against having it here, and in addition, +# creating and moving files from /tmp can sometimes cause problems. +# Hook for its removal unless debugging. +# Note that there is a small window in which the directory will not be cleaned: +# after its creation but before its name has been assigned to `$tmp'. +$debug || +{ + tmp= + trap 'exit_status=$? + { test -z "$tmp" || test ! -d "$tmp" || rm -fr "$tmp"; } && exit $exit_status +' 0 + trap '{ (exit 1); exit 1; }' 1 2 13 15 +} +# Create a (secure) tmp directory for tmp files. + +{ + tmp=`(umask 077 && mktemp -d "./confXXXXXX") 2>/dev/null` && + test -n "$tmp" && test -d "$tmp" +} || +{ + tmp=./conf$$-$RANDOM + (umask 077 && mkdir "$tmp") +} || +{ + echo "$me: cannot create a temporary directory in ." >&2 + { (exit 1); exit 1; } +} + +# +# Set up the sed scripts for CONFIG_FILES section. +# + +# No need to generate the scripts if there are no CONFIG_FILES. +# This happens for instance when ./config.status config.h +if test -n "$CONFIG_FILES"; then + +_ACEOF + + + +ac_delim='%!_!# ' +for ac_last_try in false false false false false :; do + cat >conf$$subs.sed <<_ACEOF +SHELL!$SHELL$ac_delim +PATH_SEPARATOR!$PATH_SEPARATOR$ac_delim +PACKAGE_NAME!$PACKAGE_NAME$ac_delim +PACKAGE_TARNAME!$PACKAGE_TARNAME$ac_delim +PACKAGE_VERSION!$PACKAGE_VERSION$ac_delim +PACKAGE_STRING!$PACKAGE_STRING$ac_delim +PACKAGE_BUGREPORT!$PACKAGE_BUGREPORT$ac_delim +exec_prefix!$exec_prefix$ac_delim +prefix!$prefix$ac_delim +program_transform_name!$program_transform_name$ac_delim +bindir!$bindir$ac_delim +sbindir!$sbindir$ac_delim +libexecdir!$libexecdir$ac_delim +datarootdir!$datarootdir$ac_delim +datadir!$datadir$ac_delim +sysconfdir!$sysconfdir$ac_delim +sharedstatedir!$sharedstatedir$ac_delim +localstatedir!$localstatedir$ac_delim +includedir!$includedir$ac_delim +oldincludedir!$oldincludedir$ac_delim +docdir!$docdir$ac_delim +infodir!$infodir$ac_delim +htmldir!$htmldir$ac_delim +dvidir!$dvidir$ac_delim +pdfdir!$pdfdir$ac_delim +psdir!$psdir$ac_delim +libdir!$libdir$ac_delim +localedir!$localedir$ac_delim +mandir!$mandir$ac_delim +DEFS!$DEFS$ac_delim +ECHO_C!$ECHO_C$ac_delim +ECHO_N!$ECHO_N$ac_delim +ECHO_T!$ECHO_T$ac_delim +LIBS!$LIBS$ac_delim +build_alias!$build_alias$ac_delim +host_alias!$host_alias$ac_delim +target_alias!$target_alias$ac_delim +VERSION!$VERSION$ac_delim +LDFLAGS!$LDFLAGS$ac_delim +OPTIM!$OPTIM$ac_delim +ARCHFLAGS!$ARCHFLAGS$ac_delim +CC!$CC$ac_delim +CFLAGS!$CFLAGS$ac_delim +CPPFLAGS!$CPPFLAGS$ac_delim +ac_ct_CC!$ac_ct_CC$ac_delim +EXEEXT!$EXEEXT$ac_delim +OBJEXT!$OBJEXT$ac_delim +CXX!$CXX$ac_delim +CXXFLAGS!$CXXFLAGS$ac_delim +ac_ct_CXX!$ac_ct_CXX$ac_delim +INSTALL_PROGRAM!$INSTALL_PROGRAM$ac_delim +INSTALL_SCRIPT!$INSTALL_SCRIPT$ac_delim +INSTALL_DATA!$INSTALL_DATA$ac_delim +RANLIB!$RANLIB$ac_delim +AR!$AR$ac_delim +CP!$CP$ac_delim +LN!$LN$ac_delim +MKDIR!$MKDIR$ac_delim +RM!$RM$ac_delim +ARFLAGS!$ARFLAGS$ac_delim +CPP!$CPP$ac_delim +GREP!$GREP$ac_delim +EGREP!$EGREP$ac_delim +PTHREAD_FLAGS!$PTHREAD_FLAGS$ac_delim +PTHREAD_LIBS!$PTHREAD_LIBS$ac_delim +DSO!$DSO$ac_delim +DSOFLAGS!$DSOFLAGS$ac_delim +LIBMXML!$LIBMXML$ac_delim +PICFLAG!$PICFLAG$ac_delim +PC_CFLAGS!$PC_CFLAGS$ac_delim +PC_LIBS!$PC_LIBS$ac_delim +LIBOBJS!$LIBOBJS$ac_delim +LTLIBOBJS!$LTLIBOBJS$ac_delim +_ACEOF + + if test `sed -n "s/.*$ac_delim\$/X/p" conf$$subs.sed | grep -c X` = 73; then + break + elif $ac_last_try; then + { { echo "$as_me:$LINENO: error: could not make $CONFIG_STATUS" >&5 +echo "$as_me: error: could not make $CONFIG_STATUS" >&2;} + { (exit 1); exit 1; }; } + else + ac_delim="$ac_delim!$ac_delim _$ac_delim!! " + fi +done + +ac_eof=`sed -n '/^CEOF[0-9]*$/s/CEOF/0/p' conf$$subs.sed` +if test -n "$ac_eof"; then + ac_eof=`echo "$ac_eof" | sort -nru | sed 1q` + ac_eof=`expr $ac_eof + 1` +fi + +cat >>$CONFIG_STATUS <<_ACEOF +cat >"\$tmp/subs-1.sed" <<\CEOF$ac_eof +/@[a-zA-Z_][a-zA-Z_0-9]*@/!b end +_ACEOF +sed ' +s/[,\\&]/\\&/g; s/@/@|#_!!_#|/g +s/^/s,@/; s/!/@,|#_!!_#|/ +:n +t n +s/'"$ac_delim"'$/,g/; t +s/$/\\/; p +N; s/^.*\n//; s/[,\\&]/\\&/g; s/@/@|#_!!_#|/g; b n +' >>$CONFIG_STATUS >$CONFIG_STATUS <<_ACEOF +:end +s/|#_!!_#|//g +CEOF$ac_eof +_ACEOF + + +# VPATH may cause trouble with some makes, so we remove $(srcdir), +# ${srcdir} and @srcdir@ from VPATH if srcdir is ".", strip leading and +# trailing colons and then remove the whole line if VPATH becomes empty +# (actually we leave an empty line to preserve line numbers). +if test "x$srcdir" = x.; then + ac_vpsub='/^[ ]*VPATH[ ]*=/{ +s/:*\$(srcdir):*/:/ +s/:*\${srcdir}:*/:/ +s/:*@srcdir@:*/:/ +s/^\([^=]*=[ ]*\):*/\1/ +s/:*$// +s/^[^=]*=[ ]*$// +}' +fi + +cat >>$CONFIG_STATUS <<\_ACEOF +fi # test -n "$CONFIG_FILES" + + +for ac_tag in :F $CONFIG_FILES :H $CONFIG_HEADERS +do + case $ac_tag in + :[FHLC]) ac_mode=$ac_tag; continue;; + esac + case $ac_mode$ac_tag in + :[FHL]*:*);; + :L* | :C*:*) { { echo "$as_me:$LINENO: error: Invalid tag $ac_tag." >&5 +echo "$as_me: error: Invalid tag $ac_tag." >&2;} + { (exit 1); exit 1; }; };; + :[FH]-) ac_tag=-:-;; + :[FH]*) ac_tag=$ac_tag:$ac_tag.in;; + esac + ac_save_IFS=$IFS + IFS=: + set x $ac_tag + IFS=$ac_save_IFS + shift + ac_file=$1 + shift + + case $ac_mode in + :L) ac_source=$1;; + :[FH]) + ac_file_inputs= + for ac_f + do + case $ac_f in + -) ac_f="$tmp/stdin";; + *) # Look for the file first in the build tree, then in the source tree + # (if the path is not absolute). The absolute path cannot be DOS-style, + # because $ac_f cannot contain `:'. + test -f "$ac_f" || + case $ac_f in + [\\/$]*) false;; + *) test -f "$srcdir/$ac_f" && ac_f="$srcdir/$ac_f";; + esac || + { { echo "$as_me:$LINENO: error: cannot find input file: $ac_f" >&5 +echo "$as_me: error: cannot find input file: $ac_f" >&2;} + { (exit 1); exit 1; }; };; + esac + ac_file_inputs="$ac_file_inputs $ac_f" + done + + # Let's still pretend it is `configure' which instantiates (i.e., don't + # use $as_me), people would be surprised to read: + # /* config.h. Generated by config.status. */ + configure_input="Generated from "`IFS=: + echo $* | sed 's|^[^:]*/||;s|:[^:]*/|, |g'`" by configure." + if test x"$ac_file" != x-; then + configure_input="$ac_file. $configure_input" + { echo "$as_me:$LINENO: creating $ac_file" >&5 +echo "$as_me: creating $ac_file" >&6;} + fi + + case $ac_tag in + *:-:* | *:-) cat >"$tmp/stdin";; + esac + ;; + esac + + ac_dir=`$as_dirname -- "$ac_file" || +$as_expr X"$ac_file" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ + X"$ac_file" : 'X\(//\)[^/]' \| \ + X"$ac_file" : 'X\(//\)$' \| \ + X"$ac_file" : 'X\(/\)' \| . 2>/dev/null || +echo X"$ac_file" | + sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ + s//\1/ + q + } + /^X\(\/\/\)[^/].*/{ + s//\1/ + q + } + /^X\(\/\/\)$/{ + s//\1/ + q + } + /^X\(\/\).*/{ + s//\1/ + q + } + s/.*/./; q'` + { as_dir="$ac_dir" + case $as_dir in #( + -*) as_dir=./$as_dir;; + esac + test -d "$as_dir" || { $as_mkdir_p && mkdir -p "$as_dir"; } || { + as_dirs= + while :; do + case $as_dir in #( + *\'*) as_qdir=`echo "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #( + *) as_qdir=$as_dir;; + esac + as_dirs="'$as_qdir' $as_dirs" + as_dir=`$as_dirname -- "$as_dir" || +$as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ + X"$as_dir" : 'X\(//\)[^/]' \| \ + X"$as_dir" : 'X\(//\)$' \| \ + X"$as_dir" : 'X\(/\)' \| . 2>/dev/null || +echo X"$as_dir" | + sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ + s//\1/ + q + } + /^X\(\/\/\)[^/].*/{ + s//\1/ + q + } + /^X\(\/\/\)$/{ + s//\1/ + q + } + /^X\(\/\).*/{ + s//\1/ + q + } + s/.*/./; q'` + test -d "$as_dir" && break + done + test -z "$as_dirs" || eval "mkdir $as_dirs" + } || test -d "$as_dir" || { { echo "$as_me:$LINENO: error: cannot create directory $as_dir" >&5 +echo "$as_me: error: cannot create directory $as_dir" >&2;} + { (exit 1); exit 1; }; }; } + ac_builddir=. + +case "$ac_dir" in +.) ac_dir_suffix= ac_top_builddir_sub=. ac_top_build_prefix= ;; +*) + ac_dir_suffix=/`echo "$ac_dir" | sed 's,^\.[\\/],,'` + # A ".." for each directory in $ac_dir_suffix. + ac_top_builddir_sub=`echo "$ac_dir_suffix" | sed 's,/[^\\/]*,/..,g;s,/,,'` + case $ac_top_builddir_sub in + "") ac_top_builddir_sub=. ac_top_build_prefix= ;; + *) ac_top_build_prefix=$ac_top_builddir_sub/ ;; + esac ;; +esac +ac_abs_top_builddir=$ac_pwd +ac_abs_builddir=$ac_pwd$ac_dir_suffix +# for backward compatibility: +ac_top_builddir=$ac_top_build_prefix + +case $srcdir in + .) # We are building in place. + ac_srcdir=. + ac_top_srcdir=$ac_top_builddir_sub + ac_abs_top_srcdir=$ac_pwd ;; + [\\/]* | ?:[\\/]* ) # Absolute name. + ac_srcdir=$srcdir$ac_dir_suffix; + ac_top_srcdir=$srcdir + ac_abs_top_srcdir=$srcdir ;; + *) # Relative name. + ac_srcdir=$ac_top_build_prefix$srcdir$ac_dir_suffix + ac_top_srcdir=$ac_top_build_prefix$srcdir + ac_abs_top_srcdir=$ac_pwd/$srcdir ;; +esac +ac_abs_srcdir=$ac_abs_top_srcdir$ac_dir_suffix + + + case $ac_mode in + :F) + # + # CONFIG_FILE + # + + case $INSTALL in + [\\/$]* | ?:[\\/]* ) ac_INSTALL=$INSTALL ;; + *) ac_INSTALL=$ac_top_build_prefix$INSTALL ;; + esac +_ACEOF + +cat >>$CONFIG_STATUS <<\_ACEOF +# If the template does not know about datarootdir, expand it. +# FIXME: This hack should be removed a few years after 2.60. +ac_datarootdir_hack=; ac_datarootdir_seen= + +case `sed -n '/datarootdir/ { + p + q +} +/@datadir@/p +/@docdir@/p +/@infodir@/p +/@localedir@/p +/@mandir@/p +' $ac_file_inputs` in +*datarootdir*) ac_datarootdir_seen=yes;; +*@datadir@*|*@docdir@*|*@infodir@*|*@localedir@*|*@mandir@*) + { echo "$as_me:$LINENO: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&5 +echo "$as_me: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&2;} +_ACEOF +cat >>$CONFIG_STATUS <<_ACEOF + ac_datarootdir_hack=' + s&@datadir@&$datadir&g + s&@docdir@&$docdir&g + s&@infodir@&$infodir&g + s&@localedir@&$localedir&g + s&@mandir@&$mandir&g + s&\\\${datarootdir}&$datarootdir&g' ;; +esac +_ACEOF + +# Neutralize VPATH when `$srcdir' = `.'. +# Shell code in configure.ac might set extrasub. +# FIXME: do we really want to maintain this feature? +cat >>$CONFIG_STATUS <<_ACEOF + sed "$ac_vpsub +$extrasub +_ACEOF +cat >>$CONFIG_STATUS <<\_ACEOF +:t +/@[a-zA-Z_][a-zA-Z_0-9]*@/!b +s&@configure_input@&$configure_input&;t t +s&@top_builddir@&$ac_top_builddir_sub&;t t +s&@srcdir@&$ac_srcdir&;t t +s&@abs_srcdir@&$ac_abs_srcdir&;t t +s&@top_srcdir@&$ac_top_srcdir&;t t +s&@abs_top_srcdir@&$ac_abs_top_srcdir&;t t +s&@builddir@&$ac_builddir&;t t +s&@abs_builddir@&$ac_abs_builddir&;t t +s&@abs_top_builddir@&$ac_abs_top_builddir&;t t +s&@INSTALL@&$ac_INSTALL&;t t +$ac_datarootdir_hack +" $ac_file_inputs | sed -f "$tmp/subs-1.sed" >$tmp/out + +test -z "$ac_datarootdir_hack$ac_datarootdir_seen" && + { ac_out=`sed -n '/\${datarootdir}/p' "$tmp/out"`; test -n "$ac_out"; } && + { ac_out=`sed -n '/^[ ]*datarootdir[ ]*:*=/p' "$tmp/out"`; test -z "$ac_out"; } && + { echo "$as_me:$LINENO: WARNING: $ac_file contains a reference to the variable \`datarootdir' +which seems to be undefined. Please make sure it is defined." >&5 +echo "$as_me: WARNING: $ac_file contains a reference to the variable \`datarootdir' +which seems to be undefined. Please make sure it is defined." >&2;} + + rm -f "$tmp/stdin" + case $ac_file in + -) cat "$tmp/out"; rm -f "$tmp/out";; + *) rm -f "$ac_file"; mv "$tmp/out" $ac_file;; + esac + ;; + :H) + # + # CONFIG_HEADER + # +_ACEOF + +# Transform confdefs.h into a sed script `conftest.defines', that +# substitutes the proper values into config.h.in to produce config.h. +rm -f conftest.defines conftest.tail +# First, append a space to every undef/define line, to ease matching. +echo 's/$/ /' >conftest.defines +# Then, protect against being on the right side of a sed subst, or in +# an unquoted here document, in config.status. If some macros were +# called several times there might be several #defines for the same +# symbol, which is useless. But do not sort them, since the last +# AC_DEFINE must be honored. +ac_word_re=[_$as_cr_Letters][_$as_cr_alnum]* +# These sed commands are passed to sed as "A NAME B PARAMS C VALUE D", where +# NAME is the cpp macro being defined, VALUE is the value it is being given. +# PARAMS is the parameter list in the macro definition--in most cases, it's +# just an empty string. +ac_dA='s,^\\([ #]*\\)[^ ]*\\([ ]*' +ac_dB='\\)[ (].*,\\1define\\2' +ac_dC=' ' +ac_dD=' ,' + +uniq confdefs.h | + sed -n ' + t rset + :rset + s/^[ ]*#[ ]*define[ ][ ]*// + t ok + d + :ok + s/[\\&,]/\\&/g + s/^\('"$ac_word_re"'\)\(([^()]*)\)[ ]*\(.*\)/ '"$ac_dA"'\1'"$ac_dB"'\2'"${ac_dC}"'\3'"$ac_dD"'/p + s/^\('"$ac_word_re"'\)[ ]*\(.*\)/'"$ac_dA"'\1'"$ac_dB$ac_dC"'\2'"$ac_dD"'/p + ' >>conftest.defines + +# Remove the space that was appended to ease matching. +# Then replace #undef with comments. This is necessary, for +# example, in the case of _POSIX_SOURCE, which is predefined and required +# on some systems where configure will not decide to define it. +# (The regexp can be short, since the line contains either #define or #undef.) +echo 's/ $// +s,^[ #]*u.*,/* & */,' >>conftest.defines + +# Break up conftest.defines: +ac_max_sed_lines=50 + +# First sed command is: sed -f defines.sed $ac_file_inputs >"$tmp/out1" +# Second one is: sed -f defines.sed "$tmp/out1" >"$tmp/out2" +# Third one will be: sed -f defines.sed "$tmp/out2" >"$tmp/out1" +# et cetera. +ac_in='$ac_file_inputs' +ac_out='"$tmp/out1"' +ac_nxt='"$tmp/out2"' + +while : +do + # Write a here document: + cat >>$CONFIG_STATUS <<_ACEOF + # First, check the format of the line: + cat >"\$tmp/defines.sed" <<\\CEOF +/^[ ]*#[ ]*undef[ ][ ]*$ac_word_re[ ]*\$/b def +/^[ ]*#[ ]*define[ ][ ]*$ac_word_re[( ]/b def +b +:def +_ACEOF + sed ${ac_max_sed_lines}q conftest.defines >>$CONFIG_STATUS + echo 'CEOF + sed -f "$tmp/defines.sed"' "$ac_in >$ac_out" >>$CONFIG_STATUS + ac_in=$ac_out; ac_out=$ac_nxt; ac_nxt=$ac_in + sed 1,${ac_max_sed_lines}d conftest.defines >conftest.tail + grep . conftest.tail >/dev/null || break + rm -f conftest.defines + mv conftest.tail conftest.defines +done +rm -f conftest.defines conftest.tail + +echo "ac_result=$ac_in" >>$CONFIG_STATUS +cat >>$CONFIG_STATUS <<\_ACEOF + if test x"$ac_file" != x-; then + echo "/* $configure_input */" >"$tmp/config.h" + cat "$ac_result" >>"$tmp/config.h" + if diff $ac_file "$tmp/config.h" >/dev/null 2>&1; then + { echo "$as_me:$LINENO: $ac_file is unchanged" >&5 +echo "$as_me: $ac_file is unchanged" >&6;} + else + rm -f $ac_file + mv "$tmp/config.h" $ac_file + fi + else + echo "/* $configure_input */" + cat "$ac_result" + fi + rm -f "$tmp/out12" + ;; + + + esac + +done # for ac_tag + + +{ (exit 0); exit 0; } +_ACEOF +chmod +x $CONFIG_STATUS +ac_clean_files=$ac_clean_files_save + + +# configure is writing to config.log, and then calls config.status. +# config.status does its own redirection, appending to config.log. +# Unfortunately, on DOS this fails, as config.log is still kept open +# by configure, so config.status won't be able to write to it; its +# output is simply discarded. So we exec the FD to /dev/null, +# effectively closing config.log, so it can be properly (re)opened and +# appended to by config.status. When coming back to configure, we +# need to make the FD available again. +if test "$no_create" != yes; then + ac_cs_success=: + ac_config_status_args= + test "$silent" = yes && + ac_config_status_args="$ac_config_status_args --quiet" + exec 5>/dev/null + $SHELL $CONFIG_STATUS $ac_config_status_args || ac_cs_success=false + exec 5>>config.log + # Use ||, not &&, to avoid exiting from the if with $? = 1, which + # would make configure fail if this is the last instruction. + $ac_cs_success || { (exit 1); exit 1; } +fi + + diff -Naur mxml-2.6/configure.in mxml-2.6-haiku/configure.in --- mxml-2.6/configure.in 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/configure.in 2009-04-18 17:05:52.000000000 +0000 @@ -0,0 +1,340 @@ +dnl +dnl "$Id: configure.in 387 2009-04-18 17:05:52Z mike $" +dnl +dnl Configuration script for Mini-XML, a small XML-like file parsing library. +dnl +dnl Copyright 2003-2009 by Michael Sweet. +dnl +dnl This program is free software; you can redistribute it and/or +dnl modify it under the terms of the GNU Library General Public +dnl License as published by the Free Software Foundation; either +dnl version 2, or (at your option) any later version. +dnl +dnl This program is distributed in the hope that it will be useful, +dnl but WITHOUT ANY WARRANTY; without even the implied warranty of +dnl MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +dnl GNU General Public License for more details. +dnl + +dnl Specify a source file from the distribution... +AC_INIT(mxml.h) + +dnl Set the name of the config header file... +AC_CONFIG_HEADER(config.h) + +dnl Version number... +VERSION=2.6 +AC_SUBST(VERSION) +AC_DEFINE_UNQUOTED(MXML_VERSION, "Mini-XML v$VERSION") + +dnl Clear default debugging options and set normal optimization by +dnl default unless the user asks for debugging specifically. +CFLAGS="${CFLAGS:=}" +CXXFLAGS="${CXXFLAGS:=}" +LDFLAGS="${LDFLAGS:=}" +AC_SUBST(LDFLAGS) +OPTIM="" +AC_SUBST(OPTIM) + +AC_ARG_WITH(ansi, [ --with-ansi set full ANSI C mode, default=no], + use_ansi="$withval", + use_ansi="no") + +AC_ARG_WITH(archflags, [ --with-archflags set additional architecture flags, default=none], + ARCHFLAGS="$withval", + ARCHFLAGS="") +AC_SUBST(ARCHFLAGS) + +AC_ARG_ENABLE(debug, [ --enable-debug turn on debugging, default=no], +if eval "test x$enable_debug = xyes"; then + OPTIM="-g" +fi) + +AC_ARG_WITH(docdir, [ --with-docdir set directory for documentation, default=${prefix}/share/doc/mxml], + docdir="$withval", + docdir="NONE") + +AC_SUBST(docdir) + +AC_ARG_WITH(vsnprintf, [ --with-vsnprintf use vsnprintf emulation functions, default=auto], + use_vsnprintf="$withval", + use_vsnprintf="no") + +dnl Get the operating system and version number... +uname=`uname` +uversion=`uname -r | sed -e '1,$s/[[^0-9]]//g'` +if test x$uname = xIRIX64; then + uname="IRIX" +fi + +dnl Checks for programs... +AC_PROG_CC +AC_PROG_CXX +AC_PROG_INSTALL +if test "$INSTALL" = "$ac_install_sh"; then + # Use full path to install-sh script... + INSTALL="`pwd`/install-sh -c" +fi +AC_PROG_RANLIB +AC_PATH_PROG(AR,ar) +AC_PATH_PROG(CP,cp) +AC_PATH_PROG(LN,ln) +AC_PATH_PROG(MKDIR,mkdir) +AC_PATH_PROG(RM,rm) + +dnl Flags for "ar" command... +case "$uname" in + Darwin* | *BSD*) + ARFLAGS="-rcv" + ;; + *) + ARFLAGS="crvs" + ;; +esac + +AC_SUBST(ARFLAGS) + +dnl Inline functions... +AC_C_INLINE + +dnl Checks for string functions. +if test "x$use_ansi" != xyes; then + AC_CHECK_FUNCS(strdup) +fi + +if test "x$use_vsnprintf" != xyes; then + AC_CHECK_FUNCS(snprintf vsnprintf) +fi + +dnl Check for "long long" support... +AC_CACHE_CHECK(for long long int, ac_cv_c_long_long, + [if test "$GCC" = yes; then + ac_cv_c_long_long=yes + else + AC_TRY_COMPILE(,[long long int i;], + ac_cv_c_long_long=yes, + ac_cv_c_long_long=no) + fi]) + +if test $ac_cv_c_long_long = yes; then + AC_DEFINE(HAVE_LONG_LONG) +fi + +dnl Threading support +AC_ARG_ENABLE(threads, [ --enable-threads enable multi-threading support]) + +have_pthread=no +PTHREAD_FLAGS="" +PTHREAD_LIBS="" + +if test "x$enable_threads" != xno; then + AC_CHECK_HEADER(pthread.h, AC_DEFINE(HAVE_PTHREAD_H)) + + if test x$ac_cv_header_pthread_h = xyes; then + dnl Check various threading options for the platforms we support + for flag in -lpthreads -lpthread -pthread; do + AC_MSG_CHECKING([for pthread_create using $flag]) + SAVELIBS="$LIBS" + LIBS="$flag $LIBS" + AC_TRY_LINK([#include ], + [pthread_create(0, 0, 0, 0);], + have_pthread=yes) + AC_MSG_RESULT([$have_pthread]) + LIBS="$SAVELIBS" + + if test $have_pthread = yes; then + PTHREAD_FLAGS="-D_THREAD_SAFE -D_REENTRANT" + PTHREAD_LIBS="$flag" + + # Solaris requires -D_POSIX_PTHREAD_SEMANTICS to + # be POSIX-compliant... :( + if test $uname = SunOS; then + PTHREAD_FLAGS="$PTHREAD_FLAGS -D_POSIX_PTHREAD_SEMANTICS" + fi + break + fi + done + fi +fi + +AC_SUBST(PTHREAD_FLAGS) +AC_SUBST(PTHREAD_LIBS) + +dnl Shared library support... +DSO="${DSO:=:}" +DSOFLAGS="${DSOFLAGS:=}" + +AC_ARG_ENABLE(shared, [ --enable-shared turn on shared libraries, default=no]) + +if test x$enable_shared = xyes; then + AC_MSG_CHECKING(for shared library support) + PICFLAG=1 + + case "$uname" in + SunOS* | UNIX_S*) + AC_MSG_RESULT(yes) + LIBMXML="libmxml.so.1.4" + DSO="\$(CC)" + DSOFLAGS="$DSOFLAGS -Wl,-h,libmxml.so.1 -G -R\$(libdir) \$(OPTIM)" + LDFLAGS="$LDFLAGS -R\$(libdir)" + ;; + + HP-UX*) + AC_MSG_RESULT(yes) + LIBMXML="libmxml.sl.1" + DSO="ld" + DSOFLAGS="$DSOFLAGS -b -z +h libmxml.sl.1 +s +b \$(libdir)" + LDFLAGS="$LDFLAGS -Wl,+s,+b,\$(libdir)" + ;; + + IRIX) + AC_MSG_RESULT(yes) + LIBMXML="libmxml.so.1.4" + DSO="\$(CC)" + DSOFLAGS="$DSOFLAGS -Wl,-rpath,\$(libdir),-set_version,sgi1.0,-soname,libmxml.so.1 -shared \$(OPTIM)" + ;; + + OSF1* | Linux | GNU) + AC_MSG_RESULT(yes) + LIBMXML="libmxml.so.1.4" + DSO="\$(CC)" + DSOFLAGS="$DSOFLAGS -Wl,-soname,libmxml.so.1,-rpath,\$(libdir) -shared \$(OPTIM)" + LDFLAGS="$LDFLAGS -Wl,-rpath,\$(libdir)" + ;; + + *BSD*) + AC_MSG_RESULT(yes) + LIBMXML="libmxml.so.1.4" + DSO="\$(CC)" + DSOFLAGS="$DSOFLAGS -Wl,-soname,libmxml.so.1,-R\$(libdir) -shared \$(OPTIM)" + LDFLAGS="$LDFLAGS -Wl,-R\$(libdir)" + ;; + + Darwin*) + AC_MSG_RESULT(yes) + LIBMXML="libmxml.1.dylib" + DSO="\$(CC)" + DSOFLAGS="$DSOFLAGS \$(RC_CFLAGS) -dynamiclib -lc" + ;; + + *) + AC_MSG_RESULT(no) + AC_MSG_WARN(shared libraries not supported on this platform.) + PICFLAG=0 + LIBMXML="libmxml.a" + ;; + esac +else + PICFLAG=0 + LIBMXML="libmxml.a" +fi + +AC_SUBST(DSO) +AC_SUBST(DSOFLAGS) +AC_SUBST(LIBMXML) +AC_SUBST(PICFLAG) + +dnl Add -Wall for GCC... +if test -n "$GCC"; then + CFLAGS="-Wall $CFLAGS" + + if test "x$OPTIM" = x; then + OPTIM="-Os -g" + fi + + if test "x$use_ansi" = xyes; then + CFLAGS="-ansi -pedantic $CFLAGS" + fi + + if test $PICFLAG = 1 -a $uname != AIX; then + OPTIM="-fPIC $OPTIM" + fi +else + case $uname in + HP-UX*) + CFLAGS="-Ae $CFLAGS" + + if test "x$OPTIM" = x; then + OPTIM="-O" + fi + + OPTIM="+DAportable $OPTIM" + + if test $PICFLAG = 1; then + OPTIM="+z $OPTIM" + fi + ;; + + UNIX_SVR* | SunOS*) + if test "x$OPTIM" = x; then + OPTIM="-O" + fi + + if test $PICFLAG = 1; then + OPTIM="-KPIC $OPTIM" + fi + ;; + + *) + if test "x$OPTIM" = x; then + OPTIM="-O" + fi + ;; + esac +fi + +dnl Fix "prefix" variable if it hasn't been specified... +if test "$prefix" = "NONE"; then + prefix="/usr/local" +fi + +dnl Fix "exec_prefix" variable if it hasn't been specified... +if test "$exec_prefix" = "NONE"; then + exec_prefix="$prefix" +fi + +dnl Fix "docdir" variable if it hasn't been specified... +if test "$docdir" = "NONE"; then + docdir="$datadir/doc/mxml" +fi + +dnl Fix "mandir" variable if it hasn't been specified... +if test "$mandir" = "\${prefix}/man" -a "$prefix" = "/usr"; then + case "$uname" in + *BSD* | Darwin* | Linux*) + # BSD, Darwin (MacOS X), and Linux + mandir="/usr/share/man" + ;; + IRIX*) + # SGI IRIX + mandir="/usr/share/catman/u_man" + ;; + *) + # All others + mandir="/usr/man" + ;; + esac +fi + +dnl pkg-config stuff... +if test "$includedir" != /usr/include; then + PC_CFLAGS="-I$includedir" +else + PC_CFLAGS="" +fi + +if test "$libdir" != /usr/lib; then + PC_LIBS="-L$libdir -lmxml" +else + PC_LIBS="-lmxml" +fi + +AC_SUBST(PC_CFLAGS) +AC_SUBST(PC_LIBS) + +dnl Output the makefile, etc... +AC_OUTPUT(Makefile mxml.list mxml.pc) + +dnl +dnl End of "$Id: configure.in 387 2009-04-18 17:05:52Z mike $". +dnl diff -Naur mxml-2.6/doc/0.gif mxml-2.6-haiku/doc/0.gif --- mxml-2.6/doc/0.gif 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/0.gif 2007-04-26 22:21:37.000000000 +0000 @@ -0,0 +1,5 @@ +GIF89addç + + +  !!!"""###$$$%%%&&&'''((()))***+++,,,---...///000111222333444555666777888999:::;;;<<<===>>>???@@@AAABBBCCCDDDEEEFFFGGGHHHIIIJJJKKKLLLMMMNNNOOOPPPQQQRRRSSSTTTUUUVVVWWWXXXYYYZZZ[[[\\\]]]^^^___```aaabbbcccdddeeefffggghhhiiijjjkkklllmmmnnnooopppqqqrrrssstttuuuvvvwwwxxxyyyzzz{{{|||}}}~~~€€€‚‚‚ƒƒƒ„„„………†††‡‡‡ˆˆˆ‰‰‰ŠŠŠ‹‹‹ŒŒŒŽŽŽ‘‘‘’’’“““”””•••–––———˜˜˜™™™ššš›››œœœžžžŸŸŸ   ¡¡¡¢¢¢£££¤¤¤¥¥¥¦¦¦§§§¨¨¨©©©ªªª«««¬¬¬­­­®®®¯¯¯°°°±±±²²²³³³´´´µµµ¶¶¶···¸¸¸¹¹¹ººº»»»¼¼¼½½½¾¾¾¿¿¿ÀÀÀÁÁÁÂÂÂÃÃÃÄÄÄÅÅÅÆÆÆÇÇÇÈÈÈÉÉÉÊÊÊËËËÌÌÌÍÍÍÎÎÎÏÏÏÐÐÐÑÑÑÒÒÒÓÓÓÔÔÔÕÕÕÖÖÖ×××ØØØÙÙÙÚÚÚÛÛÛÜÜÜÝÝÝÞÞÞßßßàààáááâââãããäääåååæææçççèèèéééêêêëëëìììíííîîîïïïðððñññòòòóóóôôôõõõööö÷÷÷øøøùùùúúúûûûüüüýýýþþþÿÿÿ,ddþÿ H°`A5*\È°¡Ã‡#*Tc°¢Å‹‡IÜȱ£ÇÃ0Š¼hå£É“(­Œ\ù¯Ê—0;öay1¦Í›i$…³§Ï„¤tþkò³(Î&4a]jÆJ¢L£¾DŠ‘§Ô«'ƒÖÄÊõãÖ® ydªæÎÝ5MDÀ*¬è’k–”ºÎ,ˆÐ°,)uß]ºRU”*äoE?RjdzÍ°Å{QCþ‹ªÏ1ƨ™Þ³,’if£’9_<·ô¢'DLbôtQÕ+ÕÂ4{$dÙ'uâhD'n“ìXÆ‹(%¿ß…oŒÇ9Ç1Í9²äã\"K !D¯þp»ôØÜþ¦©äc••6Â7üÞëHtêzï8_}ý÷¹¯|vÒWûø3¬äšGçTC| ²v&Ù5Ò&ÐÏO„ùáG¡~ÒסsZ÷!r!FT¢l'v7âo):ÔbW/Ê·"n1.TãU7&”#f3æÔ£Z;îèÙ. £‘2Ž„!’62‰£“:BÉ£’( Yš”V¤”CR™—WziR–¯a ¦–fŠÞ–jrئ‡o:çMšá+)eU"¡ƒ"]rR,+åµdœ&žfgc*Š&¢>BŠœ&+…ðQ+qaB€2 +§§›ÆH&SÉ>›*”K»lÔ K²¤ºKÄDD M²*dŠN4T‚N‚ä:km æj±•!l“ÈV´l’ÍöìB6D;ÐL øÓ\Í~‘ídLÙÑ-R­@¬‰›®hzý³˜THX6V¡uuÄ]U)_]É1 j &í´]ÔÁEqKÂÄ°OU=|“VA%1J|b¤çÅ9Å’Åo”ñJV…ÅB™©a«|€Â–ñ˱Àµ½ËphÖš¶,E; \ No newline at end of file diff -Naur mxml-2.6/doc/1.gif mxml-2.6-haiku/doc/1.gif --- mxml-2.6/doc/1.gif 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/1.gif 2007-04-26 22:21:37.000000000 +0000 @@ -0,0 +1,7 @@ +GIF89addç + + +  !!!"""###$$$%%%&&&'''((()))***+++,,,---...///000111222333444555666777888999:::;;;<<<===>>>???@@@AAABBBCCCDDDEEEFFFGGGHHHIIIJJJKKKLLLMMMNNNOOOPPPQQQRRRSSSTTTUUUVVVWWWXXXYYYZZZ[[[\\\]]]^^^___```aaabbbcccdddeeefffggghhhiiijjjkkklllmmmnnnooopppqqqrrrssstttuuuvvvwwwxxxyyyzzz{{{|||}}}~~~€€€‚‚‚ƒƒƒ„„„………†††‡‡‡ˆˆˆ‰‰‰ŠŠŠ‹‹‹ŒŒŒŽŽŽ‘‘‘’’’“““”””•••–––———˜˜˜™™™ššš›››œœœžžžŸŸŸ   ¡¡¡¢¢¢£££¤¤¤¥¥¥¦¦¦§§§¨¨¨©©©ªªª«««¬¬¬­­­®®®¯¯¯°°°±±±²²²³³³´´´µµµ¶¶¶···¸¸¸¹¹¹ººº»»»¼¼¼½½½¾¾¾¿¿¿ÀÀÀÁÁÁÂÂÂÃÃÃÄÄÄÅÅÅÆÆÆÇÇÇÈÈÈÉÉÉÊÊÊËËËÌÌÌÍÍÍÎÎÎÏÏÏÐÐÐÑÑÑÒÒÒÓÓÓÔÔÔÕÕÕÖÖÖ×××ØØØÙÙÙÚÚÚÛÛÛÜÜÜÝÝÝÞÞÞßßßàààáááâââãããäääåååæææçççèèèéééêêêëëëìììíííîîîïïïðððñññòòòóóóôôôõõõööö÷÷÷øøøùùùúúúûûûüüüýýýþþþÿÿÿ,ddþÿ H°`A5*\È°¡Ã‡#*Tc°¢Å‹‡IÜȱ£ÇÃ0Š¼hå£É“(­Œ\ù¯Ê—0;öay1¦Í›i$…³§Ï„¤tþkò³(Î&4a]jÆJ¢L£¾DŠ‘§Ô«'ƒÖÄÊõãÖ®`9Vt¶lÄ™Í6ü*µ`Iµ +©°ªr Ü…»Ôx÷€…¼\Cþë›P$X„iÖ;ø.‘‡Âý±¬dµ½XÆÚ@ç樄6þìsD:шIŸT EIèPT}RöbÚmÆÝQ÷\Þ}[Þ[ølâG\9Aæ?‡žSzjê75cÏ^y»MíÞaÞ‚r>>???@@@AAABBBCCCDDDEEEFFFGGGHHHIIIJJJKKKLLLMMMNNNOOOPPPQQQRRRSSSTTTUUUVVVWWWXXXYYYZZZ[[[\\\]]]^^^___```aaabbbcccdddeeefffggghhhiiijjjkkklllmmmnnnooopppqqqrrrssstttuuuvvvwwwxxxyyyzzz{{{|||}}}~~~€€€‚‚‚ƒƒƒ„„„………†††‡‡‡ˆˆˆ‰‰‰ŠŠŠ‹‹‹ŒŒŒŽŽŽ‘‘‘’’’“““”””•••–––———˜˜˜™™™ššš›››œœœžžžŸŸŸ   ¡¡¡¢¢¢£££¤¤¤¥¥¥¦¦¦§§§¨¨¨©©©ªªª«««¬¬¬­­­®®®¯¯¯°°°±±±²²²³³³´´´µµµ¶¶¶···¸¸¸¹¹¹ººº»»»¼¼¼½½½¾¾¾¿¿¿ÀÀÀÁÁÁÂÂÂÃÃÃÄÄÄÅÅÅÆÆÆÇÇÇÈÈÈÉÉÉÊÊÊËËËÌÌÌÍÍÍÎÎÎÏÏÏÐÐÐÑÑÑÒÒÒÓÓÓÔÔÔÕÕÕÖÖÖ×××ØØØÙÙÙÚÚÚÛÛÛÜÜÜÝÝÝÞÞÞßßßàààáááâââãããäääåååæææçççèèèéééêêêëëëìììíííîîîïïïðððñññòòòóóóôôôõõõööö÷÷÷øøøùùùúúúûûûüüüýýýþþþÿÿÿ,ddþÿ H°`A5*\È°¡Ã‡#*Tc°¢Å‹‡IÜȱ£ÇÃ0Š¼hå£É“(­Œ\ù¯Ê—0;öay1¦Í›i$…³§Ï„¤tþkò³(Î&4a]jÆJ¢L£¾DŠ‘§Ô«'ƒÖÄÊõãÖ®`9VtÉÕ‹¿•vºÎ,ˆuŽÐÁ°,µÕÛŠRUŒ:âîEwQj\ͯH KCþcÊÏðÈ0K.Ýçx¥ £’‹&«Ì2HÑjàL³h蟤u†=y)5M<«½êôW‚á’·±;fQ QN9¹7Ò\'¶tðˆÆ‹¯<ÑËXbî0ÞJv&“SWøÜäîÛ¹þ/? >üòÑo_ +¥zê+¸oþüÈóGÖO¸2A~‘ûÙàH_vøY‚ +ö„À{ ÚÏJÑD¸àHþYØÓ=jxÒw+‰âáMv8bz,½qbL¼­xR-ºøQ :a £I¡èDÅ5FÓ<¢H“Ar„…P7¹Q=BA dD0 +õdD•5Ï”9 5–9'\6dNô„ÙÐ[;š©Rª©"BçfB›é8gB…é樴yg:Ás§x,Y3(4•sèpjwgŒwŠBÓ'‹ +è¤Ûap)nûµ)¦ð} +*s¢Žœ ¥:JÝ,©š[«p®zt‹°êwE8Õj«M™ñªk7õJë¯åúÏ`ÃkÐMŠ-V©pÑõìCzí5íC‘uíBk±µíB_m[Õ·Z]Õ³T‰¤T¥N±tîé²dÕœåúifeÚNÙmeÒY­kȺØlª³*HÑ]; \ No newline at end of file diff -Naur mxml-2.6/doc/3.gif mxml-2.6-haiku/doc/3.gif --- mxml-2.6/doc/3.gif 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/3.gif 2007-04-26 22:21:37.000000000 +0000 @@ -0,0 +1,6 @@ +GIF89addç + + +  !!!"""###$$$%%%&&&'''((()))***+++,,,---...///000111222333444555666777888999:::;;;<<<===>>>???@@@AAABBBCCCDDDEEEFFFGGGHHHIIIJJJKKKLLLMMMNNNOOOPPPQQQRRRSSSTTTUUUVVVWWWXXXYYYZZZ[[[\\\]]]^^^___```aaabbbcccdddeeefffggghhhiiijjjkkklllmmmnnnooopppqqqrrrssstttuuuvvvwwwxxxyyyzzz{{{|||}}}~~~€€€‚‚‚ƒƒƒ„„„………†††‡‡‡ˆˆˆ‰‰‰ŠŠŠ‹‹‹ŒŒŒŽŽŽ‘‘‘’’’“““”””•••–––———˜˜˜™™™ššš›››œœœžžžŸŸŸ   ¡¡¡¢¢¢£££¤¤¤¥¥¥¦¦¦§§§¨¨¨©©©ªªª«««¬¬¬­­­®®®¯¯¯°°°±±±²²²³³³´´´µµµ¶¶¶···¸¸¸¹¹¹ººº»»»¼¼¼½½½¾¾¾¿¿¿ÀÀÀÁÁÁÂÂÂÃÃÃÄÄÄÅÅÅÆÆÆÇÇÇÈÈÈÉÉÉÊÊÊËËËÌÌÌÍÍÍÎÎÎÏÏÏÐÐÐÑÑÑÒÒÒÓÓÓÔÔÔÕÕÕÖÖÖ×××ØØØÙÙÙÚÚÚÛÛÛÜÜÜÝÝÝÞÞÞßßßàààáááâââãããäääåååæææçççèèèéééêêêëëëìììíííîîîïïïðððñññòòòóóóôôôõõõööö÷÷÷øøøùùùúúúûûûüüüýýýþþþÿÿÿ,ddþÿ H°`A5*\È°¡Ã‡#*Tc°¢Å‹‡IÜȱ£ÇÃ0Š¼hå£É“(­Œ\ù¯Ê—0;öay1¦Í›i$…³§Ï„¤tþkò³(Î&4a]jÆJ¢L£¾DŠ‘§Ô«'ƒÖÄÊõãÖ®búUÎ^»g¨€UXÑ%V]4ûÕà:³àUDB ÚÃZ°$SGy-JU9)‚ÀñD¨Ñ(Ä"ï1 ùoi(È+™ +4ºóÊ~K7ÿ¼à™e*£ÿþ,MÓ¨jŸåX·^{R6Í´?*Ó™À¡(¡¹=Ò¬ QgðŽ,‘³$~<âï‘':F`É«yÄä±[w¸rÊÇ9Ú·þ3Ìl2¼x¶#k“?¿p}öôìÛÃ÷ê>~}ŽæÙß߸’_|©$¬ÆQͳ=å‡ NѬÄÜ‚>™  „0=1!…(Ñ4†19ðŠN,pXdˆ8b`&ª'”.)ª¨Ó$-ž˜—1*‡˜?5òç9æT=rÇA.„ÀxCË V$G…Ï“i “Tâ7[–Å]È¥B®TÈ—]HfB.xy¦šd²ù¥›`ÁÙœ\Ñ)ß|çÙ‰žâ陟‹™Ñ€j&æIþºÔ=v¦¨QC°4æ{#AAàp6 +zœNOè¸e|'UÂCô‚¶·` ©²´…‘­Ž¤‡±b$b¨µDäO¯ùdF®=èEK=,n¨U¶”¹*Õ>©*hcLAÀš1WQ¦¬TØ€| äV IJ’87€EXagÊ([írT—]ñjYQ½eVd¾ iuTü*D•HJ|€S,\ïÀ,íÛ®¿ª®‰¼TÎëÙ¸=®kµ-j l¯RX@; \ No newline at end of file diff -Naur mxml-2.6/doc/4.gif mxml-2.6-haiku/doc/4.gif --- mxml-2.6/doc/4.gif 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/4.gif 2007-04-26 22:21:37.000000000 +0000 @@ -0,0 +1,6 @@ +GIF89addç + + +  !!!"""###$$$%%%&&&'''((()))***+++,,,---...///000111222333444555666777888999:::;;;<<<===>>>???@@@AAABBBCCCDDDEEEFFFGGGHHHIIIJJJKKKLLLMMMNNNOOOPPPQQQRRRSSSTTTUUUVVVWWWXXXYYYZZZ[[[\\\]]]^^^___```aaabbbcccdddeeefffggghhhiiijjjkkklllmmmnnnooopppqqqrrrssstttuuuvvvwwwxxxyyyzzz{{{|||}}}~~~€€€‚‚‚ƒƒƒ„„„………†††‡‡‡ˆˆˆ‰‰‰ŠŠŠ‹‹‹ŒŒŒŽŽŽ‘‘‘’’’“““”””•••–––———˜˜˜™™™ššš›››œœœžžžŸŸŸ   ¡¡¡¢¢¢£££¤¤¤¥¥¥¦¦¦§§§¨¨¨©©©ªªª«««¬¬¬­­­®®®¯¯¯°°°±±±²²²³³³´´´µµµ¶¶¶···¸¸¸¹¹¹ººº»»»¼¼¼½½½¾¾¾¿¿¿ÀÀÀÁÁÁÂÂÂÃÃÃÄÄÄÅÅÅÆÆÆÇÇÇÈÈÈÉÉÉÊÊÊËËËÌÌÌÍÍÍÎÎÎÏÏÏÐÐÐÑÑÑÒÒÒÓÓÓÔÔÔÕÕÕÖÖÖ×××ØØØÙÙÙÚÚÚÛÛÛÜÜÜÝÝÝÞÞÞßßßàààáááâââãããäääåååæææçççèèèéééêêêëëëìììíííîîîïïïðððñññòòòóóóôôôõõõööö÷÷÷øøøùùùúúúûûûüüüýýýþþþÿÿÿ,ddþÿ H°`A5*\È°¡Ã‡#*Tc°¢Å‹‡IÜȱ£ÇÃ0Š¼hå£É“(­Œ\ù¯Ê—0;öay1¦Í›i$…³§Ï„¤tþkò³(Î&4a]jÆJ¢L£¾DŠ‘§Ô«'ƒÖÄÊõãÖ®`9Vt¶lÄ™Í2¤HÓhÁ’j +5ªr`\…é溨ñ.¡ÿ–† |÷`Â{ S9ÌT`áÈ‹þCwd¦”ãBŽ\øçfÎqùZ2éÒ=—}úåjÖ­MbœÆ2vÌ ¯´ #Ý#y£´•¸Há'‹WŽ\ìÅ\rw7ç‚yíé1ŽXx;ÄPÌ—þõî0¼x‹äú»¨©a÷ô +-˜?_>CŒÊK·`ÑÅ|½ß| H>í‘Ó~é9@` ’‡Ñ8]µ#‘…Í=]péÁsQÙEØ\~xœ„ãUh¢p`\´MGÚ–"w/ÚFÎE@xT#jµ¸aŽ­Ýx‘¥-qQ_>"š‘G‚ˆÜkTÂfV•¯¡†åjZn¹Y—^2VZ˜—I&``žÙ–™j®ùd›nvgœü-(e²9‰g€zîé^Ÿ~âxg %J¨‹†Êg¢ŠþÉh£‚®©’•›•þDQl?ÆäX‘€&g¥Zöö“o>Ó`£NŠè?Kp¹êQ]vÉÚ$AdÙ*Zié:d}¾.Z‘UÁ.¤ÕEP{U")U¬S,%k+³,ëê±zMºZ®„òºZ¬xÒŠ%ªé±ªæ¥¼±X@; \ No newline at end of file diff -Naur mxml-2.6/doc/5.gif mxml-2.6-haiku/doc/5.gif --- mxml-2.6/doc/5.gif 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/5.gif 2007-04-26 22:21:37.000000000 +0000 @@ -0,0 +1,5 @@ +GIF89addç  +  + +    ! "! #"!$#"%$#&%#'&$'&$('%)(&*)'+*(,+)-,*.-,0/-10.21/320431542653665886997::8;;9<<:=<;>==@?>A@?BA@CBADCBEDCFEDGFEHGFIHHKJILKJMLKNMLONNQPORQPSRQTSRUTSUUTVVUWWVXXWYYY[[Z\\[]]\^^]__^``_a``baacbbdcbedcfedgfehgfihgjihkjilkjmlknmlonmponqporqpsrqtsrttsuutvvuwwvxxwyyxzzy{{z||{}}|~~}~€€€‚‚ƒƒ‚„ƒƒ…„„†……‡††ˆ‡ˆŠ‰‰‹ŠŠŒ‹‹ŒŒŽŽŽ‘’‘’“““””•–––———˜˜˜™™™ššš››œžžžŸŸŸ   ¡¡¡¢¢¡££¢¤¤£¥¥¤¦¦¥§¦¦¨§§©¨¨ª©©«ªª¬««­¬¬®­­¯®®°¯¯±°°²±±²²²³³³´´´µµµ¶¶¶···¸¸¸¹¹¹ººº»»»¼¼¼½½½¾¾¾¿¿¿ÀÀÀÁÁÁÂÂÂÃÃÃÄÄÄÅÅÅÆÆÆÇÇÇÈÈÈÉÉÊËÊËÌËÌÍÌÍÎÍÎÏÎÏÐÏÐÑÐÑÑÑÒÒÒÓÓÓÔÔÔÕÕÕÖÖÖ×××ØØØÙÙÙÚÚÚÛÛÛÜÜÜÝÝÝÞÞÞßßßààààáááââãäääåååææçèèèéééêêêëëëìììíííîíîïîïðïðððñññòòòóóóôôôõõõööö÷÷÷øøøùùùúúúûûûüüüýýýþþþÿÿÿ,ddþé H°`A1*\È°¡Ã‡#*c°¢Å‹sIÜȱ£G¹0Š¼øä£É“(ŸŒ\IÏÊ—0;Úay1¦Í›iÔ„³§Ï„štÒ3ò³(N#4U]jSÅJ¢L£¾DŠ‘§Ô«'ƒÖÄÊõãÖ®`9Vt¶lÄ™"ÊV`Ï‚%‹új˶§ÊKéÖ}+P£Q½B}†¤Ç°ÎŸnóf‰˜°Q‹û¤‡Ð(©È+Vþ‹y¤Y”=6ZähÒ¥¿žÞh!µêÕa„mÖ4í°¶owÍ­+ÆU½¹À¸#8Ö9³_=—\yTÞÎ9¿ŽÞØ"·†^äU´&„ºGŒlþÚ ùÇ{D,Ð6˜y‡Ïf—ŒãýB×ÃÙOˆßàþþþ½`€Ô1`A¢xWË@ƒ*ÇÖ*9°€©´Ct4­Q69Ç’  “Ê¡°R ß±r›ŒôÍGÐ$¡hIÃ’zûÅÄR‚=Âdc/ ‘ e†d’8.é•’N>Ùd”bAIe•S^Ñ‘ZJÄe—9Y d–i¦™2 ÝjóäJY|¹Ú-+Í¡&F¤ô††œÀRš· À§—ƒžÆ']¶’:ÆÑ”@GiШn¡Ð”ÂFÚv#M==@?>A@?BA@CBADCBEDCFEDGFEHGFIHGJIHKJILKJMLKNMLONMPONQPORQPSRQTSRUTSUUTVVUWWVXXWYYXZZY[[Z\\[]]\^^]__^``_a``baacbbdcbedcfedgfehgfihgjihkjilkjmlknmlonmponqporqpsrqtsrttsuutvvuwwvxxwyyxzzy{{{}}|~~~€€€‚‚ƒƒ‚„ƒƒ…„„†……‡††ˆ‡‡‰ˆˆŠ‰‰‹ŠŠŒ‹‹ŒŒŽŽ‘’‘‘“’’“““”””•••–––———˜˜˜™™™ššš›››œœœžžžŸŸ ¡¡¡¢¢¡££¢¤¤£¥¥¤¦¦¥§¦¦¨§§©¨¨ª©©«ªª¬««­¬¬®­­¯®®°¯¯±°°²±±²²²³³³´´´µµµ¶¶¶···¸¸¸¹¹¹ººº»»»¼¼¼½½½¾¾¾¿¿¿ÀÀÀÁÁÁÂÂÂÃÃÃÄÄÅÆÆÇÈÈÈÉÉÉÊÊÊËÊËÌËÌÍÌÍÎÍÎÏÎÏÐÏÐÑÐÑÑÑÒÒÒÓÓÓÔÔÔÕÕÕÖÖÖ×××ØØØÙÙÙÚÚÚÛÛÛÜÜÜÝÝÝÞÞÞßßßààààáááâââãããäääåååæææçççèèèéééêêêëëëìììíííîíîïîïðïðððñññòòòóóóôôôõõõööö÷÷÷øøøùùùúúúûûûüüüýýýþþþÿÿÿ,ddþó H°`A3*\È°¡Ã‡#*4c°¢Å‹{IÜȱ£G½0Š¼(å£É“(¥Œ\™/Ê—0;æay1¦Í›iô„³§Ï„žtæCò³(N$4U]jSÅJ¢L£¾DŠ‘§Ô«'ƒÖÄÊõãÖ® s0R6n¶R[€­è¬Ö‘é\Y°k +¡YI-Xòª¼1U9«8À™Ô¸ñÅFCæ“*À±ÈF6¶Œ1BQÍŠ9üŒp©è•ø~–6 +éôJ`aºf¥ÎRuÖ6YµD*, íöÈG8´‡s\iøJåÍ=÷:zÄ•WL®ÑÕ-Æ=IÊñ£YõñK¡V$çÈQ%’R({äTœ-s¤2K"ÇìPÉÂÚ¬gÛ¬1g ,ñlþRLðµéÞG`; \ No newline at end of file diff -Naur mxml-2.6/doc/7.gif mxml-2.6-haiku/doc/7.gif --- mxml-2.6/doc/7.gif 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/7.gif 2007-04-26 22:21:37.000000000 +0000 @@ -0,0 +1,8 @@ +GIF89addç  +  + +    ! #"!$#"%$#&%#'&$'&$('%)(&*)'+*)-,*.-+/.,0/-10.21/320431542653664775886997::8;;9<<:=<;>==@?>A@ADCBEDFIHGJIHKJILKKNMLONMPONQPORQPSRQTSRUTSUUUWWWYYXZZY[[[]]\^^]__^``_a`acbbdcbedehgfihgjihkjilkjmlknmlonorqpsrqtsrttsuutvvuwwvxxwyyxzzy{{{}}|~~}~€€€‚‚‚„ƒƒ…„„†……‡††ˆ‡ˆŠ‰ŠŒ‹‹ŒŽ’‘’““”•••––˜™™™ššš›››œœœžžŸ   ¡¡¡¢¢£¥¥¥§¦¦¨§§©¨¨ª©©«ªª¬««­¬­¯®®°¯¯±°°²±²³³µ¶¶·¸¸¸¹¹¹ººº»»»¼¼½¾¾¿ÀÀÀÁÁÂÃÃÃÄÄÄÅÅÅÆÆÆÇÇÈÉÉÊËÊËÌËÌÍÌÍÎÍÎÏÎÏÐÏÐÑÐÑÑÑÒÒÒÓÓÓÔÔÔÕÕÕÖÖÖ×××ØØØÙÙÙÚÚÚÛÛÛÜÜÜÝÝÝÞÞÞßßßààààáááâââãããääåæææçççèèèéééêêêëëìíííîíîïîðððòòòóóóôôôõõõööö÷÷÷øøøùùùúúúûûûüüüýýýþþþÿÿÿ,ddþ£ H°`Á+*\È°¡Ã‡#*¼b°¢Å‹3IÜȱ£G™0Š¼ˆä£É“(‘Œ\ Ê—0;¢ay1¦Í›i„³§Ï„ƒtFûñ³(Î4Q]jÅJ¢L£¾DŠ‘§Ô«'ƒÖÄÊõãÖ®`9Vt¶lÄ™m +]KfÁ’1ÙÊ SåÀ›sóVŒ+P£Z½€Æ  gàÀ Ö›ïâ¼j:~,צäɔך}˜¹òæ†Ù~Zçè°V*8 våÖ]Wö‚ÍÕØJÚX·ÜÆ-5õȼ¥®ì<ê®Ýņ@ž¼èÊÍ6É,zQÌ­+éA»Ïc#þyï)!ûx·#yœ¿ Éüú“îß{ùJ>Ìò#í£ÉF?Ê#ñù'ÑJDh’]t8ŸHB(è:Hva… +%3-nta‡`|ˆáJCt8`~&B¤‰ˆ®¤TŠœ¡cCŒ°(áJ\ÌèòÀ£‚ÏühàJ`è8!FF2dƒÚ¤,%¹ÐJ‰H©ÐJ9X ÀOê÷I—öE©¥˜V’)¥™£]ÆT +hnFÑU}´i–`RA#gYtFÕk} w'X„¦eDÁ5hCæy蔑µhBh¥õhB_ZÕ¢Z]••T‰ôb’N±´éŒ²dŒ™ +£^Ž:©^†ú—èa~Éhij&G[; \ No newline at end of file diff -Naur mxml-2.6/doc/8.gif mxml-2.6-haiku/doc/8.gif --- mxml-2.6/doc/8.gif 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/8.gif 2007-04-26 22:21:37.000000000 +0000 @@ -0,0 +1,7 @@ +GIF89addç  +  + +    ! "! #"!$#"%$#&%#'&$'&$('%)(&*)'+*(,+)-,*.-+/.,0/-10.21/320431542653664775886997::8;;9<<:=<;>==@?>A@?BA@CBADCBEDCFEDGFEHGFIHGJIHKJILKJMLKNMLONMPONQPORQPSRQTSRUTSUUTVVUWWVXXXZZY[[Z\\[]]\^^]__^``_a``baacbbdcbedcfedgfehgfihgjihkjilkjmlknmlonmponqporqpsrqtsrttsuutvvuwwvxxwyyxzzy{{z||{}}|~~}~€€€‚‚ƒƒ‚„ƒƒ…„„†……‡††ˆ‡‡‰ˆˆŠ‰‰‹ŠŠŒ‹‹ŒŒŽŽŽ‘’‘‘“’’“““”””•••–––———˜˜˜™™™ššš›››œœœžžžŸŸŸ   ¡¡¡¢¢¡££¢¤¤£¥¥¥§¦¦¨§§©¨¨ª©ª¬««­¬¬®­­¯®¯±°°²±±²²²³³³´´´µµµ¶¶¶···¸¸¸¹¹¹ººº»»»¼¼¼½½½¾¾¾¿¿¿ÀÀÀÁÁÁÂÂÂÃÃÃÄÄÄÅÅÅÆÆÆÇÇÇÈÈÈÉÉÉÊÊÊËÊËÌËÌÍÌÍÎÍÎÏÎÏÐÏÐÑÐÑÑÑÒÒÒÓÓÓÔÔÔÕÕÕÖÖÖ×××ØØØÙÙÙÚÚÚÛÛÛÜÜÜÝÝÝÞÞÞßßßààààáááâââãããäääåååæææçççèèèéééêêêëëëìììíííîíîïîïðïðððñññòòòóóóôôôõõõööö÷÷÷øøøùùùúúúûûûüüüýýýþþþÿÿÿ,ddþù H°`A3*\È°¡Ã‡#*4c°¢Å‹}IÜȱ£G¾0Š¼8å£É“(§Œ\ÉOÊ—0;êay1¦Í›i…³§Ï„¢tòKò³(Î$4W]jsÅJ¢L£¾DŠ‘§Ô«'ƒÖÄÊõãÖ® yT +ö-Þ7Ym€MXÑ%Öâh¢á:³ VhB R¸Z°dTvy+:ˆªr`TŠ-Ò‹:PãÒz‰EX’ÓÈ+5,¸óJF9õL34ŸH—þyú§jš”ÖžÔ÷zµl:M= 0æ¨Û…±,ÆÑ6ðˆ,kxl·òøÆ•`L®Ôäâ†æ'±Wo¨iä”òFþnwÈL„ÂŽ-Ö#DáÙÈÀS›HBTî4Ùq %PY-Mú ¥Að Y×ŃãBÒU4Ý2£NHãJp˜ KútD†qðñ)Q,¥`0,Ô›ŒÛ±´„~+MÖ'¢61ðõ±Ò5/ P¨z,ÅùÒ¦ãʨˆ²‰š¤À™š!…Ω:!©åk¹ú¬`ÉÚ‘­¥®”…{¨ÞægG=àºÖ"ÂæTl­+ÙsR ,¥øèJ:¬*ÒwðÙC“³ö +œ¦4}²Ñ:9k_^v<C^B@&F娸îW¾k8r ï@ã yǽ–ÕšOŠÈkEKAf”¡õkTZªq™ÂKŲ£T9U8ª=UeGµo`ÜpE_\ÏJˆ€U˜aW&L[-÷T—]1÷oÍŸ^dÎ(iuT<Ä&FJÝ‘S,m4DC¯´óÒ ù,ÔSbóÒ3{F2Î+×fñ•ù/‡ˆå; \ No newline at end of file diff -Naur mxml-2.6/doc/9.gif mxml-2.6-haiku/doc/9.gif --- mxml-2.6/doc/9.gif 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/9.gif 2007-04-26 22:21:37.000000000 +0000 @@ -0,0 +1,6 @@ +GIF89addç  +  + +    ! "! #"!$#"%$#&%#'&$'&$('%)(&*)'+*(,+)-,*.-+/.,0/-10.21/320431542653664775886997::8;;9<<:=<;>==@?>A@?BA@CBADCCFEDGFEHGFIHGJIHKJILKKNMLONMPONQPORQPSRQTSRUTSUUTVVUWWVXXWYYXZZY[[Z\\[]]\^^]__^``_a``baacbbdcbedcfedgfehgfihgjihkjilkjmlknmlonmponqporqpsrqtsrttsuutvvuwwvxxwyyxzzy{{z||{}}|~~}~€€€‚‚ƒƒ‚„ƒƒ…„„†……‡††ˆ‡‡‰ˆˆŠ‰‰‹ŠŠŒ‹‹ŒŒŽŽ‘’‘‘“’’“““”””•••–––———˜˜˜™™™ššš›››œœœžžžŸŸ ¡¡¡¢¢¡££¢¤¤£¥¥¤¦¦¥§¦¦¨§§©¨¨ª©©«ªª¬««­¬¬®­­¯®®°¯¯±°°²±±²²²³³³´´´µµµ¶¶¶···¸¸¸¹¹¹ººº»»»¼¼¼½½½¾¾¾¿¿¿ÀÀÀÁÁÁÂÂÂÃÃÃÄÄÄÅÅÅÆÆÆÇÇÇÈÈÈÉÉÉÊÊÊËÊËÌËÌÍÌÍÎÍÎÏÎÏÐÏÐÑÐÑÑÑÒÒÒÓÓÓÔÔÔÕÕÕÖÖÖ×××ØØØÙÙÙÚÚÚÛÛÛÜÜÜÝÝÝÞÞÞßßßààààáááâââãããäääåååæææçççèèèéééêêêëëëìììíííîíîïîïðïðððñññòòòóóóôôôõõõööö÷÷÷øøøùùùúúúûûûüüüýýýþþþÿÿÿ,ddþù H°`Á2*\È°¡Ã‡#*,c°¢Å‹}IÜȱ£G¾0Š¼å£É“(£Œ\É/Ê—0;æay1¦Í›iü„³§Ï„Ÿtò;ò³(Î#4W]jsÅJ¢L£¾DŠ‘§Ô«'ƒÖÄÊõãÖ®~Xb–Ž]5MHÀ.¬è«)–˜ÀÎ,xU‡Ð¸,É4Ã]ƒXUŒzïoE5Wj\jø¢;©!ù-eÐX¤TF TsÑÍ#á1å‡ð'è•|––ö‰ëôJµ0]³„}Rg;‡tZ¡í•e‚ˆhòîÈn6G–|‡GdyÀ£qåA¬ ÷ñÍkèé]ï-òv‡Ï=þεüáÊ(·—O¨ž;F¨ë´÷˜oä»õ ;Íïxh¿òhþmÔC€¼ÅC`D›> +>¤ÙH àçMƒ°’ø CaCg¬ ~lÈ4áa‡ƒˆk•ˆÝJ¤§"t+åsÂá÷¢D:á€=+=ó‘9â§K8¤76t—ŽìCÓ!ð“ èDC6%“²m©£] +ÅdB †™äŠf¢–ir6fBzÈ6Fò¼©~ 1ÀJªØ©›Ý·çHWø©P­£ÐJEªPw­6(yŽ.äKÇ(éf¥ ñME±à jrêP&¥šjÞHŒ¨jÓJá¸Sª²Ð­²–‰Q/câ’˯À lm#ÅÊd9(r‚kT¥0êÞE¢éÃJûÐçì›,)µÑ-g¢¹ÒÃÒ~Š£“¨ YW£ŸmZdˆ£íVÄi¼=Àé1ôòÓŒªùJ%iOñú+™Qm&60Á]Þƒ•gK)âzñ³SøTvW‘U5w £AÉI%@.#B›`ƒÕê“Am©lÓœ)»<«E2Çv‘U5¤ÕEðå¼U"iësDN±ÔóÐ ÍÎH+´³˜M³WYË9ÃÜXȵ¢,ÛĪfÜî¿LRôW@; \ No newline at end of file diff -Naur mxml-2.6/doc/A.gif mxml-2.6-haiku/doc/A.gif --- mxml-2.6/doc/A.gif 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/A.gif 2007-04-26 22:21:37.000000000 +0000 @@ -0,0 +1,6 @@ +GIF89addç  +  + +   ! "! #""%$#&%$'&$('%)(&*)'+*)-,*.-,0/-10.21/320431542653664775887::8;;9<<:=<;>==@?>A@?BA@CBADCBEDCFEDGFEHGFIHGJIHKJJMLKNMLONMPONQPPSRQTSRUTSUUTVVUWWVXXWYYY[[Z\\]__^``_a``babdcbedehgfihhkjknmmponqporqqtstvvuwwvxxwyyxzzz|||~~}~€€€‚‚‚„ƒƒ…„„†……‡††ˆ‡‡‰ˆˆŠ‰‰‹ŠŠŒ‹ŒŽŽŽ‘’‘‘“’’“““”””•••–––———˜˜˜™™™ššš››œžŸŸŸ   ¡¡¡££¢¤¤£¥¥¤¦¦¦¨§§©¨ª¬««­¬­¯®®°¯¯±°°²±³´´µ¶¶¶···¸¸¸¹¹¹ºº»¼¼¼½½½¾¾¾¿¿¿ÀÀÀÁÁÂÃÃÃÄÄÅÆÆÇÈÈÈÉÉÉÊÊËÌËÌÍÌÎÏÎÏÐÏÐÑÐÑÑÑÒÒÒÔÔÔÕÕÕÖÖÖ×××ØØØÙÙÙÚÚÚÛÛÛÜÜÜÝÝÝÞÞÞßßßààààáááâââãããäääåååæææçççèèéêêêëëëìììíííîíïðïðððñññóóóôôôõõõööö÷÷÷øøøùùùúúúûûûüüüýýýþþþÿÿÿ,ddþ¥ H°`Á+*\È°¡Ã‡#*¼b°¢Å‹9IÜȱ£Gœ0Š¼¨ä£É“(•Œ\)m Ê—0;Žay1¦Í›i4„³§Ï„†tJ ò³(Î 4K]j³ÄJ¢L£¾DŠ‘§Ô«'ƒÖÄÊõãÖ®`9VtÉU(×™»~Ú¢,Á’nÍbU9¬P]jäšè®´"\CJ³ëw°[Â~óÆÚª°4,eÆ-ÌU2VŽñ†½Ê,³46›¥zÖÚ¨ÓÑ¥—ŽH(uÑÕ¤]ß„{±l›µ¥]º}“e,–¼cÒY +ðà/YÀ²r”ǯ|nRñ„ÆW îQ¹B–¸þsÌ>r!¬ãâ#[ùj!y‘ÒGô¾¥3ù+ Wx~:þ†,¹ÒÐ{yðCô!¸ß<,¨Ð+ÊàC^Tà %`„Ü­åßC~ˆ_sUh‘jèMÿ!ÂáB®¼‰™XQ#®´ÜF,¦×˜ˆýX^z,±Ò‘Õ!f@JÔ#u5¤Œ©ù’)B T®ØeXOzÄÊ—ˆå&”'ÈÑffb3®é׎·¹é—-¼Í!'›²Ýé—qê)”1²Yç§\U*Ô©aihEѤ¶Þ¢: +iR¡Q0)¡eŠ$€Oa*&%L4ýVƒ+íò“^EÓ¦?¥*™­^±DEW^°”‹QF¸ªK¬¾+n¿ÆºX¹¸.L©ùiD–uDœFé +E&I‹M~Äúј+ÑÖn(ìHÐ—{mÄä¹=ÑIG‚ÙÑ2,Õ‚Uá~7\2EW]ý2eYÿ„VZ·jQÂí^dÃ0iuTŸD•HJUüÑiOiÜÑÅ,=ìñCc:r}™|òÁžñ[ñ¿µ¥[p¼w6+E~; \ No newline at end of file diff -Naur mxml-2.6/doc/B.gif mxml-2.6-haiku/doc/B.gif --- mxml-2.6/doc/B.gif 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/B.gif 2007-04-26 22:21:37.000000000 +0000 @@ -0,0 +1,4 @@ +GIF89addç  +  + +    ! #"!$#"%$#&%#'&$'&%)(&*)'+*(,+)-,*.-+/.,0/-10.21/320431542653664775886997::8;;9<<:=<;>==@??BA@CBADCBEDCFEDGFFIHGJIHKJJMLKNMLONMPONQPORQPSRQTSRUTSUUTVVUWWVXXWYYXZZY[[Z\\[]]\^^]__^``_a`acbbdcbeddgfehggjihkjilkjmlknmlonmponqporqpsrqtssuutvvuwwvxxwyyxzzy{{z||{}}|~~}€‚‚ƒƒ‚„ƒƒ…„„†……‡†‡‰ˆˆŠ‰‰‹ŠŠŒ‹ŒŽŽ‘’‘‘“’’“““”””••–———˜˜˜™™š››œžžžŸŸ ¡¡¡¢¢¡££¢¤¤£¥¥¤¦¦¦¨§§©¨¨ª©©«ªª¬««­¬¬®­­¯®®°¯¯±°±²²²³³³´´´µµµ¶¶·¸¸¸¹¹¹ººº»»»¼¼¼½½½¾¾¾¿¿¿ÀÀÀÁÁÁÂÂÂÃÃÃÄÄÄÅÅÅÆÆÆÇÇÇÈÈÈÉÉËÌËÌÍÌÍÎÍÎÏÎÏÐÏÐÑÐÑÑÑÒÒÒÓÓÓÔÔÔÕÕÕÖÖÖ×××ØØØÙÙÙÚÚÚÜÜÜÝÝÝßßßààààáááâââãããäääåååæææçççèèèéééêêêëëëìììíííîíîïîïðïðððñññòòòóóóôôôõõõööö÷÷÷øøøùùùúúúûûûüüüýýýþþþÿÿÿ,ddþÑ H°`Á/*\È°¡Ã‡#*üb°¢Å‹]IÜȱ£G®0Š¼èä£É“(Œ\‰NÊ—0;Êay1¦Í›i”„³§Ï„’t¢#ò³(N"4S]j3ÅJ¢L£¾DŠ‘§Ô«'ƒÖÄÊõãÖ®`9VtiR¨Ù‚¤0YåÙ· -Xò$Ü»üT9ð%Þ¿ß~Ôèöïß=C¢ƒiØð…ž7þ»gd¿“ÿZFˆ93Þ›œ;{†Ë(lÃÑšM/Dw˜j…4?ÈÅÔÛ× cÃì!tnÝ1ƒéüͧ0঑ÇT–ùK>Å_;‘øJŸÑUO/<ÒzwÈ×¥þg¿9>ìv“nV’ó.üÈÊâÃÛ´UÞ|ý“¹XFÀ àüÆ49Ã_÷A4ÀMˆbÖ€²¶ ƒ>a„,Ià lŽtÄ…fø‡ zX æ&âEДxb{®(Ò º(ÒÊxTìÙhPüùç1ÔŽ„Úø64•“ã‡0 @Óñ}g™‘Rùè‘TFe¥G,uR¤|8y‘åR[r fWev4æ\kzu&WiŠõ&VqnÔ¦`wª9çUuFÄIžîI9åžU%}Ú”hC9ÐtÇ—‚Â4Êp²¢BE©£E2hº©AK~*P ¡ŠÚ£¨ žŠê@ð•jc z8…fתètëbÔmŠ®Ümª ž’é¨ ›„Í*ã K)ÆkY"~BŸÕU¢i|õ5mr‘u-Wlµµ-œ} ­EV‰k”V7š[U")¥.NN±„ã»S U.½&¡›)¾nÂ¥-¿u‹—´/TídŬ¬ƒ²nKÑY; \ No newline at end of file diff -Naur mxml-2.6/doc/C.gif mxml-2.6-haiku/doc/C.gif --- mxml-2.6/doc/C.gif 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/C.gif 2007-04-26 22:21:37.000000000 +0000 @@ -0,0 +1,9 @@ +GIF89addç  +  + +    ! "! #"!$#"%$#&%#'&$'&$('%)(&*)'+*(,+)-,*.-+/.,0/-10.21/320431542653664775886997::8;;9<<:=<;>==@?>A@?BA@CBADCBEDCFEDGFEHGFIHGJIHKJILKJMLKNMLONMPONQPQTSRUTSUUTVVUWWVXXWYYXZZY[[Z\\[]]\^^]__^``_a``baacbbdccfedgfehgfihgjihkjilkjmlknmlonmponqporqpsrqtsrttsuutvvuwwvxxwyyxzzy{{z||{}}|~~}~€€€‚‚ƒƒ‚„ƒƒ…„„†……‡†ˆŠ‰‰‹ŠŠŒ‹‹ŒŒŽŽŽ‘’‘‘“’’“““”””•••–––———˜˜˜™™™ššš›››œœœžžžŸŸŸ   ¡¡¡¢¢¡££¢¤¤£¥¥¤¦¦¥§¦¦¨§§©¨¨ª©©«ªª¬««­¬­¯®®°¯¯±°°²±±²²²³³³´´µ¶¶¶···¸¸¸¹¹¹ººº»»»¼¼¼½½½¾¾¾¿¿¿ÀÀÀÁÁÁÂÂÂÃÃÃÄÄÄÅÅÅÆÆÆÇÇÇÈÈÈÉÉÉÊÊÊËÊËÌËÌÍÌÍÎÍÎÏÎÏÐÏÐÑÐÑÑÑÒÒÒÓÓÓÔÔÔÕÕÕÖÖÖ×××ØØØÙÙÙÚÚÚÛÛÛÜÜÜÝÝÝÞÞÞßßßààààáááâââãããäääåååæææçççèèèéééêêêëëëìììíííîíîïîïðïðððñññòòòóóóôôôõõõööö÷÷÷øøøùùùúúúûûûüüüýýýþþþÿÿÿ,ddþó H°`A2*\È°¡Ã‡#*$c°¢Å‹wIÜȱ£G»0Š¼å£É“(£Œ\™Ê—0;âay1¦Í›iô„³§Ï„žtæKò³(Î$4W]jsÅJ¢L£¾DŠ‘§Ô«'ƒÖÄÊõãV®ˆhvpµ¢K©<„üÂtfA©âÔb`´`É¥òä®$ëSåÀ¥¨ôÒ”÷s Æ¢‚Õšè2_Q$‰åë)ðgàÈrñá¬Ü³æÄ7ó!ÄéêsbÍ1Gß¼b:²³®´Æ öÃÈìè舰`Fv m3§wÊF:z…+, —ÃG(jù +W›í¥Zå/„f‰)T¹Ð!¡iþæ±=Aç)Ê4mwï)(=lˆYÂÖC3UQcò»Â¯»²…~–Â,ÅÒ\µà#ÑÁÕ9*÷K‹88]~>¸R…°áÐ †R]ÂÒ2rEKZ„ˆÕ†& +HaŠL¡Èba+¾ß…2ªHc3Ž„#‚:îã>ncÜ I¤uFyƒ+¡¤M‡°Ë“1à"•]‰%GZn)Mf0ÕÌJ·pEL—EŽô W   Kkü·Ò%6ŠäWûýÔH’KAÓ9Š¤ž›±@¨OîäÞJÓLÈ!8ýBŽ²$„M>(Ú•l:‰Ó:aã Zè Ìz£ªUbG6ÈU!!®z%DÜ’†³a ‡¹Ç!s½^—b +ÁêD‹5»Ò8©†ÓÊb”C³Ž­@ ·T8× +„š¶Kµ­ +ñ¶”ÁÞaTcÕFuBk/´8Ð]W­!ØvQùõ—mG#R((È9ÐY^ÞäÖ[/jPÂiVdÃ&iuTwD•HJU¼‘S,Q¬±C³ôðÇ IŒ*ÉDFpÅGFoÁú¶f.•ì*ëlÉ; \ No newline at end of file diff -Naur mxml-2.6/doc/D.gif mxml-2.6-haiku/doc/D.gif --- mxml-2.6/doc/D.gif 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/D.gif 2007-04-26 22:21:37.000000000 +0000 @@ -0,0 +1,8 @@ +GIF89addç  +  + +    ! "! #"!$#"%$#&%#'&$'&$('%)(&*)'+*(,+)-,*.--10.21/320432653664776997::8;;9<<:=<=@?>A@?BA@CBADCBEDCFEDGFEHGFIHGJIHKJILKJMLKNMLONMPONQPORQPSRQTSRUTTVVUWWVXXWYYXZZY[[Z\\[]]\^^]___a``baacbbdcbedcfedgfehgfihgjihkjilkjmlknmlonmponqporqpsrqtsrttsuutvvuwwwyyxzzy{{z|||~~}~€€ƒƒ‚„ƒƒ…„…‡††ˆ‡‡‰ˆˆŠ‰‰‹ŠŠŒ‹‹ŒŒŽŽŽ‘’‘’“““”””•••––—˜˜™ššš›››œœœžžžŸŸŸ   ¡¡¡¢¢¡£££¥¥¤¦¦¥§¦¦¨§§©¨¨ª©©«ªª¬««­¬¬®­­¯®®°¯¯±°°²±±²²³´´´µµµ¶¶¶···¸¸¸¹¹¹ººº»»»¼¼¼½½½¾¾¾¿¿¿ÀÀÁÂÂÂÃÃÃÄÄÄÅÅÅÆÆÆÇÇÇÈÈÈÉÉÉÊÊÊËÊËÌËÌÍÌÍÎÍÎÏÎÏÐÏÐÑÐÑÑÑÒÒÒÓÓÓÔÔÔÕÕÕ×××ÙÙÙÚÚÚÛÛÛÜÜÜÝÝÝÞÞÞààààáááâââãããäääåååæææçççèèèéééêêêëëëìììíííîíîïîïðïðððñññòòòóóóôôôõõõööö÷÷÷øøøùùùúúúûûûüüüýýýþþþÿÿÿ,ddþ× H°`Á/*\È°¡Ã‡#*üb°¢Å‹aIÜȱ£G°0Š¼Èä£É“(™Œ\¹.Ê—0;Æay1¦Í›iœ„³§Ï„“t®ò³(Î!4S]j3ÅJ¢L£¾DŠ‘§Ô«'ƒÖÄÊõãÖ®`9VtéU¨ÙuäÆ`YðäÙ·5D-XÒ$Ü»ë +-U9%^¼TŒÔèö/Þ¢!×½4ü7ÀO‹ã-à²_ɇ{®CxóÝžœ;{†Öáh¼J3šblâÉEgÆ=žW|ÊjEh<¢UŒÚCZDi(¦MOyÇ#Õ.V¯nɪ5 +×®O¾‚m"vì’²fçMMëmZ·f᎕ –nW»Zñ^ÕK•¯H¿¡~*¸ÊÍÂF#&¢x±ÆŽ!/¾#¤ckp¨hŒçñ¸É1[æÌŒØhÐo”‰ötÙs7Zlïìâ»jRµß¬b•û3íÞ¬­XÎEÓHÄ£P£(ùGl;W²œÍðéÆMp wîÝ·`§ÝÌtWÕì*O¤r*; \ No newline at end of file diff -Naur mxml-2.6/doc/F.gif mxml-2.6-haiku/doc/F.gif --- mxml-2.6/doc/F.gif 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/F.gif 2007-04-26 22:21:37.000000000 +0000 @@ -0,0 +1 @@ +GIF89add¥  $'&&*)-100437:::=F *tœÄ¢ E"ÝVr)S”Nƒ}Œ*ê(Õ.D¯f¥º5jW§_—†E:¶hY¡g¦Í¸ÖbÛ‰o!Æm8Wa݃wi‹8"•¤MÕòä«”íàR}é¦F8°Åb‡±Z…;DÖU;¸r]¶c„Ôf4ªb~–jdtã=¦»hº)5Jb¹vâˆMëÙI`³±„{µ ܵ + + +

3More Mini-XML +Programming Techniques

+ +

This chapter shows additional ways to use the Mini-XML +library in your programs.

+ +

Load Callbacks

+ +

Chapter 2 introduced the mxmlLoadFile() and mxmlLoadString() functions. +The last argument to these functions is a callback function +which is used to determine the value type of each data node in +an XML document.

+ +

Mini-XML defines several standard callbacks for simple +XML data files:

+ +
    + +
  • MXML_INTEGER_CALLBACK - All data nodes + contain whitespace-separated integers.
    • + +
  • MXML_OPAQUE_CALLBACK - All data nodes + contain opaque strings ("CDATA").
    • + +
  • MXML_REAL_CALLBACK - All data nodes contain + whitespace-separated floating-point numbers.
    • + +
  • MXML_TEXT_CALLBACK - All data nodes contain + whitespace-separated strings.
    • + +
+ +

You can provide your own callback functions for more complex +XML documents. Your callback function will receive a pointer to +the current element node and must return the value type of the +immediate children for that element node: MXML_INTEGER, +MXML_OPAQUE, MXML_REAL, or MXML_TEXT. +The function is called after the element and its +attributes have been read, so you can look at the element name, +attributes, and attribute values to determine the proper value +type to return.

+ + +

The following callback function looks for an attribute named +"type" or the element name to determine the value type for its +child nodes:

+ +
+    mxml_type_t
+    type_cb(mxml_node_t *node)
+    {
+      const char *type;
+
+     /*
+      * You can lookup attributes and/or use the
+      * element name, hierarchy, etc...
+      */
+
+      type = mxmlElementGetAttr(node, "type");
+      if (type == NULL)
+	type = node->value.element.name;
+
+      if (!strcmp(type, "integer"))
+	return (MXML_INTEGER);
+      else if (!strcmp(type, "opaque"))
+	return (MXML_OPAQUE);
+      else if (!strcmp(type, "real"))
+	return (MXML_REAL);
+      else
+	return (MXML_TEXT);
+    }
+
+ +

To use this callback function, simply use the name when you +call any of the load functions:

+ +
+    FILE *fp;
+    mxml_node_t *tree;
+
+    fp = fopen("filename.xml", "r");
+    tree = mxmlLoadFile(NULL, fp, type_cb);
+    fclose(fp);
+
+ + +

Save Callbacks

+ +

Chapter 2 also introduced the mxmlSaveFile(), mxmlSaveString(), and mxmlSaveAllocString() +functions. The last argument to these functions is a callback +function which is used to automatically insert whitespace in an +XML document.

+ +

Your callback function will be called up to four times for +each element node with a pointer to the node and a "where" value +of MXML_WS_BEFORE_OPEN, MXML_WS_AFTER_OPEN, +MXML_WS_BEFORE_CLOSE, or MXML_WS_AFTER_CLOSE. +The callback function should return NULL if no +whitespace should be added and the string to insert (spaces, +tabs, carriage returns, and newlines) otherwise.

+ +

The following whitespace callback can be used to add +whitespace to XHTML output to make it more readable in a standard +text editor:

+ +
+    const char *
+    whitespace_cb(mxml_node_t *node,
+                  int where)
+    {
+      const char *name;
+
+     /*
+      * We can conditionally break to a new line
+      * before or after any element. These are
+      * just common HTML elements...
+      */
+
+      name = node->value.element.name;
+
+      if (!strcmp(name, "html") ||
+          !strcmp(name, "head") ||
+          !strcmp(name, "body") ||
+	  !strcmp(name, "pre") ||
+          !strcmp(name, "p") ||
+	  !strcmp(name, "h1") ||
+          !strcmp(name, "h2") ||
+          !strcmp(name, "h3") ||
+	  !strcmp(name, "h4") ||
+          !strcmp(name, "h5") ||
+          !strcmp(name, "h6"))
+      {
+       /*
+	* Newlines before open and after
+        * close...
+	*/
+
+	if (where == MXML_WS_BEFORE_OPEN ||
+            where == MXML_WS_AFTER_CLOSE)
+	  return ("\n");
+      }
+      else if (!strcmp(name, "dl") ||
+               !strcmp(name, "ol") ||
+               !strcmp(name, "ul"))
+      {
+       /*
+	* Put a newline before and after list
+        * elements...
+	*/
+
+	return ("\n");
+      }
+      else if (!strcmp(name, "dd") ||
+               !strcmp(name, "dt") ||
+               !strcmp(name, "li"))
+      {
+       /*
+	* Put a tab before <li>'s, * <dd>'s,
+        * and <dt>'s, and a newline after them...
+	*/
+
+	if (where == MXML_WS_BEFORE_OPEN)
+	  return ("\t");
+	else if (where == MXML_WS_AFTER_CLOSE)
+	  return ("\n");
+      }
+
+     /*
+      * Return NULL for no added whitespace...
+      */
+
+      return (NULL);
+    }
+
+ +

To use this callback function, simply use the name when you +call any of the save functions:

+ +
+    FILE *fp;
+    mxml_node_t *tree;
+
+    fp = fopen("filename.xml", "w");
+    mxmlSaveFile(tree, fp, whitespace_cb);
+    fclose(fp);
+
+ + + +

Custom Data Types

+ +

Mini-XML supports custom data types via global load and save +callbacks. Only a single set of callbacks can be active at any +time, however your callbacks can store additional information in +order to support multiple custom data types as needed. The +MXML_CUSTOM node type identifies custom data nodes.

+ +

The load callback receives a pointer to the current data node +and a string of opaque character data from the XML source with +character entities converted to the corresponding UTF-8 +characters. For example, if we wanted to support a custom +date/time type whose value is encoded as "yyyy-mm-ddThh:mm:ssZ" +(ISO format), the load callback would look like the +following:

+ +
+    typedef struct
+    {
+      unsigned      year,    /* Year */
+                    month,   /* Month */
+                    day,     /* Day */
+                    hour,    /* Hour */
+                    minute,  /* Minute */
+                    second;  /* Second */
+      time_t        unix;    /* UNIX time */
+    } iso_date_time_t;
+
+    int
+    load_custom(mxml_node_t *node,
+                const char *data)
+    {
+      iso_date_time_t *dt;
+      struct tm tmdata;
+
+     /*
+      * Allocate data structure...
+      */
+
+      dt = calloc(1, sizeof(iso_date_time_t));
+
+     /*
+      * Try reading 6 unsigned integers from the
+      * data string...
+      */
+
+      if (sscanf(data, "%u-%u-%uT%u:%u:%uZ",
+                 &(dt->year), &(dt->month),
+                 &(dt->day), &(dt->hour),
+                 &(dt->minute),
+                 &(dt->second)) != 6)
+      {
+       /*
+        * Unable to read numbers, free the data
+        * structure and return an error...
+        */
+
+        free(dt);
+
+        return (-1);
+      }
+
+     /*
+      * Range check values...
+      */
+
+      if (dt->month < 1 || dt->month > 12 ||
+          dt->day < 1 || dt->day > 31 ||
+          dt->hour < 0 || dt->hour > 23 ||
+          dt->minute < 0 || dt->minute > 59 ||
+          dt->second < 0 || dt->second > 59)
+      {
+       /*
+        * Date information is out of range...
+        */
+
+        free(dt);
+
+        return (-1);
+      }
+
+     /*
+      * Convert ISO time to UNIX time in
+      * seconds...
+      */
+
+      tmdata.tm_year = dt->year - 1900;
+      tmdata.tm_mon  = dt->month - 1;
+      tmdata.tm_day  = dt->day;
+      tmdata.tm_hour = dt->hour;
+      tmdata.tm_min  = dt->minute;
+      tmdata.tm_sec  = dt->second;
+
+      dt->unix = gmtime(&tmdata);
+
+     /*
+      * Assign custom node data and destroy
+      * function pointers...
+      */
+
+      node->value.custom.data    = dt;
+      node->value.custom.destroy = free;
+
+     /*
+      * Return with no errors...
+      */
+
+      return (0);
+    }
+
+ +

The function itself can return 0 on success or -1 if it is +unable to decode the custom data or the data contains an error. +Custom data nodes contain a void pointer to the +allocated custom data for the node and a pointer to a destructor +function which will free the custom data when the node is +deleted.

+ +

The save callback receives the node pointer and returns an +allocated string containing the custom data value. The following +save callback could be used for our ISO date/time type:

+ +
+    char *
+    save_custom(mxml_node_t *node)
+    {
+      char data[255];
+      iso_date_time_t *dt;
+
+
+      dt = (iso_date_time_t *)node->custom.data;
+
+      snprintf(data, sizeof(data),
+               "%04u-%02u-%02uT%02u:%02u:%02uZ",
+               dt->year, dt->month, dt->day,
+               dt->hour, dt->minute, dt->second);
+
+      return (strdup(data));
+    }
+
+ +

You register the callback functions using the mxmlSetCustomHandlers() +function:

+ +
+    mxmlSetCustomHandlers(load_custom,
+                          save_custom);
+
+ + + +

Changing Node Values

+ +

All of the examples so far have concentrated on creating and +loading new XML data nodes. Many applications, however, need to +manipulate or change the nodes during their operation, so +Mini-XML provides functions to change node values safely and +without leaking memory.

+ +

Existing nodes can be changed using the mxmlSetElement(), mxmlSetInteger(), mxmlSetOpaque(), mxmlSetReal(), mxmlSetText(), and mxmlSetTextf() functions. For +example, use the following function call to change a text node +to contain the text "new" with leading whitespace:

+ +
+    mxml_node_t *node;
+
+    mxmlSetText(node, 1, "new");
+
+ + +

Formatted Text

+ +

The mxmlNewTextf() and mxmlSetTextf() functions create +and change text nodes, respectively, using printf-style +format strings and arguments. For example, use the following +function call to create a new text node containing a constructed +filename:

+ +
+    mxml_node_t *node;
+
+    node = mxmlNewTextf(node, 1, "%s/%s",
+                        path, filename);
+
+ + +

Indexing

+ +

Mini-XML provides functions for managing indices of nodes. +The current implementation provides the same functionality as +mxmlFindElement(). +The advantage of using an index is that searching and +enumeration of elements is significantly faster. The only +disadvantage is that each index is a static snapshot of the XML +document, so indices are not well suited to XML data that is +updated more often than it is searched. The overhead of creating +an index is approximately equal to walking the XML document +tree. Nodes in the index are sorted by element name and +attribute value.

+ +

Indices are stored in mxml_index_t structures. The +mxmlIndexNew() function +creates a new index:

+ +
+    mxml_node_t *tree;
+    mxml_index_t *ind;
+
+    ind = mxmlIndexNew(tree, "element",
+                       "attribute");
+
+ +

The first argument is the XML node tree to index. Normally this +will be a pointer to the ?xml element.

+ +

The second argument contains the element to index; passing +NULL indexes all element nodes alphabetically.

+ +

The third argument contains the attribute to index; passing +NULL causes only the element name to be indexed.

+ +

Once the index is created, the mxmlIndexEnum(), mxmlIndexFind(), and mxmlIndexReset() functions +are used to access the nodes in the index. The mxmlIndexReset() function +resets the "current" node pointer in the index, allowing you to +do new searches and enumerations on the same index. Typically +you will call this function prior to your calls to mxmlIndexEnum() and mxmlIndexFind().

+ +

The mxmlIndexEnum() +function enumerates each of the nodes in the index and can be +used in a loop as follows:

+ +
+    mxml_node_t *node;
+
+    mxmlIndexReset(ind);
+
+    while ((node = mxmlIndexEnum(ind)) != NULL)
+    {
+      // do something with node
+    }
+
+ +

The mxmlIndexFind() +function locates the next occurrence of the named element and +attribute value in the index. It can be used to find all +matching elements in an index, as follows:

+ +
+    mxml_node_t *node;
+
+    mxmlIndexReset(ind);
+
+    while ((node = mxmlIndexFind(ind, "element",
+                                 "attr-value"))
+                != NULL)
+    {
+      // do something with node
+    }
+
+ +

The second and third arguments represent the element name and +attribute value, respectively. A NULL pointer is used +to return all elements or attributes in the index. Passing +NULL for both the element name and attribute value +is equivalent to calling mxmlIndexEnum.

+ +

When you are done using the index, delete it using the +mxmlIndexDelete() +function:

+ +
+    mxmlIndexDelete(ind);
+
+ +

SAX (Stream) Loading of Documents

+ +

Mini-XML supports an implementation of the Simple API for XML +(SAX) which allows you to load and process an XML document as a +stream of nodes. Aside from allowing you to process XML documents of +any size, the Mini-XML implementation also allows you to retain +portions of the document in memory for later processing.

+ +

The mxmlSAXLoadFd, mxmlSAXLoadFile, and mxmlSAXLoadString functions +provide the SAX loading APIs. Each function works like the +corresponding mxmlLoad function but uses a callback to +process each node as it is read.

+ +

The callback function receives the node, an event code, and +a user data pointer you supply:

+ +
+    void
+    sax_cb(mxml_node_t *node,
+           mxml_sax_event_t event,
+           void *data)
+    {
+      ... do something ...
+    }
+
+ +

The event will be one of the following:

+ +
    + +
  • MXML_SAX_CDATA - CDATA was just read
    • + +
  • MXML_SAX_COMMENT - A comment was just read
    • + +
  • MXML_SAX_DATA - Data (custom, integer, opaque, real, or text) was just read
    • + +
  • MXML_SAX_DIRECTIVE - A processing directive was just read
    • + +
  • MXML_SAX_ELEMENT_CLOSE - A close element was just read (</element>)
    • + +
  • MXML_SAX_ELEMENT_OPEN - An open element was just read (<element>)
    • + +
+ +

Elements are released after the close element is +processed. All other nodes are released after they are processed. +The SAX callback can retain the node using the mxmlRetain function. For example, +the following SAX callback will retain all nodes, effectively +simulating a normal in-memory load:

+ +
+    void
+    sax_cb(mxml_node_t *node,
+           mxml_sax_event_t event,
+           void *data)
+    {
+      if (event != MXML_SAX_ELEMENT_CLOSE)
+        mxmlRetain(node);
+    }
+
+ +

More typically the SAX callback will only retain a small portion +of the document that is needed for post-processing. For example, the +following SAX callback will retain the title and headings in an +XHTML file. It also retains the (parent) elements like <html>, <head>, and <body>, and processing +directives like <?xml ... ?> and <!DOCTYPE ... >:

+ + +
+    void
+    sax_cb(mxml_node_t *node,
+           mxml_sax_event_t event,
+           void *data)
+    {
+      if (event == MXML_SAX_ELEMENT_OPEN)
+      {
+       /*
+        * Retain headings and titles...
+        */
+
+        char *name = node->value.element.name;
+
+        if (!strcmp(name, "html") ||
+            !strcmp(name, "head") ||
+            !strcmp(name, "title") ||
+            !strcmp(name, "body") ||
+            !strcmp(name, "h1") ||
+            !strcmp(name, "h2") ||
+            !strcmp(name, "h3") ||
+            !strcmp(name, "h4") ||
+            !strcmp(name, "h5") ||
+            !strcmp(name, "h6"))
+          mxmlRetain(node);
+      }
+      else if (event == MXML_SAX_DIRECTIVE)
+        mxmlRetain(node);
+      else if (event == MXML_SAX_DATA &&
+               node->parent->ref_count > 1)
+      {
+       /*
+        * If the parent was retained, then retain
+        * this data node as well.
+        */
+
+        mxmlRetain(node);
+      }
+    }
+
+ +

The resulting skeleton document tree can then be searched just +like one loaded using the mxmlLoad functions. For example, +a filter that reads an XHTML document from stdin and then shows the +title and headings in the document would look like:

+ +
+    mxml_node_t *doc, *title, *body, *heading;
+
+    doc = mxmlSAXLoadFd(NULL, 0,
+                        MXML_TEXT_CALLBACK,
+                        sax_cb, NULL);
+
+    title = mxmlFindElement(doc, doc, "title",
+                            NULL, NULL,
+                            MXML_DESCEND);
+
+    if (title)
+      print_children(title);
+
+    body = mxmlFindElement(doc, doc, "body",
+                           NULL, NULL,
+                           MXML_DESCEND);
+
+    if (body)
+    {
+      for (heading = body->child;
+           heading;
+           heading = heading->next)
+        print_children(heading);
+    }
+
+ + + diff -Naur mxml-2.6/doc/basics.html mxml-2.6-haiku/doc/basics.html --- mxml-2.6/doc/basics.html 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/basics.html 2007-04-26 22:21:37.000000000 +0000 @@ -0,0 +1,526 @@ + + + +

2Getting Started +with Mini-XML

+ +

This chapter describes how to write programs that use Mini-XML to +access data in an XML file. Mini-XML provides the following +functionality:

+ +
    + +
  • Functions for creating and managing XML documents + in memory.
    • + +
  • Reading of UTF-8 and UTF-16 encoded XML files and + strings.
    • + +
  • Writing of UTF-8 encoded XML files and strings.
    • + +
  • Support for arbitrary element names, attributes, and + attribute values with no preset limits, just available + memory.
    • + +
  • Support for integer, real, opaque ("cdata"), and text + data types in "leaf" nodes.
    • + +
  • "Find", "index", and "walk" functions for easily + accessing data in an XML document.
    • + +
+ +

Mini-XML doesn't do validation or other types of processing +on the data based upon schema files or other sources of +definition information, nor does it support character entities +other than those required by the XML specification.

+ + +

The Basics

+ +

Mini-XML provides a single header file which you include:

+ +
+    #include <mxml.h>
+
+ +

The Mini-XML library is included with your program using the +-lmxml option:

+ +
+    gcc -o myprogram myprogram.c -lmxml ENTER
+
+ +

If you have the pkg-config(1) software installed, +you can use it to determine the proper compiler and linker options +for your installation:

+ +
+    pkg-config --cflags mxml ENTER
+    pkg-config --libs mxml ENTER
+
+ +

Nodes

+ +

Every piece of information in an XML file (elements, text, +numbers) is stored in memory in "nodes". Nodes are defined by +the mxml_node_t +structure. The type member +defines the node type (element, integer, opaque, real, or text) +which determines which value you want to look at in the value union.

+ + +
+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
Table 2-1: Mini-XML Node Value Members
ValueTypeNode member
Customvoid *node->value.custom.data
Elementchar *node->value.element.name
Integerintnode->value.integer
Opaque (string)char *node->value.opaque
Realdoublenode->value.real
Textchar *node->value.text.string
+ +

Each node also has a user_data member which allows you +to associate application-specific data with each node as needed.

+ +

New nodes are created using the mxmlNewElement, mxmlNewInteger, mxmlNewOpaque, mxmlNewReal, mxmlNewText mxmlNewTextf mxmlNewXML functions. Only +elements can have child nodes, and the top node must be an element, +usually the <?xml version="1.0"?> node created by +mxmlNewXML().

+ +

Nodes have pointers to the node above (parent), below +(child), left (prev), and right (next) +of the current node. If you have an XML file like the following:

+ +
+    <?xml version="1.0"?>
+    <data>
+        <node>val1</node>
+        <node>val2</node>
+        <node>val3</node>
+        <group>
+            <node>val4</node>
+            <node>val5</node>
+            <node>val6</node>
+        </group>
+        <node>val7</node>
+        <node>val8</node>
+    </data>
+
+ +

the node tree for the file would look like the following in +memory:

+ +
+    ?xml
+      |
+    data
+      |
+    node - node - node - group - node - node
+      |      |      |      |       |      |
+    val1   val2   val3     |     val7   val8
+                           |
+                         node - node - node
+                           |      |      |
+                         val4   val5   val6
+
+ +

where "-" is a pointer to the next node and "|" is a pointer +to the first child node.

+ +

Once you are done with the XML data, use the mxmlDelete function to recursively +free the memory that is used for a particular node or the entire +tree:

+ +
+    mxmlDelete(tree);
+
+ + +

Creating XML Documents

+ +

You can create and update XML documents in memory using the +various mxmlNew functions. The following code will +create the XML document described in the previous section:

+ +
+    mxml_node_t *xml;    /* <?xml ... ?> */
+    mxml_node_t *data;   /* <data> */
+    mxml_node_t *node;   /* <node> */
+    mxml_node_t *group;  /* <group> */
+
+    xml = mxmlNewXML("1.0");
+
+    data = mxmlNewElement(xml, "data");
+
+        node = mxmlNewElement(data, "node");
+        mxmlNewText(node, 0, "val1");
+        node = mxmlNewElement(data, "node");
+        mxmlNewText(node, 0, "val2");
+        node = mxmlNewElement(data, "node");
+        mxmlNewText(node, 0, "val3");
+
+        group = mxmlNewElement(data, "group");
+
+            node = mxmlNewElement(group, "node");
+            mxmlNewText(node, 0, "val4");
+            node = mxmlNewElement(group, "node");
+            mxmlNewText(node, 0, "val5");
+            node = mxmlNewElement(group, "node");
+            mxmlNewText(node, 0, "val6");
+
+        node = mxmlNewElement(data, "node");
+        mxmlNewText(node, 0, "val7");
+        node = mxmlNewElement(data, "node");
+        mxmlNewText(node, 0, "val8");
+
+ +

We start by creating the <?xml version="1.0"?> +node common to all XML files using the mxmlNewXML function:

+ +
+    xml = mxmlNewXML("1.0");
+
+ +

We then create the <data> node used for this +document using the mxmlNewElement function. The +first argument specifies the parent node (xml) while the +second specifies the element name (data):

+ +
+    data = mxmlNewElement(xml, "data");
+
+ +

Each <node>...</node> in the file is +created using the mxmlNewElement and mxmlNewText functions. The first +argument of mxmlNewText specifies the parent node +(node). The second argument specifies whether whitespace +appears before the text - 0 or false in this case. The last +argument specifies the actual text to add:

+ +
+    node = mxmlNewElement(data, "node");
+    mxmlNewText(node, 0, "val1");
+
+ +

The resulting in-memory XML document can then be saved or +processed just like one loaded from disk or a string.

+ + +

Loading XML

+ +

You load an XML file using the mxmlLoadFile +function:

+ +
+    FILE *fp;
+    mxml_node_t *tree;
+
+    fp = fopen("filename.xml", "r");
+    tree = mxmlLoadFile(NULL, fp,
+                        MXML_TEXT_CALLBACK);
+    fclose(fp);
+
+ +

The first argument specifies an existing XML parent node, if +any. Normally you will pass NULL for this argument +unless you are combining multiple XML sources. The XML file must +contain a complete XML document including the ?xml +element if the parent node is NULL.

+ +

The second argument specifies the stdio file to read from, as +opened by fopen() or popen(). You can also use +stdin if you are implementing an XML filter +program.

+ +

The third argument specifies a callback function which returns +the value type of the immediate children for a new element node: +MXML_CUSTOM, MXML_IGNORE, +MXML_INTEGER, MXML_OPAQUE, MXML_REAL, +or MXML_TEXT. Load callbacks are described in detail in +Chapter 3. The example code uses +the MXML_TEXT_CALLBACK constant which specifies that all +data nodes in the document contain whitespace-separated text +values. Other standard callbacks include +MXML_IGNORE_CALLBACK, MXML_INTEGER_CALLBACK, +MXML_OPAQUE_CALLBACK, and +MXML_REAL_CALLBACK.

+ +

The mxmlLoadString +function loads XML node trees from a string:

+ + +
+    char buffer[8192];
+    mxml_node_t *tree;
+
+    ...
+    tree = mxmlLoadString(NULL, buffer,
+                          MXML_TEXT_CALLBACK);
+
+ +

The first and third arguments are the same as used for +mxmlLoadFile(). The second argument specifies the +string or character buffer to load and must be a complete XML +document including the ?xml element if the parent node +is NULL.

+ + + +

Saving XML

+ +

You save an XML file using the mxmlSaveFile function:

+ +
+    FILE *fp;
+    mxml_node_t *tree;
+
+    fp = fopen("filename.xml", "w");
+    mxmlSaveFile(tree, fp, MXML_NO_CALLBACK);
+    fclose(fp);
+
+ +

The first argument is the XML node tree to save. It should +normally be a pointer to the top-level ?xml node in +your XML document.

+ +

The second argument is the stdio file to write to, as opened +by fopen() or popen(). You can also use +stdout if you are implementing an XML filter +program.

+ +

The third argument is the whitespace callback to use when +saving the file. Whitespace callbacks are covered in detail in Chapter 3. The previous example code +uses the MXML_NO_CALLBACK constant to specify that no +special whitespace handling is required.

+ +

The mxmlSaveAllocString, +and mxmlSaveString +functions save XML node trees to strings:

+ +
+    char buffer[8192];
+    char *ptr;
+    mxml_node_t *tree;
+
+    ...
+    mxmlSaveString(tree, buffer, sizeof(buffer),
+                   MXML_NO_CALLBACK);
+
+    ...
+    ptr = mxmlSaveAllocString(tree, MXML_NO_CALLBACK);
+
+ +

The first and last arguments are the same as used for +mxmlSaveFile(). The mxmlSaveString function +takes pointer and size arguments for saving the XML document to +a fixed-size buffer, while mxmlSaveAllocString() +returns a string buffer that was allocated using +malloc().

+ +

Controlling Line Wrapping

+ +

When saving XML documents, Mini-XML normally wraps output +lines at column 75 so that the text is readable in terminal +windows. The mxmlSetWrapMargin function +overrides the default wrap margin:

+ +
+    /* Set the margin to 132 columns */
+    mxmlSetWrapMargin(132);
+
+    /* Disable wrapping */
+    mxmlSetWrapMargin(0);
+
+ + + +

Finding and Iterating Nodes

+ +

The mxmlWalkPrev +and mxmlWalkNextfunctions +can be used to iterate through the XML node tree:

+ +
+    mxml_node_t *node;
+    
+    node = mxmlWalkPrev(current, tree,
+                        MXML_DESCEND);
+
+    node = mxmlWalkNext(current, tree,
+                        MXML_DESCEND);
+
+ +

In addition, you can find a named element/node using the mxmlFindElement +function:

+ +
+    mxml_node_t *node;
+    
+    node = mxmlFindElement(tree, tree, "name",
+                           "attr", "value",
+                           MXML_DESCEND);
+
+ +

The name, attr, and value +arguments can be passed as NULL to act as wildcards, +e.g.:

+ + +
+    /* Find the first "a" element */
+    node = mxmlFindElement(tree, tree, "a",
+                           NULL, NULL,
+                           MXML_DESCEND);
+
+ +
+    /* Find the first "a" element with "href"
+       attribute */
+    node = mxmlFindElement(tree, tree, "a",
+                           "href", NULL,
+                           MXML_DESCEND);
+
+ +
+    /* Find the first "a" element with "href"
+       to a URL */
+    node = mxmlFindElement(tree, tree, "a",
+                           "href",
+                           "http://www.easysw.com/",
+                           MXML_DESCEND);
+
+ +
+    /* Find the first element with a "src"
+       attribute */
+    node = mxmlFindElement(tree, tree, NULL,
+                           "src", NULL,
+                           MXML_DESCEND);
+
+ +
+    /* Find the first element with a "src"
+       = "foo.jpg" */
+    node = mxmlFindElement(tree, tree, NULL,
+                           "src", "foo.jpg",
+                           MXML_DESCEND);
+
+ +

You can also iterate with the same function:

+ +
+    mxml_node_t *node;
+
+    for (node = mxmlFindElement(tree, tree,
+                                "name",
+                                NULL, NULL,
+                                MXML_DESCEND);
+         node != NULL;
+         node = mxmlFindElement(node, tree,
+                                "name",
+                                NULL, NULL,
+                                MXML_DESCEND))
+    {
+      ... do something ...
+    }
+
+ + +

The MXML_DESCEND argument can actually be one of +three constants:

+ +
    + +
  • MXML_NO_DESCEND means to not to look at any + child nodes in the element hierarchy, just look at + siblings at the same level or parent nodes until the top + node or top-of-tree is reached. + +

    The previous node from "group" would be the "node" + element to the left, while the next node from "group" would + be the "node" element to the right.

    • + +
  • MXML_DESCEND_FIRST means that it is OK to + descend to the first child of a node, but not to descend + further when searching. You'll normally use this when + iterating through direct children of a parent node, e.g. all + of the "node" and "group" elements under the "?xml" parent + node in the example above. + +

    This mode is only applicable to the search function; the + walk functions treat this as MXML_DESCEND since + every call is a first time.

    • + +
  • MXML_DESCEND means to keep descending until + you hit the bottom of the tree. The previous node from + "group" would be the "val3" node and the next node would + be the first node element under "group". + +

    If you were to walk from the root node "?xml" to the end + of the tree with mxmlWalkNext(), the order would + be:

    + +

    ?xml data node val1 node val2 node val3 group node + val4 node val5 node val6 node val7 node val8

    + +

    If you started at "val8" and walked using + mxmlWalkPrev(), the order would be reversed, + ending at "?xml".

    • + +
+ + + diff -Naur mxml-2.6/doc/chapters.xcf.gz mxml-2.6-haiku/doc/chapters.xcf.gz --- mxml-2.6/doc/chapters.xcf.gz 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/chapters.xcf.gz 2007-04-26 22:21:37.000000000 +0000 @@ -0,0 +1,26 @@ +‹µY x•Å¹ž“L˜IÈ ä„$'$8‚¶ÚÛZ)¸A±>UHB€”Å‚õ†VkÕkoëm+¹]½VPÛZm+¨m-VêÒ6t×.6¸`Ep’fîûÍr’ˆ}žÞ{ŸËó̼_þÿüËüïÌ7ï÷²º³ûòø–öUñUë:c±é®Ùt †®Mžu3cÔðoGË@+ö1ýn<à `Îjܶ¡}}wwGÏ&æORcùöLgwëꎆÕ:Wú“1Y·qÓÖuñΞM6v´oê\ß³1‘U·juûúuë7Äë,4lXÝÖoœÑhÿ½G0Ë \Úö—Îz÷O èÒ-/omïìYŸ[ßë ?Ö°¹§s^¾}M½õ–õ«VmìØyõ©‡Ü‘Ñ—²á±=ø¸3F¸Çõ2­‰Ž¤ù3c<†xÁG¦é_Öˆxìˆ8{Dœ3"Îó÷ú€1æ q.ðŸî9?/Å즎-›Öµníؘmª£cñʦJ¢s}ÂÅÝm›7Æ/jíÙÿHü¬õëV†s ;¯êˆ75ŽøJ©ÃîC]Þ¹¥c}ã5˜*ÄÆVûÅ[7oZOGŸ8׺®³u£ÿ{]kÏê͘sñÊŽžåK/¢ÇµµnìhXÙ¹Á͵øºMpð=cÖnÞ¸©sÕÖøºŽU›èy= a¾4Ì1œ¶õ[º×¯ìˆ¯ÜÚÓÚÝÙîÛÎÓ¿õ.òñÙÓ`bàGÅXzÅ•£ÏóÙhg¡]ˆÖ†ø5hŸÇ,Yÿ¬Þƒ™…<ö`÷ÈÍÛ–ûŸ°Ò7ƒÝ[Áêh =†ãã  Òƒ¶å33¢úwæÃfDû¿ý>]±(}zkaïˆ÷_÷ããÆ°f6TqùÞ· 7³Y¿ò #ÍL‰e˜±¦E%×39f‹jv½còL‚Eå}ʘZåÝôŽ)2SY[vØŒ7ÕLU>h&˜JXqÜ”˜)L~ÛL4q¦¦ÿÕ”™ +¦–œ0åf2ÓWšÉ¦œ©´Ï™ +Süª‰›‰Lžl¦˜RàvS Ô[L•)aú|Sm&05󰘩‚gÌT3¿ºÇÔõZSkÆ1Uõ&°‡dê€z™I˜B¦²ž·ˆGÖ›¦ò^±ˆ[O3ùLÉ-êf:Ác€<¦g˜‚›pN:ËX¥=ËÔž\–Ëô| +7Ç°¢õx”Ò—"³ë? Ô+)šDÑ Ï¼ o¤N§ðkxWub +R¿~¡¾Š¢:x8“¡ƒW"èz» b4uײ粧³êÚ¾»ô«gž?òê[o¾vôÅ?ÿòáïíºvÝy3rX‹vÜßûä‘Ÿ|aÍÁJY•<ùø¿ŸW€¤RkÕ½1¼à43ôì¿ÍŒa(3LôÛî|¤¬F½õ•zä´&£î‡åà/ +öïw@“uäËfúë G ÏÖ¿ h1ž«b¯cÙ©·2inŽ££?¤ós(ÚLÑEͧ¨›~¨³)¼¡þ†¦¿BÑ>Šî¡èKí§è“ý–¢6ŠþJÑ"ŠþNÑé½AQEïP§hˆ¢bŠ4E¹ˆ°r„î fa[ÖöQã«ez/¦`½ƒ: *vÄŒ3uL?ààF+|ØAƒƒ‰ +H鲌wPá`†ƒ…:\ïà^=þïõd÷R—8ØÀÄ•Ç-êóÜt~€I>ÓÍõÛXI¬,ˆô~‹z+ÖÖÉY +ˆu?âRð”—‚«Ù¬Î}ë 98ã—ƒßÿ,F,ÄÆ;‘{‹±M|p¾oJ›»ó0’S³z¾ý2²i:{#6&g\YÝ™í¾á»OGÈ–šQÙ!1œdætja&i†vco2H#Ç—Ç>æ"mT@ïÌ1Ñ+8À¨»'A·˜èäÍ%83)éú—i^¼ÌešÇNyŠïF.mÌìkÜÿ†ƒüÂÁ3Ž98îà¤=ê/O:øƒ¯9èup±ƒ&@QÑX‹ºß-Á/;¸€ÕŠL¨wkø“â,÷‡Ýª¿ kÔ c,êMXWHGs-ênÌq¤‘?±¨ÏEVKC.AæQ/‘‰ÔÙHA™tÿ‰HSê¾4 ÒÖ/³‘¯ÆþV‚4†´v¸iãQ5HsH~ÏMEÖC2üm9’ąç³),2}9R¯bÛbŸaú4$ÏH}. ‡ð‹?ÍÇ/ÒL¤oÊ°yS˜ì2æ±…¸õ¨,ëÃ,ñqM©L+ìz EïP”KÑqŠŠ):J}ý Es(úEçSôcŠ:)º›¢ë)úE÷Qô Š(ú8íÆù´/ è\ŠŠ)Ú‰HÅ^¥þŽ~øs:XM§o¥èŠVÑþ>F»z&>ò$Ę·éè´•â-pôÃõ"ROIqö<\Ÿ1jÜï5mÿaw„ÅÒÒy†ÈÊ-,©H4Ÿ½¤ó3·=þžPÄNƪ?öù_)¬Í6”÷±»Þ„d*cQn×ïüzþo쥵u;ç¸ÛíÎÅÚßv{eÓKn“¬ü³Û' ¸DXõ’MLjÁt]‚é. *öÖT=S“߀î›F †@e>kòÍt¦×XPY/C60}ƒ:À ¦Ÿ4¹W;h± Ò_‡¤œÉôOÜì ÃÁ9¦;(që ÃtPä ÂA£ƒ lvp«ƒƒ<7WYÄ#ìÛ|ÐÀÉ¢>Û½øwNµ¶¨¿„Ña°õß ¶ƒ¯gú£ø$ø4“_â‹eìǧ™„Æ`)\³â@Ý’îdÁ}™V¨}™N­¸?ÃI€]1·÷o¶ 0Ù쮬ÜmðVGжO Þ©²ÙFý †)WD‹‚@=•]:ÎèK,¨?¦Cw7z‰ƒÅFWAÒÓš!PÏÆ '=ÛÁ5~ (1zŠÛšønp°ß‚z-ÅXjôg:Xãà³¾âàûžpðŒƒÃ^qð¦å rð–ƒ×qðO:Øçà79èqpƒFÞWeZÄõv÷:èuð!€ ”ìG¸ÙÁBÀȵœ…$ð­÷¡9´ÞwSAp¸Œ +‚K¨dx’Ê•’âÇ +¨d¸u…ê/Ç÷F1Ó€$~.î¨ÄQ3ƒQ6‰Ž™eÆ#¹$ ,$y”dl9rOÛgKÕ¨qû*,T1Õ5…$[TÚOl²P¯#WA¸]jAžŽt‡Ò)³;:J©)/C¼¡´š÷¶Í'êŠ …W`"¥¿J’ÒRaÉI›bÔÙ¯¡|ƒ„¨yÊIõü{­Tb—:>û÷V£GâÚ!—ifüÔfTŠÏÚe^þw›T¢¬M/Øü¹´ß.Ë¡XË®ã¨=g±¡ìKî9‰r´™òÜmGL†iaƒiM¿{ÄÄÌéøaÕEײm|Û»DžŠ}Õ ªkÕðìاðld½´[ð.ÐIÅûI ÆKb~c %ßD¦Œ^]Ÿ……ö¾ŽáEÇ®¯À²Œ¦í¶¸j~ëg¿ÿšÙ–ñ¼:…LùÍlå=Ý"ª«zT­S=_v:çÕñNçôXe£žà@ä¶ÁéNÓü«Ó4?¥â™ðå2|rdFõA§fzœšAb´jæ{  õ'ÒɘŸå:ó£±NÆ ÁZs ©#ê +*â NŽœeõËÏÊ!VÔUéø ?üŸû(±÷™íÔ¿Ù#fD#kç"´g½Ÿ”@»b„Ý7×›’#ýá±gµ¶w­Þ°~sÏÊÿo2ü{/2møtñïßõšé8ö&c³¾ˆöM´ïŒ>?¡ƒ±òCŒM½&Å›ŒûU>ÃXÕhÿö ´o3V}ÚZ´+Ñ®AÛ¶‹±šçÐ^Eb¬ï–8—±†f´n´­ŒÍXFO»Ê öïZ“Ì3§™¡þí‹‹x:o2ÑÞ®j.x£‰öw•ò,Þ`¢£ÛyŸf¢þ5<#_ï_Ê y­Q^ÈÇñ©F=½œó*L¸«y ¯4êÎ^ÊãF½´œ—ñ +£î(åå|²Ñ]|2/Goá¼Ì¨Û2yœOD]Î+9rH¯âŒ:¾Ws¬­’|*Çjhä5ëg ×r,œyÇŠ9žä  ^Èëy]=çÓ½¦sˆþÛxÇéÏ´¨[ø žCÏŸÉ!òïàËã¥R‹z9ŸÅ³Œ¾“Ïæ¤õk,ê«y—F?Í› –„ÑòÓ.ŒÁþÍç,d @á-kXú]¶_cû¤íóЃӃ}] ŠˆÓƒ;/˜ Ó%8Ý×S+…§ô”Ë, Níl–9œìÊ”yœ>²LJpz`©'‰ÓVY,‰Ó^Y"ÁéÝõ²T‚Ó#­²L‚Ó=å²\‚Ó9Y‚ÓƒIY!Áéí92.Áé§e¥§+e•$NËj N/S%qÚ,k$q:KÖJpz¸YÖIâtLõbY/ èêi2Ÿî5]‚ÓÛeƒ§s,ꤜ!sèù3%8Ý#%8=RnQ·ÊYœÞ-gKâ´Þ¢î•M’8•Í­y@žF°2‘s–@æAÙBЧÇ2-êr.A3 ®˜GÐã ÷É$AƒZ@Œîv:ÁN8˜Pæ œ¾Ïö]¶_`û"ô´NûÖÎ/´ëtÇùÅ"]§Ý5Bâ´»Ld âtG“È´N×J‘',§¢P§KÄ8Aœ®ÅÂr*J8½+!JqºB” pº»L” pÚ-& Z§IQ!ˆÓlÄ©¨à´]T ât‘¨Äé|1U§M¢F§¢V§M¢N§óE¨‰zQ@WOÄ©˜.ˆSÑ hf[ÔI1CPQ.f +pº[4 +â´Ì¢^!f pz—˜-ˆÓ„EÝ+šq*š VˆSqÁq*æ,Ð:-kÄ©´¨wˆ¹MâTÌ#èvP NE’ ÛA €Ö©8`‡ƒó°NÅ|ô}¶_kûù¶/DbàÁ]W·-l©)ÍËäÛòNðõõ®\œ¬//Ê‘8 íöEÉDYa¶ÀÝ”£I4ç'2óJkZ¶]½ëÁHÀi|0/¹fW?*³F>T´x{¿É4Í<ªîÚ‹"ª…G¥]ûM:Å`ãö£Æ Dkúù¶Ü3y\žÈ)*¯O.^ÙÛ÷½—,ZÐÕGÕ^£špÁ΃t/Õöì£{ɨ¼çº—lÞyÌÌß(³ë Ä½d\œÈ.,K$µ‡{‰ÁÂùkûì{‰¡âówØ÷QM·½—ˆÊºí½Ä`ÓÜ ß-’kûî%¶ÅšZºŠ;ÆÕ…Bi§sµüi(ì ®®VÐÔc¸ª¹u»Äñ— ©3¹*½¢s,GÍ=ÉdsÕÒEšÃUæmPzy\oƒVÍçÐå%¦€«…Ç¡á +¹J¾‰[ÄUãï8®P†ŽÇß/`Å8Õê®Jèê|SJ÷Ê3¹¾ r{"§R Ç”qÔæ9¦œžŸm&q}ø$¼ÕK&ËLæz9 ‚ë;ñ *ðî +ª<ÎQÕK3…ë§ X¨äúQ|À…€*®÷Cµ–ª¹î7œ`•qp*×Û4jèŠ4‚.¥€Z®÷Bñ×ÒA Õ€:õc:Ôòh»ƒÅŠu\õÛ~—í×Ø>I½Î3–e;R-=@ìHÕjÙ‘ª×²#UýÝÄŽ!v¤*ßCìHÝCìH•Ø‘z±ƒ·:BìHÝJìH™`ïnÙ‘º—Ø‘Žú Ø‘ú±#ÁØ‘úbGêeÄŽÔ‰‰L 2-RïtÐLìÐi=ʉ‰Š4FÐã –Ø‘ÑA,°Zítpƒ €:©Ú¾Ïö]¶_@½.ÉŽPK,;B­°ìÏŽP‰»ˆ·ìU¶›Øº›Ø*i׎PÙ–áغØj‘eG¨ù–¡š,;‚ÖØÁß–œ·ì½ˆØ¡«ÁŽpìÇž`׎pìÐóÁŽÐ»‰¼•eGèÄŽÐw;xwËŽpìÇýìÇŽÐKˆáØŽáÖŽÐk-(iÙz‡ƒ&bG8vè=,”;±C-Ô;‚Ö6»h‡ƒóêÖõ}¶_kûùÔk2Áù®¤nuWS×FÝBêZ¨«¡®”º<ê°Iäôr= Hýu}ÔõR·’ºÅÔ%©«§®œº"ê°™äôJ= ýu}ÔõR×NÝ"ê’Ô%¨+£®:l:9½£6×ã½ Å1  (AJЀ4  (AJЀ4 „Pf¯Ç›AñaH R‚†” !%hH R‚†” !%hH ;¤Ì2Y/0¨ *AƒJР4¨ *AƒJР4¨ *a•YöO jT<ñXÄcË÷ÑË^JS\µ¤økKqº+Å31îzPëkF¨xRô^Þ‹}/ý©ðeÁp‘@%ƒ/ †Ë *.|©‘*<\âË_¤`ôà )OÍšdj&­LÍ®¾ÔŒ£¹çi§]#D+ X¯f‡µ­Wº¤{½ +ÖĤ½^VϤ¥½²Nél'»½ +÷šC 2Ã\-KÍßdjN·§æy_jîÓ*pú+h±µ#4é5/Þ†¥œv$ó¼è–€$½<‹$½LÉJ§2½èôôŸšx¤ÉÖLijµ¤ÖV[j½íJ­ÁÚ¨ó†·k¿uï +[ºß߇w{¿÷“¨qº`X%fð +bXOºðZÃ+ DRºÄfZ €¦ZX¹å©ÕœL­ð•©Uß—Ê´— ïh~wë »žß‡7D¿=ÒfYã¶Îá”·ßd‡·\Jñ~;ö›sØ«S[·ÝÈ1šh!”¥rJ2•gÚS¹§/•(Ý'}¿ô…ÁïÃ{†ßAh?©q»Ëð^càö¡á]ÉÀíX~ÿ +ÛYjw³ x»Þ»ðN†÷5¼Ëá=`xGÄû#Á.ñî‰÷R¼³Œï»xÆ{2Þ¡ †M0p‚¡ ž`øÈûAÞ +fQ0¼—¬¥`5ë)XQÁš +VU°®R^VÊÝJù])lNÊKŸì ãïx×À{ÞQðþ‚w‚ùà½ïL£ÂûÞÅðžF°8¼ãáýï†xo$X%Á: VJ°V‚Õ¬ïÄx_&Ø4Á¶ñ.N0u‚ÉLŸ`S(˜DÁ4J¹H)_)å4¥¼§9);**÷5]iNº¯×}õîky_Ùû:?”ýÞðž@°¼càýï&sÁ{ Þyð>„w%‚IL‹`bS#˜ÁôðˆwD‚A ïŸ;%Ø+Án öK°c‚=ìš”“rtROÊõ™“2‚’Á:ÃlËz˜²š8ÉQÆB“Ä!1ÊZh-o2ÿÕ9ó‚S0'x)7aØ`á:œâHàNΘ|‚9Á9Hy ÃöÂÏá?wr®À¼àÌ ¾AÊI6F8§¸¾„öµ/¯}±íKo_ˆû²÷Õº¯ÝC)JûPê‡Ò?XÁðN÷ ‚lï2Ó!˜Á”&E0-‚‰AE³ý(®`ôå£/&}ié M_vú"4Ô¤¾Dõk¨_}9ë‹[_ê†Ê×¾,öE²/™C*êPa‡Š;Tà¡"÷º/×Cõªy_܇Z?ÔþÁ Þ@ð +‚w> +c싾ѿ…¾Ñ¿©¾±ÿd º1 \ No newline at end of file diff -Naur mxml-2.6/doc/docset.css mxml-2.6-haiku/doc/docset.css --- mxml-2.6/doc/docset.css 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/docset.css 2008-11-28 10:56:50.000000000 +0000 @@ -0,0 +1,114 @@ +body { + background: white; + color: black; + font-family: lucida grande, geneva, helvetica, arial, sans-serif; +} + +h1, h2, h3, h4, h5, h6, p, td, th { + font-family: lucida grande, geneva, helvetica, arial, sans-serif; +} + +kbd { + color: #006600; + font-family: monaco, courier, monospace; + font-weight: bold; +} + +pre { + font-family: monaco, courier, monospace; +} + +pre.example { + background: white; + border: dotted thin #999999; + margin-left: 36pt; + padding: 10px; +} + +pre.example em { + color: #3f0000; + font-family: lucida grande, geneva, helvetica, arial, sans-serif; +} + +div.summary table { + border: solid thin #999999; + border-collapse: collapse; + border-spacing: 0; + margin: 10px; + width: 33%; +} + +div.summary table td, div.summary table th { + background: white; + border: solid thin #999999; + border-spacing: 0; + padding: 5px; + text-align: left; + vertical-align: top; +} + +div.summary table thead th { + background: #f0f0f0; +} + +div.body h1 { + margin: 0; +} +div.body h2 { + margin-top: 1.5em; +} +div.body h3, div.body h4, div.body h5 { + margin-bottom: 0.5em; + margin-top: 1.5em; +} +.class, .enumeration, .function, .struct, .typedef, .union { + border-bottom: solid thin #999999; + margin-bottom: 0; + margin-top: 2em; +} +.description { + margin-top: 0.5em; +} +code, p.code, pre, ul.code li { + font-family: monaco, courier, monospace; + font-size: 90%; +} +ul.code, ul.contents, ul.subcontents { + list-style-type: none; + margin: 0; + padding-left: 0; +} +ul.code li { + margin: 0; +} +ul.contents > li { + margin-top: 1em; +} +ul.contents li ul.code, ul.contents li ul.subcontents { + padding-left: 2em; +} +div.body dl { + margin-left: 0; + margin-top: 0; +} +div.body dt { + font-style: italic; + margin-left: 0; + margin-top: 0; +} +div.body dd { + margin-bottom: 0.5em; +} +span.info { + background: black; + border: thin solid black; + color: white; + font-size: 80%; + font-style: italic; + font-weight: bold; + white-space: nowrap; +} +h2 span.info, h3 span.info, h4 span.info { + float: right; + font-size: 100%; +} diff -Naur mxml-2.6/doc/docset.header mxml-2.6-haiku/doc/docset.header --- mxml-2.6/doc/docset.header 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/docset.header 2008-11-28 10:56:50.000000000 +0000 @@ -0,0 +1,16 @@ +

Mini-XML API Reference

+ +
+ + + + + + + + + + + + +
Headermxml.h
Library-lmxml
diff -Naur mxml-2.6/doc/docset.intro mxml-2.6-haiku/doc/docset.intro --- mxml-2.6/doc/docset.intro 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/docset.intro 2008-11-28 10:56:50.000000000 +0000 @@ -0,0 +1,155 @@ +

Introduction

+ +

Mini-XML is a small XML parsing library that you can use to read XML and +XML-like data files in your application without requiring large non-standard +libraries. Mini-XML only requires an ANSI C compatible compiler (GCC works, +as do most vendors' ANSI C compilers) and a "make" program.

+ +

Mini-XML provides the following functionality:

+ +
    + +
  • Reading of UTF-8 and UTF-16 and writing of UTF-8 encoded XML files + and strings.
    • + +
  • Data is stored in a linked-list tree structure, preserving the XML + data hierarchy.
    • + +
  • Supports arbitrary element names, attributes, and attribute values + with no preset limits, just available memory.
    • + +
  • Supports integer, real, opaque ("cdata"), and text data types in + "leaf" nodes.
    • + +
  • Functions for creating, indexing, and managing trees of data.
    • + +
  • "Find" and "walk" functions for easily locating and navigating trees + of data.
    • + +
+ +

Mini-XML doesn't do validation or other types of processing on the data based +upon schema files or other sources of definition information, nor does it +support character entities other than those required by the XML +specification.

+ +

Using Mini-XML

+ +

Mini-XML provides a single header file which you include:

+ +
+#include <mxml.h>
+
+ +

Nodes are defined by the "mxml_node_t" structure; +the "type" member defines the node type (element, integer, opaque, real, or +text) which determines which value you want to look at in the "value" union. +New nodes can be created using the +"mxmlNewElement()", +"mxmlNewInteger()", +"mxmlNewOpaque()", +"mxmlNewReal()", and +"mxmlNewText()" functions. Only elements can have +child nodes, and the top node must be an element, usually "?xml".

+ +

You load an XML file using the "mxmlLoadFile()" function:

+ +
+FILE *fp;
+mxml_node_t *tree;
+
+fp = fopen("filename.xml", "r");
+tree = mxmlLoadFile(NULL, fp, MXML_NO_CALLBACK);
+fclose(fp);
+
+ +

Similarly, you save an XML file using the +"mxmlSaveFile()" function: + +

+FILE *fp;
+mxml_node_t *tree;
+
+fp = fopen("filename.xml", "w");
+mxmlSaveFile(tree, fp, MXML_NO_CALLBACK);
+fclose(fp);
+
+ +

The "mxmlLoadString()", +"mxmlSaveAllocString()", and +"mxmlSaveString()" functions load XML node trees +from and save XML node trees to strings:

+ +
+char buffer[8192];
+char *ptr;
+mxml_node_t *tree;
+
+...
+tree = mxmlLoadString(NULL, buffer, MXML_NO_CALLBACK);
+
+...
+mxmlSaveString(tree, buffer, sizeof(buffer),
+	       MXML_NO_CALLBACK);
+
+...
+ptr = mxmlSaveAllocString(tree, MXML_NO_CALLBACK);
+
+ +

You can find a named element/node using the +"mxmlFindElement()" function:

+ +
+mxml_node_t *node = mxmlFindElement(tree, tree, "name",
+				    "attr", "value",
+				    MXML_DESCEND);
+
+ +

The "name", "attr", and "value" arguments can be passed as +NULL to act as wildcards, e.g.:

+ +
+/* Find the first "a" element */
+node = mxmlFindElement(tree, tree, "a", NULL, NULL,
+		       MXML_DESCEND);
+
+/* Find the first "a" element with "href" attribute */
+node = mxmlFindElement(tree, tree, "a", "href", NULL,
+		       MXML_DESCEND);
+
+/* Find the first "a" element with "href" to a URL */
+node = mxmlFindElement(tree, tree, "a", "href",
+		       "http://www.easysw.com/~mike/mxml/",
+		       MXML_DESCEND);
+
+/* Find the first element with a "src" attribute*/
+node = mxmlFindElement(tree, tree, NULL, "src", NULL,
+		       MXML_DESCEND);
+
+/* Find the first element with a "src" = "foo.jpg" */
+node = mxmlFindElement(tree, tree, NULL, "src",
+		       "foo.jpg", MXML_DESCEND);
+
+ +

You can also iterate with the same function:

+ +
+mxml_node_t *node;
+
+for (node = mxmlFindElement(tree, tree, "name", NULL,
+			    NULL, MXML_DESCEND);
+     node != NULL;
+     node = mxmlFindElement(node, tree, "name", NULL,
+			    NULL, MXML_DESCEND))
+{
+  ... do something ...
+}
+
+ +

Finally, once you are done with the XML data, use the +"mxmlDelete()" function to recursively free the +memory that is used for a particular node or the entire tree:

+ +
+mxmlDelete(tree);
+
diff -Naur mxml-2.6/doc/footer.man mxml-2.6-haiku/doc/footer.man --- mxml-2.6/doc/footer.man 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/footer.man 2008-01-29 05:28:31.000000000 +0000 @@ -0,0 +1,4 @@ +.SH SEE ALSO +mxmldoc(1), Mini-XML Programmers Manual, http://www.minixml.org/ +.SH COPYRIGHT +Copyright 2003-2008 by Michael Sweet. diff -Naur mxml-2.6/doc/install.html mxml-2.6-haiku/doc/install.html --- mxml-2.6/doc/install.html 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/install.html 2007-04-26 22:21:37.000000000 +0000 @@ -0,0 +1,119 @@ + + + +

1Building, +Installing, and Packaging Mini-XML

+ +

This chapter describes how to build, install, and package +Mini-XML on your system from the source archive. You will need an +ANSI/ISO-C compatible compiler to build Mini-XML - GCC works, as +do most vendors' C compilers. If you are building Mini-XML on +Windows, we recommend using the Visual C++ environment with the +supplied solution file. For other operating systems, you'll need a +POSIX-compatible shell and make program in addition to +the C compiler.

+ +

Compiling Mini-XML

+ +

Mini-XML comes with both an autoconf-based configure script +and a Visual C++ solution that can be used to compile the library +and associated tools.

+ +

Compiling with Visual C++

+ +

Open the mxml.sln solution in the vcnet +folder. Choose the desired build configuration, "Debug" (the +default) or "Release", and then choose Build Solution +from the Build menu.

+ +

Compiling with Command-Line Tools

+ +

Type the following command to configure the Mini-XML source +code for your system:

+ +
+    ./configure ENTER
+
+ +

The default install prefix is /usr/local, which +can be overridden using the --prefix option:

+ +
+    ./configure --prefix=/foo ENTER
+
+ +

Other configure options can be found using the +--help option:

+ +
+    ./configure --help ENTER
+
+ +

Once you have configured the software, use the +make(1) program to do the build and run the test +program to verify that things are working, as follows:

+ +
+    make ENTER
+
+ + +

Installing Mini-XML

+ +

If you are using Visual C++, copy the mxml.lib and +and mxml.h files to the Visual C++ lib and +include directories, respectively.

+ +

Otherwise, use the make command with the +install target to install Mini-XML in the configured +directories:

+ +
+    make install ENTER
+
+ + +

Creating Mini-XML Packages

+ +

Mini-XML includes two files that can be used to create binary +packages. The first file is mxml.spec which is used +by the rpmbuild(8) software to create Red Hat Package +Manager ("RPM") packages which are commonly used on Linux. Since +rpmbuild wants to compile the software on its own, you +can provide it with the Mini-XML tar file to build the +package:

+ +
+    rpmbuild -ta mxml-version.tar.gz ENTER
+
+ +

The second file is mxml.list which is used by the +epm(1) program to create software packages in a variety +of formats. The epm program is available from the +following URL:

+ +
+    http://www.easysw.com/epm/
+
+ +

Use the make command with the epm target +to create portable and native packages for your system:

+ +
+    make epm ENTER
+
+ +

The packages are stored in a subdirectory named +dist for your convenience. The portable packages +utilize scripts and tar files to install the software on the +target system. After extracting the package archive, use the +mxml.install script to install the software.

+ +

The native packages will be in the local OS's native format: +RPM for Red Hat Linux, DPKG for Debian Linux, PKG for Solaris, +and so forth. Use the corresponding commands to install the +native packages.

+ + + diff -Naur mxml-2.6/doc/intro.html mxml-2.6-haiku/doc/intro.html --- mxml-2.6/doc/intro.html 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/intro.html 2009-05-17 06:04:58.000000000 +0000 @@ -0,0 +1,197 @@ + + + Mini-XML Programmers Manual, Version 2.6 + + + + + + +

0Introduction

+ +

This programmers manual describes Mini-XML version 2.6, a small +XML parsing library that you can use to read and write XML data +files in your C and C++ applications.

+ +

Mini-XML was initially developed for the Gutenprint project to replace +the rather large and unwieldy libxml2 library with +something substantially smaller and easier-to-use. It all began one +morning in June of 2003 when Robert posted the following sentence to +the developer's list:

+ +
It's bad enough that we require libxml2, but rolling +our own XML parser is a bit more than we can +handle.
+ +

I then replied with:

+ +
Given the limited scope of what you use in XML, it +should be trivial to code a mini-XML API in a few hundred lines of +code.
+ +

I took my own challenge and coded furiously for two days to +produced the initial public release of Mini-XML, total lines of +code: 696. Robert promptly integrated Mini-XML into Gutenprint +and removed libxml2.

+ +

Thanks to lots of feedback and support from various +developers, Mini-XML has evolved since then to provide a more +complete XML implementation and now stands at a whopping 3,441 +lines of code, compared to 103,893 lines of code for libxml2 +version 2.6.9.

+ +

Aside from Gutenprint, Mini-XML is used for the +following projects/software applications:

+ + + +

Please email me (mxml @ easysw . com) if you would like your +project added or removed from this list, or if you have any +comments/quotes you would like me to publish about your +experiences with Mini-XML.

+ + +

Organization of This Document

+ +

This manual is organized into the following chapters and +appendices:

+ + + + +

Notation Conventions

+ +

Various font and syntax conventions are used in this guide. +Examples and their meanings and uses are explained below:

+ +
+ +
mxmldoc
+ mxmldoc(1)
+ +
The names of commands; the first mention of a command + or function in a chapter is followed by a manual page + section number.

+ +
/var
+ /etc/hosts
+ +
File and directory names.

+ +
Request ID is Printer-123
+ +
Screen output.

+ +
lp -d printer filename ENTER
+ +
Literal user input; special keys like + ENTER are in ALL CAPS.

+ +
12.3
+ +
Numbers in the text are written using the period (.) + to indicate the decimal point.

+ +
+ + +

Abbreviations

+ +

The following abbreviations are used throughout this +manual:

+ +
+ +
Gb
+
Gigabytes, or 1073741824 bytes

+ +
kb
+
Kilobytes, or 1024 bytes

+ +
Mb
+
Megabytes, or 1048576 bytes

+ +
UTF-8, UTF-16
+
Unicode Transformation Format, 8-bit or 16-bit

+ +
W3C
+
World Wide Web Consortium

+ +
XML
+
Extensible Markup Language

+ +
+ + +

Other References

+ +
+ +
The Unicode Standard, Version 4.0, Addison-Wesley, + ISBN 0-321-18578-1
+ +
The definition of the Unicode character set which is + used for XML.

+ +
Extensible + Markup Language (XML) 1.0 (Third Edition)
+ +
The XML specification from the World Wide Web + Consortium (W3C)

+ +
+ + +

Legal Stuff

+ +

The Mini-XML library is copyright 2003-2009 by Michael Sweet. License terms +are described in Appendix A - Mini-XML License.

+ + + diff -Naur mxml-2.6/doc/intro.man mxml-2.6-haiku/doc/intro.man --- mxml-2.6/doc/intro.man 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/intro.man 2008-01-29 05:28:31.000000000 +0000 @@ -0,0 +1,150 @@ +.SH INCLUDE FILE +#include +.SH LIBRARY +\-lmxml +.SH DESCRIPTION +Mini-XML is a small XML parsing library that you can use to +read XML and XML-like data files in your application without +requiring large non-standard libraries. Mini-XML only +requires an ANSI C compatible compiler (GCC works, as do +most vendors' ANSI C compilers) and a "make" program. +.PP +Mini-XML provides the following functionality: +.IP \(bu 4 +Reading of UTF-8 and UTF-16 and writing of UTF-8 encoded XML files and strings. +.IP \(bu 4 +Data is stored in a linked-list tree structure, +preserving the XML data hierarchy. +.IP \(bu 4 +Supports arbitrary element names, attributes, and attribute +values with no preset limits, just available memory. +.IP \(bu 4 +Supports integer, real, opaque ("cdata"), and text data types in +"leaf" nodes. +.IP \(bu 4 +Functions for creating, indexing, and managing trees of data. +.IP \(bu 4 +"Find" and "walk" functions for easily locating and navigating +trees of data. +.PP +Mini-XML doesn't do validation or other types of processing +on the data based upon schema files or other sources of +definition information, nor does it support character +entities other than those required by the XML +specification. +.SH USING MINI-XML +Mini-XML provides a single header file which you include: +.nf + + #include +.fi +.PP +Nodes are defined by the "mxml_node_t" structure; the "type" +member defines the node type (element, integer, opaque, +real, or text) which determines which value you want to look +at in the "value" union. New nodes can be created using the +"mxmlNewElement()", "mxmlNewInteger()", "mxmlNewOpaque()", +"mxmlNewReal()", and "mxmlNewText()" functions. Only +elements can have child nodes, and the top node must be an +element, usually "?xml". +.PP +You load an XML file using the "mxmlLoadFile()" function: +.nf + + FILE *fp; + mxml_node_t *tree; + + fp = fopen("filename.xml", "r"); + tree = mxmlLoadFile(NULL, fp, MXML_NO_CALLBACK); + fclose(fp); +.fi +.PP +Similarly, you save an XML file using the "mxmlSaveFile()" +function: +.nf + + FILE *fp; + mxml_node_t *tree; + + fp = fopen("filename.xml", "w"); + mxmlSaveFile(tree, fp, MXML_NO_CALLBACK); + fclose(fp); +.fi +.PP +The "mxmlLoadString()", "mxmlSaveAllocString()", and +"mxmlSaveString()" functions load XML node trees from and save +XML node trees to strings: +.nf + + char buffer[8192]; + char *ptr; + mxml_node_t *tree; + + ... + tree = mxmlLoadString(NULL, buffer, MXML_NO_CALLBACK); + + ... + mxmlSaveString(tree, buffer, sizeof(buffer), + MXML_NO_CALLBACK); + + ... + ptr = mxmlSaveAllocString(tree, MXML_NO_CALLBACK); +.fi +.PP +You can find a named element/node using the "mxmlFindElement()" +function: +.nf + + mxml_node_t *node = mxmlFindElement(tree, tree, "name", + "attr", "value", + MXML_DESCEND); +.fi +.PP +The "name", "attr", and "value" arguments can be passed as +NULL to act as wildcards, e.g.: +.nf + + /* Find the first "a" element */ + node = mxmlFindElement(tree, tree, "a", NULL, NULL, + MXML_DESCEND); + + /* Find the first "a" element with "href" attribute */ + node = mxmlFindElement(tree, tree, "a", "href", NULL, + MXML_DESCEND); + + /* Find the first "a" element with "href" to a URL */ + node = mxmlFindElement(tree, tree, "a", "href", + "http://www.easysw.com/~mike/mxml/", + MXML_DESCEND); + + /* Find the first element with a "src" attribute*/ + node = mxmlFindElement(tree, tree, NULL, "src", NULL, + MXML_DESCEND); + + /* Find the first element with a "src" = "foo.jpg" */ + node = mxmlFindElement(tree, tree, NULL, "src", + "foo.jpg", MXML_DESCEND); +.fi +.PP +You can also iterate with the same function: +.nf + + mxml_node_t *node; + + for (node = mxmlFindElement(tree, tree, "name", NULL, + NULL, MXML_DESCEND); + node != NULL; + node = mxmlFindElement(node, tree, "name", NULL, + NULL, MXML_DESCEND)) + { + ... do something ... + } +.fi +.PP +Finally, once you are done with the XML data, use the +"mxmlDelete()" function to recursively free the memory that +is used for a particular node or the entire tree: +.nf + + mxmlDelete(tree); +.fi diff -Naur mxml-2.6/doc/license.html mxml-2.6-haiku/doc/license.html --- mxml-2.6/doc/license.html 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/license.html 2009-05-17 06:04:58.000000000 +0000 @@ -0,0 +1,598 @@ + + + +

AMini-XML +License

+ +

The Mini-XML library and included programs are provided under +the terms of the GNU Library General Public License (LGPL) with +the following exceptions:

+ +
    + +
  1. Static linking of applications to the Mini-XML + library does not constitute a derivative work and does + not require the author to provide source code for the + application, use the shared Mini-XML libraries, or link + their applications against a user-supplied version of + Mini-XML. + +

    If you link the application to a modified version + of Mini-XML, then the changes to Mini-XML must be + provided under the terms of the LGPL in sections 1, 2, + and 4.

    +
    2. + +
  2. You do not have to provide a copy of the Mini-XML + license with programs that are linked to the Mini-XML + library, nor do you have to identify the Mini-XML license + in your program or documentation as required by section 6 + of the LGPL.
    3. + +
+ + +

GNU LIBRARY GENERAL PUBLIC LICENSE

+

Version 2, June 1991 +
Copyright (C) 1991 Free Software Foundation, Inc. +
59 Temple Place - Suite 330, Boston, MA 02111-1307, USA +
Everyone is permitted to copy and distribute verbatim copies of +this license document, but changing it is not allowed. +
[This is the first released version of the library GPL. It is +numbered 2 because it goes with version 2 of the ordinary GPL.]

+ +

Preamble

+ +

The licenses for most software are designed to take away your freedom +to share and change it. By contrast, the GNU General Public Licenses +are intended to guarantee your freedom to share and change free +software--to make sure the software is free for all its users.

+ +

This license, the Library General Public License, applies to some +specially designated Free Software Foundation software, and to any +other libraries whose authors decide to use it. You can use it for +your libraries, too.

+ +

When we speak of free software, we are referring to freedom, +not price. Our General Public Licenses are designed to make sure +that you have the freedom to distribute copies of free software +(and charge for this service if you wish), that you receive +source code or can get it if you want it, that you can change +the software or use pieces of it in new free programs; and that +you know you can do these things.

+ +

To protect your rights, we need to make restrictions that +forbid anyone to deny you these rights or to ask you to +surrender the rights. These restrictions translate to certain +responsibilities for you if you distribute copies of the +library, or if you modify it.

+ +

For example, if you distribute copies of the library, whether +gratis or for a fee, you must give the recipients all the rights +that we gave you. You must make sure that they, too, receive or +can get the source code. If you link a program with the library, +you must provide complete object files to the recipients so that +they can relink them with the library, after making changes to +the library and recompiling it. And you must show them these +terms so they know their rights.

+ +

Our method of protecting your rights has two steps: (1) +copyright the library, and (2) offer you this license which +gives you legal permission to copy, distribute and/or modify the +library.

+ +

Also, for each distributor's protection, we want to make +certain that everyone understands that there is no warranty for +this free library. If the library is modified by someone else +and passed on, we want its recipients to know that what they +have is not the original version, so that any problems +introduced by others will not reflect on the original authors' +reputations.

+ +

Finally, any free program is threatened constantly by +software patents. We wish to avoid the danger that companies +distributing free software will individually obtain patent +licenses, thus in effect transforming the program into +proprietary software. To prevent this, we have made it clear +that any patent must be licensed for everyone's free use or not +licensed at all.

+ +

Most GNU software, including some libraries, is covered by +the ordinary GNU General Public License, which was designed for +utility programs. This license, the GNU Library General Public +License, applies to certain designated libraries. This license +is quite different from the ordinary one; be sure to read it in +full, and don't assume that anything in it is the same as in the +ordinary license.

+ +

The reason we have a separate public license for some +libraries is that they blur the distinction we usually make +between modifying or adding to a program and simply using it. +Linking a program with a library, without changing the library, +is in some sense simply using the library, and is analogous to +running a utility program or application program. However, in a +textual and legal sense, the linked executable is a combined +work, a derivative of the original library, and the ordinary +General Public License treats it as such.

+ +

Because of this blurred distinction, using the ordinary +General Public License for libraries did not effectively promote +software sharing, because most developers did not use the +libraries. We concluded that weaker conditions might promote +sharing better.

+ +

However, unrestricted linking of non-free programs would +deprive the users of those programs of all benefit from the free +status of the libraries themselves. This Library General Public +License is intended to permit developers of non-free programs to +use free libraries, while preserving your freedom as a user of +such programs to change the free libraries that are incorporated +in them. (We have not seen how to achieve this as regards +changes in header files, but we have achieved it as regards +changes in the actual functions of the Library.) The hope is +that this will lead to faster development of free libraries.

+ +

The precise terms and conditions for copying, distribution +and modification follow. Pay close attention to the difference +between a "work based on the libary" and a "work +that uses the library". The former contains code derived +from the library, while the latter only works together with the +library.

+ +

Note that it is possible for a library to be covered by the +ordinary General Public License rather than by this special +one.

+ +

TERMS AND CONDITIONS FOR COPYING, +DISTRIBUTION AND MODIFICATION

+ +

0. This License Agreement applies to any +software library which contains a notice placed by the copyright +holder or other authorized party saying it may be distributed +under the terms of this Library General Public License (also +called "this License"). Each licensee is addressed as +"you". + +

A "library" means a collection of software +functions and/or data prepared so as to be conveniently linked +with application programs (which use some of those functions and +data) to form executables.

+ +

The "Library", below, refers to any such software +library or work which has been distributed under these terms. A +"work based on the Library" means either the Library +or any derivative work under copyright law: that is to say, a +work containing the Library or a portion of it, either verbatim +or with modifications and/or translated straightforwardly into +another language. (Hereinafter, translation is included without +limitation in the term "modification".)

+ +

"Source code" for a work means the preferred form +of the work for making modifications to it. For a library, +complete source code means all the source code for all modules +it contains, plus any associated interface definition files, +plus the scripts used to control compilation and installation of +the library.

+ +

Activities other than copying, distribution and modification +are not covered by this License; they are outside its scope. The +act of running a program using the Library is not restricted, +and output from such a program is covered only if its contents +constitute a work based on the Library (independent of the use +of the Library in a tool for writing it). Whether that is true +depends on what the Library does and what the program that uses +the Library does.

+ +

1. You may copy and distribute verbatim +copies of the Library's complete source code as you receive it, +in any medium, provided that you conspicuously and appropriately +publish on each copy an appropriate copyright notice and +disclaimer of warranty; keep intact all the notices that refer +to this License and to the absence of any warranty; and +distribute a copy of this License along with the Library.

+ +

You may charge a fee for the physical act of transferring a +copy, and you may at your option offer warranty protection in +exchange for a fee.

+ +

2. You may modify your copy or copies of the +Library or any portion of it, thus forming a work based on the +Library, and copy and distribute such modifications or work +under the terms of Section 1 above, provided that you also meet +all of these conditions:

+ +
    + +

    a) The modified work must itself be + a software library. + +

    b) You must cause the files modified + to carry prominent notices stating that you changed the + files and the date of any change.

    + +

    c) You must cause the whole of the + work to be licensed at no charge to all third parties + under the terms of this License.

    + +

    d) If a facility in the modified + Library refers to a function or a table of data to be + supplied by an application program that uses the + facility, other than as an argument passed when the + facility is invoked, then you must make a good faith + effort to ensure that, in the event an application does + not supply such function or table, the facility still + operates, and performs whatever part of its purpose + remains meaningful.

    + +

    (For example, a function in a library to compute + square roots has a purpose that is entirely well-defined + independent of the application. Therefore, Subsection 2d + requires that any application-supplied function or table + used by this function must be optional: if the + application does not supply it, the square root function + must still compute square roots.)

    + +
+ +

These requirements apply to the modified work as a whole. If +identifiable sections of that work are not derived from the +Library, and can be reasonably considered independent and +separate works in themselves, then this License, and its terms, +do not apply to those sections when you distribute them as +separate works. But when you distribute the same sections as +part of a whole which is a work based on the Library, the +distribution of the whole must be on the terms of this License, +whose permissions for other licensees extend to the entire +whole, and thus to each and every part regardless of who wrote +it.

+ +

Thus, it is not the intent of this section to claim rights or +contest your rights to work written entirely by you; rather, the +intent is to exercise the right to control the distribution of +derivative or collective works based on the Library.

+ +

In addition, mere aggregation of another work not based on +the Library with the Library (or with a work based on the +Library) on a volume of a storage or distribution medium does +not bring the other work under the scope of this License.

+ +

3. You may opt to apply the terms of the +ordinary GNU General Public License instead of this License to a +given copy of the Library. To do this, you must alter all the +notices that refer to this License, so that they refer to the +ordinary GNU General Public License, version 2, instead of to +this License. (If a newer version than version 2 of the ordinary +GNU General Public License has appeared, then you can specify +that version instead if you wish.) Do not make any other change +in these notices.

+ +

Once this change is made in a given copy, it is irreversible +for that copy, so the ordinary GNU General Public License +applies to all subsequent copies and derivative works made from +that copy.

+ +

This option is useful when you wish to copy part of the code +of the Library into a program that is not a library.

+ +

4. You may copy and distribute the Library +(or a portion or derivative of it, under Section 2) in object +code or executable form under the terms of Sections 1 and 2 +above provided that you accompany it with the complete +corresponding machine-readable source code, which must be +distributed under the terms of Sections 1 and 2 above on a +medium customarily used for software interchange.

+ +

If distribution of object code is made by offering access to +copy from a designated place, then offering equivalent access to +copy the source code from the same place satisfies the +requirement to distribute the source code, even though third +parties are not compelled to copy the source along with the +object code.

+ +

5. A program that contains no derivative of +any portion of the Library, but is designed to work with the +Library by being compiled or linked with it, is called a +"work that uses the Library". Such a work, in +isolation, is not a derivative work of the Library, and +therefore falls outside the scope of this License.

+ +

However, linking a "work that uses the Library" +with the Library creates an executable that is a derivative of +the Library (because it contains portions of the Library), +rather than a "work that uses the library". The +executable is therefore covered by this License. Section 6 +states terms for distribution of such executables.

+ +

When a "work that uses the Library" uses material +from a header file that is part of the Library, the object code +for the work may be a derivative work of the Library even though +the source code is not. Whether this is true is especially +significant if the work can be linked without the Library, or if +the work is itself a library. The threshold for this to be true +is not precisely defined by law.

+ +

If such an object file uses only numerical parameters, data +structure layouts and accessors, and small macros and small +inline functions (ten lines or less in length), then the use of +the object file is unrestricted, regardless of whether it is +legally a derivative work. (Executables containing this object +code plus portions of the Library will still fall under Section +6.)

+ +

Otherwise, if the work is a derivative of the Library, you +may distribute the object code for the work under the terms of +Section 6. Any executables containing that work also fall under +Section 6, whether or not they are linked directly with the +Library itself.

+ +

6. As an exception to the Sections above, +you may also compile or link a "work that uses the +Library" with the Library to produce a work containing +portions of the Library, and distribute that work under terms of +your choice, provided that the terms permit modification of the +work for the customer's own use and reverse engineering for +debugging such modifications.

+ +

You must give prominent notice with each copy of the work +that the Library is used in it and that the Library and its use +are covered by this License. You must supply a copy of this +License. If the work during execution displays copyright +notices, you must include the copyright notice for the Library +among them, as well as a reference directing the user to the +copy of this License. Also, you must do one of these things:

+ +
    + + a) Accompany the work with the complete + corresponding machine-readable source code for the + Library including whatever changes were used in the work + (which must be distributed under Sections 1 and 2 + above); and, if the work is an executable linked with + the Library, with the complete machine-readable + "work that uses the Library", as object code + and/or source code, so that the user can modify the + Library and then relink to produce a modified executable + containing the modified Library. (It is understood that + the user who changes the contents of definitions files + in the Library will not necessarily be able to recompile + the application to use the modified definitions.) + +

    b) Accompany the work with a written + offer, valid for at least three years, to give the same + user the materials specified in Subsection 6a, above, + for a charge no more than the cost of performing this + distribution.

    + +

    c) If distribution of the work is + made by offering access to copy from a designated place, + offer equivalent access to copy the above specified + materials from the same place.

    + +

    d) Verify that the user has already + received a copy of these materials or that you have + already sent this user a copy.

    + +
+ +

For an executable, the required form of the "work that +uses the Library" must include any data and utility +programs needed for reproducing the executable from it. However, +as a special exception, the source code distributed need not +include anything that is normally distributed (in either source +or binary form) with the major components (compiler, kernel, and +so on) of the operating system on which the executable runs, +unless that component itself accompanies the executable.

+ +

It may happen that this requirement contradicts the license +restrictions of other proprietary libraries that do not normally +accompany the operating system. Such a contradiction means you +cannot use both them and the Library together in an executable +that you distribute.

+ +

7. You may place library facilities that are +a work based on the Library side-by-side in a single library +together with other library facilities not covered by this +License, and distribute such a combined library, provided that +the separate distribution of the work based on the Library and +of the other library facilities is otherwise permitted, and +provided that you do these two things:

+ +
    + + a) Accompany the combined library with + a copy of the same work based on the Library, uncombined + with any other library facilities. This must be + distributed under the terms of the Sections above. + +

    b) Give prominent notice with the + combined library of the fact that part of it is a work + based on the Library, and explaining where to find the + accompanying uncombined form of the same work.

    + +
+ +

8. You may not copy, modify, sublicense, +link with, or distribute the Library except as expressly +provided under this License. Any attempt otherwise to copy, +modify, sublicense, link with, or distribute the Library is +void, and will automatically terminate your rights under this +License. However, parties who have received copies, or rights, +from you under this License will not have their licenses +terminated so long as such parties remain in full +compliance.

+ +

9. You are not required to accept this +License, since you have not signed it. However, nothing else +grants you permission to modify or distribute the Library or its +derivative works. These actions are prohibited by law if you do +not accept this License. Therefore, by modifying or distributing +the Library (or any work based on the Library), you indicate +your acceptance of this License to do so, and all its terms and +conditions for copying, distributing or modifying the Library or +works based on it.

+ +

10. Each time you redistribute the Library +(or any work based on the Library), the recipient automatically +receives a license from the original licensor to copy, +distribute, link with or modify the Library subject to these +terms and conditions. You may not impose any further +restrictions on the recipients' exercise of the rights granted +herein. You are not responsible for enforcing compliance by +third parties to this License.

+ +

11. If, as a consequence of a court judgment +or allegation of patent infringement or for any other reason +(not limited to patent issues), conditions are imposed on you +(whether by court order, agreement or otherwise) that contradict +the conditions of this License, they do not excuse you from the +conditions of this License. If you cannot distribute so as to +satisfy simultaneously your obligations under this License and +any other pertinent obligations, then as a consequence you may +not distribute the Library at all. For example, if a patent +license would not permit royalty-free redistribution of the +Library by all those who receive copies directly or indirectly +through you, then the only way you could satisfy both it and +this License would be to refrain entirely from distribution of +the Library.

+ +

If any portion of this section is held invalid or +unenforceable under any particular circumstance, the balance of +the section is intended to apply, and the section as a whole is +intended to apply in other circumstances.

+ +

It is not the purpose of this section to induce you to +infringe any patents or other property right claims or to +contest validity of any such claims; this section has the sole +purpose of protecting the integrity of the free software +distribution system which is implemented by public license +practices. Many people have made generous contributions to the +wide range of software distributed through that system in +reliance on consistent application of that system; it is up to +the author/donor to decide if he or she is willing to distribute +software through any other system and a licensee cannot impose +that choice.

+ +

This section is intended to make thoroughly clear what is +believed to be a consequence of the rest of this License.

+ +

12. If the distribution and/or use of the +Library is restricted in certain countries either by patents or +by copyrighted interfaces, the original copyright holder who +places the Library under this License may add an explicit +geographical distribution limitation excluding those countries, +so that distribution is permitted only in or among countries not +thus excluded. In such case, this License incorporates the +limitation as if written in the body of this License.

+ +

13. The Free Software Foundation may publish +revised and/or new versions of the Library General Public +License from time to time. Such new versions will be similar in +spirit to the present version, but may differ in detail to +address new problems or concerns.

+ +

Each version is given a distinguishing version number. If the +Library specifies a version number of this License which applies +to it and "any later version", you have the option of +following the terms and conditions either of that version or of +any later version published by the Free Software Foundation. If +the Library does not specify a license version number, you may +choose any version ever published by the Free Software +Foundation.

+ +

14. If you wish to incorporate parts of the +Library into other free programs whose distribution conditions +are incompatible with these, write to the author to ask for +permission. For software which is copyrighted by the Free +Software Foundation, write to the Free Software Foundation; we +sometimes make exceptions for this. Our decision will be guided +by the two goals of preserving the free status of all +derivatives of our free software and of promoting the sharing +and reuse of software generally.

+ +

NO WARRANTY

+ +

15. BECAUSE THE LIBRARY IS LICENSED FREE OF +CHARGE, THERE IS NO WARRANTY FOR THE LIBRARY, TO THE EXTENT +PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN +WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE +LIBRARY "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER +EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED +WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR +PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF +THE LIBRARY IS WITH YOU. SHOULD THE LIBRARY PROVE DEFECTIVE, YOU +ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR +CORRECTION.

+ +

16. IN NO EVENT UNLESS REQUIRED BY +APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT +HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR REDISTRIBUTE +THE LIBRARY AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, +INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL +DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE LIBRARY +(INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING +RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES +OR A FAILURE OF THE LIBRARY TO OPERATE WITH ANY OTHER SOFTWARE), +EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE +POSSIBILITY OF SUCH DAMAGES.

+ +

END OF TERMS AND CONDITIONS

+ +

How to Apply These Terms to Your New Libraries

+ +

If you develop a new library, and you want it to be of the +greatest possible use to the public, we recommend making it free +software that everyone can redistribute and change. You can do so +by permitting redistribution under these terms (or, alternatively, +under the terms of the ordinary General Public License). + +

To apply these terms, attach the following notices to the +library. It is safest to attach them to the start of each source +file to most effectively convey the exclusion of warranty; and each +file should have at least the "copyright" line and a pointer to +where the full notice is found. + +

    + +

    one line to give the library's name and an idea of what it +does.
    +Copyright (C) year name of author + +

    This library is free software; you can redistribute it and/or +modify it under the terms of the GNU Lesser General Public License +as published by the Free Software Foundation; either version 2.1 of +the License, or (at your option) any later version. + +

    This library is distributed in the hope that it will be useful, +but WITHOUT ANY WARRANTY; without even the implied warranty of +MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU +Lesser General Public License for more details. + +

    You should have received a copy of the GNU Lesser General Public +License along with this library; if not, write to the Free Software +Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA +02111-1307 USA + +

+ +

Also add information on how to contact you by electronic and paper mail. + +

You should also get your employer (if you work as a programmer) +or your school, if any, to sign a "copyright disclaimer" for the +library, if necessary. Here is a sample; alter the names: + +

    + +

    Yoyodyne, Inc., hereby disclaims all copyright interest in the +library `Frob' (a library for tweaking knobs) written by James +Random Hacker. + +

    signature of Ty Coon, 1 April 1990 Ty Coon, President +of Vice + +

+ +

That's all there is to it! + + + diff -Naur mxml-2.6/doc/logo.gif mxml-2.6-haiku/doc/logo.gif --- mxml-2.6/doc/logo.gif 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/logo.gif 2007-04-26 22:21:37.000000000 +0000 @@ -0,0 +1,54 @@ +GIF87a,,çL + + +  !!!"""###$$$%%%&&&'''((()))***+++,,,---...///000111222333444555666777888999:::;;;<<<===>>>???@@@AAABBBCCCDDDEEEFFFGGGHHHIIIJJJKKKLLLMMMNNNOOOPPPQQQRRRSSSTTTUUUVVVWWWXXXYYYZZZ[[[\\\]]]^^^___```aaabbbcccdddeeefffggghhhiiijjjkkklllmmmnnnooopppqqqrrrssstttuuuvvvwwwxxxyyyzzz{{{|||}}}~~~€€€‚‚‚ƒƒƒ„„„………†††‡‡‡ˆˆˆ‰‰‰ŠŠŠ‹‹‹ŒŒŒŽŽŽ‘‘‘’’’“““”””•••–––———˜˜˜™™™ššš›››œœœžžžŸŸŸ   ¡¡¡¢¢¢£££¤¤¤¥¥¥¦¦¦§§§¨¨¨©©©ªªª«««¬¬¬­­­®®®¯¯¯°°°±±±²²²³³³´´´µµµ¶¶¶···¸¸¸¹¹¹ººº»»»¼¼¼½½½¾¾¾¿¿¿ÀÀÀÁÁÁÂÂÂÃÃÃÄÄÄÅÅÅÆÆÆÇÇÇÈÈÈÉÉÉÊÊÊËËËÌÌÌÍÍÍÎÎÎÏÏÏÐÐÐÑÑÑÒÒÒÓÓÓÔÔÔÕÕÕÖÖÖ×××ØØØÙÙÙÚÚÚÛÛÛÜÜÜÝÝÝÞÞÞßßßàààáááâââãããäääåååæææçççèèèéééêêêëëëìììíííîîîïïïðððñññòòòóóóôôôõõõööö÷÷÷øøøùùùúúúûûûüüüýýýþþþÿÿÿ,,,@þÿ H° Áƒ*DøNÙ)Dl¨üpñBƒ2jÜȱ£Ç CŠI²¤É“%4 ðÁÅ*lRön¡Í›8sêÜI°ž# (ƒ +J´¨Ñ£H“Ðà¨ϧPÎâ´ªÕ«X³jÍŠe^Ô¯{5ØJ¶¬Ù³hÑ6è6¡˜´pãÊK¥˜¨ŽêêÝË·o\G6×õK8+«Ãˆ'.LÔ‡âLJëðm°Î Ƙ¯âÌ4ËMV„ÑTƹ´éÓ¨5*£à—ÕÍ lÚ +T•ñ‘lŸNnéÚf©nÿ3çÁ¤g›  ³n­3ƒ6àí\VdŒv8 ‘Ü-²7Î{—Eþv€–óÉÈã “§–ë]a—“è‚ÿyûM’íz?¡zý!ôßziå‡Pô!—`zöÙ„ßMvVŸH4 gxP„%UhÐ…!yXˆq’†q¸ B$n$"A-b¨Š©xÞ„â’‰ ÑH9*H¡Ž2šåã@@†HäBŠÄãGG +”äM¸d‘Xf©å–\véå—`†)æ˜d–iæ™h¦©¦Œ/䣓E…àNúÐ`eT¥õÇW1j¥”kî5„?9ñRR"9áÓB_Ý1mõ™ÑŸÿLè\[äÔŽYÀNõœÀN¬(£'= Bxú „þ—fF‡pòˆpÔ‹0€t u@Ò1 +Qq®Iz¥–ÆêW#;¹ãkUÄ +¤ +¡# + ¢Q´ÿ‹¬²™•ÑIq;à +íÒQòqdÛ×91‘'9 BÔ»¹¡P#a@(BßxÄow8%+ïViääÍ`ÙÐON‰¬È"H•@Õ§»Ê[Âg²±—:i+Ô0:AÂd•±¥“J^Ù¥Â!„^±Å²ðÎ<‹ A÷,4Ïß$dOuC'}¦öìžÒPo)ÚmóØõÕœÙàUÍ õ2Ö`›5Ë\ „­¶H ÁkÙpõM#A(°v™ +ÑHþÑq÷Ý÷:•ìpw ;TR™ßˆ/ Òƒ7¾‘?'þ”*;nùP ¨"¹@T]îùVXÜvLÚŸ—žÀæĉé¬ë…/B·®Û}]FkìYÌÔ‡ìA=‰¥í…õñ°}ýy³F@â&NÍ’–à£S2C åûÌ°nt+çÔ¤£|aÄ¿yâ´5¸¼ç$8• ‚ýg=˜dNWØ/3G×sD©Õ(ÙÅMN¿‹É/{Œ2`ý£>…°/! +ûÈøb?¬ý)‚.Ú_ÇXö‘þmä‚£â`G&x5Gƒ#DaF<è'ZL@dàãuBÞ©‚;¢Âh(>’wþ@ ¢‡HÄ"ñˆHL¢—ÈÄ@ÉB'›ÊtbŠò$/D¹ ŸÁ&& 9Á†Ý>"Œœx¢‡m CPN o¬‰y7蔂 Ì&•(Ê»¼¡˜¤ +éÁÁNôF8z$‡ƒ +#”¯ì#!øp€H4—5dd=*¤!=âmðä+—Ç2B…Hã#oPH&2¨Âcir“ØFÍÔ‘£`ò™J)6RÊ„ #…­üåøtdj7i$$3A(ä»Jˆ<Æè®QÒ…cú@_ ÐœÌÂ$PGNà¡M+Â$ÁáÉ +nˆÃL¶ÏfzùÀ;è>æD +Gþ±MNæ1 Zó#äy%0mè¿w³.5ùGú6ÉÐIn¨¡ÝÖMꂈ2QNQ‰‡ ,DÄ£oª &GæJ´ Œ¨ÜH×Ôl”j`ÜJOãFlí¥8%H;TÌ”,*@ƒ*°“ӢĜxÁOKóN4ͨe;F–Ú¥¤ª9IÆF©z&€«YÆ2¹ +.,#§ŸÀY‡–€OlNc]+Ö8 ¸%C¥r [¾ +xÈ4¯óÀÛv +ÀÊ:‰ay—;…øb±DôEBÞ·D®ç‡tÙAÚ!R%Z65˜¥‹ˆúslò³¨ m]Î!ŠBV‰!øþ"¾ä‚0¢©P(qt¶$  ‚,QŠU~è Â×%`¡–0Å*F‰?€jU"\À›/ ÒƒJ2j©âŽO1PòY6 `Y‡ÐØN¾¸ »{¡™pα<áPƒ¹9tÐÇlB ~”­ <'að›ß§|ƒrø‚è0ŠDB¥¨ÀCº‡N˜c'7h`B¸ˆ“v¼"fà‚òp +qê„$QíÐ(ŽúÙÀ‰?€@\c€"F‰Ò¹’Ì'X¤ Kx“ÙÖp!Úx¡…‚|!ÄB‰ A%ºåž™0ÁS~ò’AÒ^l‚ùCæDóþ ‚A.×WÉ2t’¯Éæ¾¹š]æÙ—cÜJ7¹ƒsvg™ygVZh{N󈤬f9 x‡ƒ¦ïŸ:é¤%ze•ögžPf2zјŽ3“=­è\‰YÔd4”ÌÌç<ËѬf'ªC­à¯oÀ‘þ´©á\ë¨]š×a>3¨}kH+¤Íx>ô%ûüÚf;ûÙÐŽ¶´§Míj[ûÚØζ¶·Íín{Ž`؉Ž"Öæä š†ŠŒBî=űæ]À¡“E ¥7 l½+ oDÆߤ̈3q"Œw}Ò +$%þI…¸aƒ–Ï=aÐß…°#”q‚NP¥ë]sdF:è•B¤[ù—^ërŠŒ[Ÿ##ðT7 iw™6P±:8kb7€ñ€ÜU Ðy{«‚Qt s8¥æ~q<ñM²Æ€…WTÇC?@@u‘N81nDƒ7Ñ ¿åg·wJ ¤ÑoFg9µ‚sÑz27á”eu°V~§ç8!X,'w>BM0>õm£‘…^ˆ5Apy4†`“1 ¡Th¨4/pómÈ3pSÏ7Us¨,9`v:¡3y¨&‘#‹ô‡câRp³ þ_CˆZ2gu>ŸpƒŠˆ +àVE%щ}auVo‰p!ʼn9Ñ àZ ˆ! +|HŠmá Y°©x ’åŠPu±ÐM€ŠÕMб`n¸XŒ¡‹¼è‹ÔŒÂHŒÆUsS7Š˜7{óŒç‹²˜Šµx‹ÖS5‹"QSvØ8aŠÊŽB±Š­HŽq6ÿ‡ŽDÑ6ƒEŽže!ŠÝ˜Rö¨†È‰–¸s¡‰Xå5©cƒVXq1‰R +Y%µ9ˆø™Áˆ~S5iZ7ƒ˜‘§Ñm¡Q¹%~8’ˆPñ4(I È´ý€þ‡-)#{¸5“Y‚Q8‡8©%uxGÓ“[Â46Á†B©%oxlGY; q†•¥j¿Ãld¡†4L„Z§ñjpÁ7!†H„•¦¡•iQ†±PW •E"–iaRÿÐ…M–¥¡–h†q’o‰–2"—h9E¸”a²…óä—dò.(˜br +"Óuˆ1!ˆ0| ñ¥`ï¸ Ô°çÐ 8Œ‰$±˜¡éÁ`O“y +QP€%á¡)…ÁŸÙ`Þ¥=@o<± -×Sàb;á˜Ð›³óh@ØE¸Á`+3×k|ñåÄÆsq€^OÑ ‰þˆš ÈÅYlÇy ´è{m18Ð~ÒÂqñ'°ŽOZW3öRÆflW3&x}йîùžìh}ik„k +·Á !g…k6 G7ùyR“àŸÁ6j9 J°q ãˆé€xµn“g@eq…q Qpƒ –ߘ|(8c91 +$!…9± P…Ñ *Z,:ôà•wr¤·#/”’&ÑX &’ÿY"x‰{71'AË™gDkêk7‘ '¡ÏGy#¡¦›V¡ Q B(®&•Êò'2Ø Ñ êÙ-CJEŠnAÑþ>d§±òk'X¦dúƒ©fœ‚¦”„–ƒ•'©;ƒ¨ ¨¨>(‚€æ¨;Wqz꧋:l +©Ÿú¤“z£§ä©¨ºl›¶0– +…­j£YÊ?[ÚB‡¡Œ*«µ +k¹š¨»š©JljlÈùœ˜J«ÉŠ£¿z©Á +¬¢Ú¨âù¨ÇÚ§’¢—à«”6«¶×«¡ªŪÞzªãZ©Ì×­ËÊ«éú­·ŠzÍ*¬ëªšª4Úª¬Ïê¬Ñº©ÓÚ©¤j­N6õŠ®÷ª®Ë®œÚ€žª«ùº­å +«çŠƒ ëªÊ®)bg’Š­wú°K©»®+Ԯ˗°ÿ*¯Ã:ªÕ:²¥ú§Q¤È&þ° k¯/ˬ"‹¯ó +­5k«›‚ýzj㊱‡ª±äê±.{³© +²Ë°ë³—r´Ë­[°›³õ®6[²4kµPãY°µ\Ûµ\ëœ%!^;¶[kš&!¶dëµfK!iëµ$¡µmûµB¶q›k t·wk˜|Û·~û·€¸‚;¸„[¸†{¸ˆ›¸Š»¸ŒÛ¸Žû¸¹’;¹”[¹–›‡ :QüVÝ—U®É-‘˜E[„ ;+DtŠïð£C +õ¯ +Ñ Ga §k¬';Dì’öBÁ7±$kWG+`r¨›»CDôû°N&±Ö )qUµ6þq E È‹»«ŠD P 9áéIPsÔw™O«µyðH·;žÝ›DÆ—G0$¦Ù³<á¥A±‘R¤•ÒD$“È÷9  áÕ£¿<Bÿ›¼ñ«D67‘¢A9‘ëÕ§6±J(A¨̽áÚD0£7á(9¡ «¶€„1y(ш¡’”šL$@8ádA¥ ‘j÷‘¿& +a„7µT{Dƒ˜l©ýÀûB*€—‚g® u°Ä\ÚÄGÄ9 +Æ€äÀ¦â +C7º%€ qµv:›ºpÚ'v9Ä +"³[þ ‹Ƹ*ÆH´Ñpq€ü‚ +Q¼!ÑšWËDÈîjÈIÔ `±5 Jb +a #qdºÔ´ÜªÃ %.Pñ àéÉM +±¾!™áGA+´¨ÜPGȨ`ó"üëU.é³a<³ %ã ‹ìËÖÄ•áÀ2 Á~· µ!‹Ì›dlÇÁ§#m J6WÌD[ÈÚ GŸË ìÊ8”£(yjœ·ŽgÊåšË†„eÔðŒüO€`ÄÁ4³ÆŒÎÞ G@ZQa¥çzDÒ¾ZÌ`ˆÀ*}ΗœÎI„.ÂÍA8—¤{ +¢þqC«ÑÙ¼ÐKT81 +QXßÌA"ðÇQŸñH‹ËâwD@Í6! ¼Ùr/Ì€ý—œc 1挵ËÑDÄ­­wм7¡(|üf5Ê¡~ QE=Íú|DI\§€Â6Ñpkœ¬<Œw×ÑÉiÐíÒEt9Ñ‘¡›‰híÁ$ÒÖ ñ +0 |J°jýÓA„ÅsdcÝйŸ +ª!q 1{ qŸ}ÍÒkÝ%®9°¤7±#1 +9¡2ÀÀ÷ÊPA Ö¯$\±e’óLK  <«{mðÙ1²‰;1» ÚðkPHþŠà˜zqÜ ±FIþ’ÆÆ©´ëðŽ–ÜÒ/5ÝgáåC pÆ8tA¡Á9QcÃËÛ‘};'ÏMq8…ÞfA><P7q6;ÐÍ’bû-O<Ûž-Ù~mÞ'åße=8dœ×0¡C1t:‘ÙWKÕAG½‘PßÐM­ç­¦rŽg±:! H®}ý™Ñ$¾—0¾Ò;~Ìý]±õ»s¹{!<¥…ä{AŒ,Éäpñ’œå ™ÕŠEå¸sKˆå[¡Y!\N”‘æZ¼¡€fn¯³W¾æGÄmçH:AÓt>ˆÅœ£“ç(:QáW~^‚ÕŸ8è ¡E²qWˆÞ{U6EÖèJ7p…èt•8bAçkÑ>iæmõR”å™cTbe¹fʼnS!¹]aŒZŸ^5 ‹c¸¡!U€kU´®>!‡BÉ‘—ë@™T#ÙTø ì<8[Š…caÆ^6;ÕShTCÕìFÕQñS*Á.2A; \ No newline at end of file diff -Naur mxml-2.6/doc/logo.xcf.gz mxml-2.6-haiku/doc/logo.xcf.gz --- mxml-2.6/doc/logo.xcf.gz 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/logo.xcf.gz 2007-05-23 21:38:42.000000000 +0000 @@ -0,0 +1,50 @@ +‹äš xTE¶ÇÏíNÒ IY „¤“@ÈB‡„}Ç EAGBÂ#áãŒÁuÔ§8"¢>QŸ#Œ¨£‚Š".#âs@QÑÙ•}‰„¾Ugþ§ª3“D?}‹ŸAÍ÷üNÕ½·»êÔ©SçvÕ”²3ýs'NöO.›^JDÞ¬˜¿xˆãà_"$òœ;ˆDð— Irˆr_K ?;˜X1cFiy….ŠP s¥lFÉ”ÒÀ”Ye“BÈÜʪyÓKýeåU¥³*K'V•U”Wæ5Ëe6\ÏŸUZ>nÔHùº %•¥Ie³¬Ëù§WÍBåÿÙq¦Í®¬*›<Ï?±TüX¾±¬¼4Pç8âú=šP170£bR©Ò¼ò’eCU ºWϼnäï¸ÈÈzÈ&ȧ ï ß9ÁHF¤@r!=!ƒ —C¦BæBn†,,‡¼y ² ‚ç#ð¼Ïûð¼Ïûð¼Ïûð¼ÏG&@ÖBÞ…l‡ÓÝg+‚“áûcGÁ‘ÎF G”=q8œçsÄŒk‰Z%J{§ž$jƒÏNëEÔv QúÅD¸ß?Ÿ(ó>¢,LƒìÕDížÚ·‚ ¯9³‰:´‡|H”{#Q^7È^¢ü»!Bp>îËß +Ù Áw„Cà­x®÷|@Ôq(Q r5Q!¼¿ðîí4òäY¢âeD]`×nhw÷D½#êó4Q??QÿŽD`°ÇY’gO#:7è¼|¢ ž#Œø6Saè5DÃ@– _Ht ¾ëÒîD£Î!úU¢ÑLj~qƒÙ8c0özH Ñ•˜ÙWN„¤Þ¿»bX -Á׺ˈÙË?C˃G‹ÆœY›¹=»íà „ëô~ž3ÙÝ:È¡Rý·q[vkf‡SRQwqVw¤ R\Naµ:Ž2ÑOÍɬžŒ lÒ•Ü’Õ3áÔŽ”ó$'²ÚK9¤RŽr<«#Ù”KzT=‰òHEà8VëÊ'}#7g¥;RéŽPõr +Þα¬óE{cX¿B…¤§ˆ6F´s9šÕ‰f¢fAÕOS'Ò ¢M-B´,*"ÜuÈ1Ô/S±à6 ¢¡» ÖÔ‹jâ†ÞºŽ·Ýy¶—:S0ïê·‡³»çŽÎh…›2w¾Ý]?:q{?äìî˜,=wó_EßÝÏíŸTÑËœÊêµµ%7á~ ùnuµ&5rg°z«µ"Õü1Îbut0\NuÙÎíØÕsøœ*©å¬îòˆ£ynÆp©‡Â0XÊ·’;B÷ˆ{E¿( *î q¯â^Ñâ^*ØWœÊ·N¥ö¤ˆ+y‡+©gø’^ þ3®¤Ká>µ‡nåŠÿÜMmö‹ÿ¸Ös_ÖGá>)\sdõõãûeµŠñÂ[ƒÍïäÅgqP¯ìîÀ·;±z:ž`µk5'´ïå$´»€Õ¢0jAhûBs'eé[.«µað4ôogÞQ:°‚þçÈ'S{V§Ó õX¨+7ÃP? .²1 †z¥ +J,Ú0è—Ž¡^{g‰‰Z7 ˆô*íq2Οróc/¾÷ùc§ô©Ã»·oÞ°òöÙ-žÚ“> ‡>ýÉc•b1–i<ýRyFÒÏî–kÛš ª§zÐ0LœOÆzÐþìnÂœI”~¾ÒýÌg·¶ÒÀ ¯ùaèØP¨•*Ã`±Z ‰áZæÁ("Ü + ̆YÆb<»²ªÉG¬ÀØmŠ„Ýî0~+z°Ú†ÑíɺÌ@}‡îÅúfu$£Ü›õ4µÍƒ Ñ‡õË ‚ÇðÒˆpá²Xb±×Cð•+ÿOŽ£è–¹'/yWKlZŒ¸Ic_”èõ.Ú궻ßeøA0Jœ1÷/Ðu=s=s´DáâºCjàºú*@_+árl¢ÇŠ¶VÒ÷K8]MÅÉy¬7ÂgôdÑ>–ÈëÛ#‘w ««E;,ZÑjat½ Z’|ˆA©ÅÙ™ @KŒR}i –Ÿ)Þ’F6èõ|¤kMÝ¢G¿ÑólN³|Ñ8™Ü!'A¹ö(V~¤‘¿9¯Þ/ELNzÎ O¾p/ü«~Ø­ðyÄäĵĘ9Ÿ! +cÝïúæ¢ò9lj±â÷—µ]–ûãˆÆXëG°ª#:§~ŒU>æ=d,ñÎãÇY+{3–ù~®DeJÜ#«º³Rbó8îÇúÒÐňE›ÿój<üàÆþјÒÝØÝuM&ÂCvß¹8 Ñ£˜Ý.µÁÚ V‡cj"mAZ+AéÙXµo÷Ú¨}›c£ö=¡¨½Ök£ö®dL4Ì·6h?h‚¶:œlƒ÷omð>oƒ÷BužÝmìžkÑÙ†ðc^Â_@°nžß¢ÝùC+î\¾vãίž¿>¸óãž^T5ªGªƒì£Öi7yé{§%Hxnþà–øœ`äEì@úÜ~{ÿ04PËÈ‰ð†œ«õ2å9@ïhu2©„ÕÈÈ„? +GDæý#²ÑTd`ïÂC‘C¤CŽÖ†ôUÊûzžFú"åÙ„ £-éi*ñ4§s:ég-fX(ç ¼ Ò¯ZüÁbºÅ%½€†3æ™ÿÇ‹”NCrËjƒÄ ‰Þu" ²Á×êH-X4P†!#D¾8Á@}‰\1AÖ3Úì LdÝËb™ú:ÙY’d« TMu –¬/´øƒÅg@2ëVHR“åšÁÕOZ|´b-‰Pd1Ô¢ÌâF‹‡-ÖY¼c±Õâ3‹½G,jÎù†ÄrƒWMç²3àµòÇ‘ú~ÖÔ¯“M-õm&©“ywnÑÅ"Ý"É"ÚÂkÐåg/ _á²dÆ›„˜E±…MØu¢E´…× íg/õ Ô8ëý¥I}[4}zæäþ¿”¼ÿö>-o¦æׄÉçZäX´¶ˆ³3hó³—úÊ7j“¶´ˆµ·p?¥ÿb¤¾iš}K.÷K’†ykSç’M-?¥\¶:¢áF\ØÞ}OêרÅMi}·TG´ýIåb­Ûô«ô÷ä3Ú{¦ç4áßhqS/ñß-Õ ãYS¯ºß»*7²î™¾2ÇÚÿdVÏêðÙMø§qù»EßBúÙ°Z)»¤™5¢vƒªç‰¶V*#þµé³€hÒp±ü¤ßêq é2å}ÛüŒ«º(.äæ¤ï2Pq²Gz´r^æŽÜ‚T‡Ó\Àñ¤¯7PQ²óž@z0Рu1g‘HýH½ë¡¾¤xþ»üq8õ!G^Djw3êMÖs ÔáxêE^Ö¿7P5­©'…ɶ©@¹í©¢Œ^DÈÏEÝk€†f¹•ô t´©°-†z²œOxH »}V’ÄL×Kí8©M«‘ÚuŽÔ>$ê©©î¬eú·¢:ë¤zk„Ü1Lžë#µáÛä†%%¿[ãúÞR÷•Ô^&µ7Kíjù\•qJöOú¥úrC¥hÝå†÷ÃÌW¼.7¨.äkÔŸù¤>‰² çþ /g?>]ö Ó -Ö¨Zµ¥ ù-Ú ÊâIµÏ¡4òËqƒ1‹-6(ÝœÚP¦lìT[¬1PGíVº°ñ^vôJc?·ày-‹\a±Èâ ®4Ô}9APe±ÈÃì6Ôm9Qp™Åí€\R¾ZC݃“3-–-T„ ñCHÃÏ]Jí9õÆ­àž?ˆ|WôI$ý„ÙêQmOØ]èJþÙøÑ}€dÒØퟤƒfûGO´»@ž7í.P¡kvômv3(v—Ù Ò—Ú=!çy»”}ÊnýÎnE~l7ƒé¤³Û>©GíËú ö>§aÙTÝå J&é{ d#¾5g‘¾Ò@9¯r*g“Êr +·#ý{½ƒ[q{Ù}j……L?Íɀʨá–Èsô\‰­Æ_y7ĵT«ÃÖ §(ï—Uü¹#é; $¶Æq€ôåÊy‰›s!©œZŽåN¤¯3PQŸr I4‹ábÒs4 ÒŽcéï,©¶‰£ðö {]å¸@$ °»‘ž` —ÇN—k°]´°ÖÎÞûœ³Oÿs¿þaªtÞ­h#3>,=4QÑ +Eoe'®Y°[¢ºìl¶÷ÇÔ2ž%õ“ÓulOéfsÌõ%uûð4“×Ý*ÞÞA™×IýŒ20i²¨bt`ŽS6³(@ÝÁkðÁµ¤%õ1©y·=ŸË'õ7|÷ç~’å¼½…î$5×øÎ Êú®à·î)h@Bl‹?##D²>(&B=|–š|–êªT³=æ‹P›L„ºû,uy„jŽó(÷ ´³%Ý¥âÚ‘)Dë¿Î7/„‘x1ùmq¡ŒÛ‹þœQ>ȸ÷Ât„u`ŸõÙÁ´Y|vˆ ?i­l°‘é‹û‰ü ¼eJŒÛß”ça±äÿNþœ"ÂŽ%¢ Þ:¯Á[ãö Æ‚í§Ø³v£¿vã@žc‰¢U™~\0 óhØœØò[Ðk £"†j¯fà>} kú"ƒßÈÈÜa]—™§+ñÃI>BëšÀnú/ÙÁÜÂó›`yøù9Dü ÅÜhGa×\;»eöW°\°ùÝ)ȉþ-Œš4ûÛn+}­{’'KÚÊq¥Ûa¹Sa"9uÚHþ×i9…‹h¥9´MÄÐ6‘ÃO÷ñjì‡g†î?ѶÚN¹nMší{¿ †vx?&I§ì®Æofï à'ëc!HÍ {“fLû_ÑŒé4cHŒt0Zâlà0oz![©É–FA™œÍZgÖáѦæ.¦s³=?1&*˜žú7èqÖù"M0¶‚-øWüÀP³šòaÑÇÒîK³_¬`w¨éGŸë£¦¿‰†‘"ØhÐ?û‚8`ÆNf ½¸sL1ºïEcµ…®3ˆ®ß9®ì¡V@ŽÇ·Á‡ŸX8K}Ûë㨜DÇñÑ6â8~ ?}t}ŠÇ¸>¨ã…ê1nê®®â~uOUWñéê*~J]Å#ÅUL»„N (hâ˨cW@·©æZˆ-ò,ÐÙäDšv…°m`é9N?Mù…!()¿³4å÷«MùÝâ¥ü^«)¿‡“4å÷ç@0±iªïoZhŽï=^Žožfõ¾èƒ}vÉzúvëI”Ó¨tº´èTÚk™Öu”^mÏO k1E‡Ñbó:œ@’ç1Ü·h<¬!õ©ÿ$5wÓhod“ºŠ"‡|$ïçí>¸ƒÔ´e¢Ä¡0€· eµ 9_å“l9w) cx7…/O%%¦ï‡¼+þ‡U¤^$5•ï|I²'ì)3B¬ž)ÚßÞL˜Gj¯Ž4üÕ|ùCR<¹—¥Q/÷W:{;HGÉØăݼAÛáìJáy f‘Ú££2‰»éë>y…ú p®• \†7L¯³ð3’é| ¡»Ÿ·ÅEò8©IM#õ©ŠÄ‡ùò“Ê\Æ«/ò¾LÓù¤~Iê‡òòOø¤ÛŠOæð껼ÿcRÕ¤–‘ú{R2’ò(+óâSùOÊ2µž÷eὓ”8e†:È›‚|0ƒ_çÅkH-!UIêRµ¤Úóå-¸Ò¹ ¼ØŸךNêV¶lIeŒ ·ˆìp² ü-§¢ÀŸ;ZÀ*»˜á’EyÉ¢üîeH«AÆŸ¶qŒBŽ´ñ¶KJƒ`· &Eq +ÂÀ½±®¾nÝ[lK6ÛŸŒ% £ŸWJPŸáU î—k¿0 œ/y(²ÿ‰Fç;|©Ñùuêr­ÞÅ„Õ»X)ŽDÚdmé4 Ô©Ópºø#?á³ê +£^¿Äƒêõ«R?_8²oª/o†zï2O©÷n½:èÆbGÉÐ41À(¥N_¸½„™s±¾Ãvä~˜u +8ËèF˸î8›ÇpwËC‚Ýå¶3ƒáý]àT¿c»pce»2rKµ+wlß&ÛÛø56ŸÛ~«ß vWØîL¸àC‰Þc{PG™m{R­É9­Çw}[l/jKãmoª[I‡È. ÚVìê¡Þèwa´Æs (´æø¹žËs„>~ê@˜BmY‘£Í Æþæ²ÌÂ]ŒŠgõŽàGŒ^½›O_˜yVúð¿E+z$­èa´¢·INÍ&fÌ„h-w§ í> Ü­–Peë>¤Ÿb³Ü$2ÆßÓ:Ÿ'óx}üïìœÉuýz†@bX;B£x”~Ã¥oú9}1Ôa­WÀÆ•’'P +ó$ꉦÎhd@öa“Fß~Gjí¥Xŧüÿ.0í¨VäXçãwÌêÉæÚAuggŸ” +%ŸI7“ªN†u^õ™,fòt°î@–ÉùšAåµ /—³Hs ‰$czCÑ3XRäD*H§Å~«ç0l=£Ûù]$ã) VweòìÃ=#Ã?™AAÌó­¬û‚‘D–)ÉÞI¤ªÙ‹½ËôLHöN<•£öÌücI Ù;Aú8ŠØ;°|÷ÇÀÆEïÄÐRícÜîX ]>µõ/S[ƒÚúá|µõ«ÕÖ?•.Ø-Sßù$AMþ©jò¿%Ø-?ÀŠåß_Lþ§hÕ7u¤É_E[??ΩԢx’Õù,E«>ªÇU‡Ê Sú"òìœ/ˆ¡ÐN ‰â—t4홊@ÄÀi.§Oe0BĪÎþ º*“ fDŒ&K¢Ók~Mmš¦©M'ÚkõÑ\õ¦çZç£×-ä8!ͽÐhÜ ÆÊÒˆÛFŸÆØÆiŒíPK §­Ä`«„ÎöDKy ÷.­²q:Wªl0TË#Þ2Ê{HLš570|“å.ÑÊ{c¤ò†{Ÿà8Ós¦@²ØL!Ç(<Ž‚)çÐkõWÔ‘ªé´ªrJbòÒŸÇɇ«M=x“¯PÜ*Aξ"vmP&_¡xW‚œ}Et°ÄqòqÎeòáþ?Çì+¢”ÉW(î– g_‘x\beöÑëäìÃÕ/3¼œº":_‚œ}!ú_beò‰æ’_ä¿ò‹¤Òÿ*™W=õä=¬¦^¹Ï)š«h¨æcÁ*”|¬7-U4^Q{ têÑÌÑrŸP4MQoïøþ MÜz^Ñ}Š®Ð4®„°¦qéÑ~l™‚®UÔ+ë=î¿FÑ-Š +¼Ãÿ_j¾×VE¥Š†kö %‰˜½­èE?V”©)a nÍ ƒ>!¨HuRcu/*š¯èš5–èh”o·¢Š&(ÊÊ¥#Á§MWÔGÓË¢Ni˜q›¢ŠFh²Y+Wã”{­T4QQŽ&¢ùa?·ca„=“|“ž'+Ž‘Ÿ2Mèg’:|F’‡²ë…„“…¿‰Þè¨ÓÜ»~Ë¢3ö1îÍ!>ð°ðõäo!?ù¾à£lópc¶òÃNG+?Ïøó…;°XGÙðóX’%¾*Ü ¿øÅ®‡m±—„ÍS”¹é=J½Ì/]2ƒ…7‹;“ìùZVäs¿fmÑD¹Š†y¢´ÊÈ[º·< h‚¢l-6rȧ¹G5š*r‡¢þš‰ÔØB3‘^Ñ=k‘¢1ŠR5=éCMÇ]¥hª¢žš³$þu†ä¨'$‡nÉ`rZ +vßÑ]óAEåJV{N²›ÖiFñ, KÖø%küâ²ÆKc†ž_¶$¦ÎôÖJ‡ÿйÍ''H +鲋•ÌëB)MËŒ“"-Üæ$Éá‰Ý~^­æÕᤑú•¨n¢º½yu¯>Ê«EûkÌ0¥‰¯þÙ/±´¬B´–äˆD‘DÙbŲ*â*¤eÅã,´ªx&•œg9%çYÆëyØQ¶4qÇ·*‹Þùv,H¢½•£jû/‰îZÕÞ'éZ] ÔéOÞKOÃZMHº]Q_Mþê©Léyôׂ˜î&9PïÂ`ûæ+Å ,y _Çhh­Z*劮V”®É¡ûÅšqW4 -ûÑw^]Kwç5è›_]êª×Ι#ј,MaJƒóí9ð¿ÏÇÞiÏV—xÀ«Žþ(`—G_¸Ñ£»B^õÈŸ6`iüø+&ßpëM3oŸ=]žô{Ÿ•ô#ÿ¾­’¾ÿ·'Wãsqò¯Ù¸ ðàiÀ–óŸ™r%àyµ1·Ll¼xð1àKcnÅ︵5`¼1·AvÆí€R@•1³Ó7æ𠳟<xðàÀcîÄÿåÎLcî9p°vì¼88•ïž5e~ 00ð€<°¿÷Ÿ;ó³_Ö^¼øð) É˜ûÑÎ÷·t Œü-àc¡«í|mÌbôÏâv€|@1`$``ànÀbÀC´Ýâ­È/†übÈ/†|äË _ù2È—A¾ òe/ƒ|äË _ù2È—A¾ òe/ƒ|9äË!_ùrÈ—C¾òå/‡|9äË!_ùrÈ—C¾òå/‡|ä+ _ù +ÈW@¾ò¯€|ä+ _ù +ÈW@¾ò¯€|%ä+!_ ùJÈWB¾ò•¯„|%ä+!_ ùJÈWB¾ò•¯„üÈ/üÈ/üÈ/üÈW¡ªÐGUè£*ôQú¨ +}T…>ZŠ>ZŠ>ZŠ>ZŠ>ZŠ>ZŠ>ZŠ>ZvŸ1+Ñ÷+Ñ÷+Ñ÷+Ñ÷+Ñ÷+—VÖ0vVbì¬ÄØY‰±ósŒ_ÔóðýƬÂ4^…ɹêã«Vžlìüð;À)cÃy siÍAÀIcž óôÃÆÔ`üÕàjð 5ø†|C ¾¡ßPƒo¨Á7¬K5f=Þ¿í±í±í±í±aó`æÁ̃ ˜06`lÀ<ØØ€öÙˆöݸø[kìG¿d]Vòc‰TVúcõ?V^eIÖɤ,°t"ѽ”ó†Î(nxé²Ðs§äÿØËÙ0‹yþ8lX¨ímžœîå‰ï¶– +ÝMŠeZKO)Þʘ–¶P*ã%ØT6ˆ³}MÐ2çf€¨UѶ–Ô ˜bƒ/}ê÷õ©zÁ`žÞ`M±qn;`}LÕ›Zo<6afÞˆ—m ƒ<…ÏØ Ã:­—ÙxÆsf· àŒª³-²ÉZm“«™Ùh“œ)©µ) Ç*l*u›1û Ût2N|5¡ŽÆÛ`Û1ƵBc,Ã÷Ú :a@ÓÉ0Nþv›MOÏäF £@›”°I¨Îvb¼äÇæÑYµÌv‘ÀÈ6 ŒŒ8l»12]"!îrÛƒ‘¤Íù(xÏöbÈãG' ƒ$0˜/!Ž{õðrhŽAú›$-/øœ-M«Õ¢¥÷hÑÒõZ´4tд¥fºzžg÷²[YH‚]Énd÷±ëØm©6_º+Éö–.b÷°kØ-ì¿b\kJ㶛‹ê¥& M0ýMSþu ××c…LSIËwž‚•ÖË4%Z°õ8ÆK¾iN¿ümŒÎ¦9~tÕnÛc š³ ƒ!Ë4G©>€aÐÁ4'Oz†#é&ÜfÊôyª ÇOÚd;³dè˜5Íèæ$ÈUB'âÖ͵èÒx.~¨*}ãe'º±… g/<‚D‡ Zó窭¶Ø†Í¤:LO÷[7Ïržli«_›o¥ÌgÉÝJÆM¹kQõ“›wÔím8|ìdc3“0ætrh܌ʵµ ;Íó×ì: +‘¹{Åœc·\P¾¿‰ÅïÙa¾‰;ÚÏœæÆ“Ç7ì­Û±ùÉêEwMWÒ-ê\{º±¡vmåŒq¡d3‰¥»Úð–)m ôð¦IñŠ 7¯c¸Ü‡UàaÚ…koŽ—âæáƇŠ¥œ¹³s24hŒÊ# ³¡Ê±áÕƒ Su·bx¾dK£ w“ŒÞ!Ƀ¤UbÑ¥qxIÞÈl!k)ØQØRiøštì(¬oÄñ·DÂH9**†]1̺È0S1Rº,¢(reèežU#Š#!ÓæŠQ"#Š$¡¶bB¤O¤HS[ªÝD¸ô_þò_6nˆ9=Ò èXÏ=Íi{¬ÁZ=Òóœé~,'y–ë ž{õÏ=¹ó#=¹SpBOî$½§'w6kzØrM›®ia#4-,û°`w›f…-Ól°$Œ51$+¬N³ÁªµšËd­ß’ߨÉ`Û5 l& ×$°¨½š¶BO“ŽÕƒ£ñ šV­¹_cô8h`Ÿæ€UhîW‰ÆkkõˆçL=͙ը`«5ók”Œë4l†&€µ>~n˜[¨ëg4ýk„ƶ_–,0w‚FÃ÷hØT œ×k +Ømb? ™`h- Ê7hØ4è¿TÀ}Ø ¨Ý´šgþÖ8Ž@ñõ§ø¨ü=…âc<4à(½#¶´¥û½k­’¿L>ºÕÚ;ŸÐ¸Ê6Šß˜j[SI¢Ñ®´êª!¢2¶ÆÄNëB«Dº +"](ÅMÅ…SJ.,Åà"n…º.„Æ?YT£4‹2 ¨P,¦*¥¨¨Ì¢ä^ßó<ç¼÷i¢ñOJ¦ò>oó}¦æΧ÷Ü3¿çÜÏý‚Ý“ùE»7ô)zôúУ¸xo =ºÉzôÁУ;íBŽÅÅü¦Ð£¸ ÷³Gqa =ª‹;ÖPèQôçmÖŸÛãÅ^.7ú(è½y‡õæQ`Ýe½y{XèKE¡)"o;ûrØúòV  X½Ý`Ý¿£67f±iKc>ývqÔÇÞ.T|ìí§Ÿw[¼ÛæÝ–¿Ùê“n ›}Òíc‰A$Á* +’ R1(lÛo‚1ÂÚ~¾ÏÚ¾ð¶Ù°õã[ "ƒ@ƒ•?æZòü6dÅI“”AÔ #Oäy_[®øc(êþŠg÷žsv¯9ììÞgvûÄ#®eù£ŽìÙàÈÞ;Žì=íÈ^£Ï?úšÉpMÌ÷ºý¾×iƒ·L•æUçØ{Õ%jóŽ2g#(ÕÇýƒ¿º Váz—nöÏýÞÎp•Îï÷ýŽ»ˆ}Ì™½/<cŸ‡^|“áúž¿ààÞ¢Ýæ/·—Ÿu•ûŠÓ{ »ùKᎱ]mâôñôßÂÓ3Oú¸É»“¸×ü?y€Zé3H¶Ø=r¥%OöF»ãØ}B­MvR®v72}Ät]ow(å‚EÔ¾zí¦u]gw4­«Çîp|u?&½ç“Wwäý)‹”Ëçœx÷hÉ÷ÜîÝ湓S¾]púý9 ¥ÌOŸyb廆À/÷5…Ñc-œ„¯XØeþ–o猋ZÑ‚cf/÷]vëxÒ)ƒî y”æ~ß>r?y°xÛ¤oÇö)ÈÓ¦íáOÝQ*aÛYŸ¯;±½æÛIŸïó¡ô'};êÛ×>$¾ÕçןñmÚ·¯|b|Àf܃`µí°os¾]²iò|ćâ'}›öí”o¿ú€ù°Ñ?ëÛ”oú¶èCç›mâ>üð¶í Ûµ¤ÿÎ×h°{Ù`÷±ÁÔ\éÃ*l.5ÖŽ¤±v&¥†M*m¦´‘Ú›(mžöÆ©¶4-¢ê +¥Ö»'ëÔÿå îA"áü“æ…]?!Ê¡þ97ÆÆé +Æü±mNöOùvÁܲ ¬Œï?e.t>æOÝ|×´¦?.Ñ·gÅ|ê l;çæÚ^{"gPŠö`ÎË}þ`ÎIßN¸å6dO ÂѶ܀ô‡uNúvÜ,×ÜàÏìÜëÛŒogíisá¿oð|Í·“|˜¼ÏŸßù¤oG}ûÚ}ó­îå=ãÛ´o_ù3ê¬>nõ°Õ9«—ÌjA±ç +N£œBù5(°¢¨egqѳbéÉÊuUþÅðw. ägQ¦P>DÁ„øoá:‚±»¬Ø¨íMµÊjÅ7Ù–¼ÓߺޮÇ|;íÛE 0´@—ŠÕ «¬±úÕ« «MXƒ8ÛQª((ûQ¢¼‰2ƒò>Ê,Ê&(‰ŽP"MP2 ^¡ìÓµ’w·’Ç·’Øî¶û‰©×ØîC¦eê]¦ž¦|ÎÔûL=Qù¤òMS/Uþ*¼Öîñ¯óã÷»Ðòž”w¨‡J³t;7òmNhé‹Nµx¦pP駖îêt‹ó:⩤—Z<ÚÃ-þ-Ü\z»¥ÓKß.0=áÒ!¦_ÜçY¦'[œeøÌtKÚi7¨éW—î5¼l:Û¥Ï=äOŽ:áV¸;ânÓ/§{N/½tÖá³Óu¼[òtèé×Ó½§—Og¿ôùáúó3~"ÀÏ:~Uù§_o¨­&vµõd{?¦}ØÞƒiÿ¥½—šê¹ÔMÍRõ› ÕÔdU¯¡Ïº‡pMB²7§£å9B4z¢‡¯t š¨¥¥Jƒv븛¯¥Kc6-MÛÒÂ…¡K{·4{aýÊ ŽÆ°lb˜Æ´KCö2ÍfZÏr¢£1m65MëÒ†¡M{›f·¼ïh…›1N›œ¦9-ôÒPßæ–yÏ=÷q² Œøvû*]«8¾µìÛU¿åê|Ûf‹¦MvÈ d3’7gÙbô˜§¢ï<œ…o³«¡>‰¾•`ŠðAá„ … +?Ž(<0Œ°EaŒ€f„7 +wú( ÀðH ’r„O¥°#¼¨%Ká—@1dͦ dè&à  œ@:v +óò ôpÑî"ëÿz?~‡ˆ H ž@$“€&qM›D9 vó$ôI”@(ñP¢DG ’Š+%fJè”*Tñ©ÄU ¯e%Ø*ΕØ+!X1±Dd ÌŠŸ%NK¸–¨­È[‚¸Är éŠÙ%ÂK —x¯h_¿D 5,Š˜P1cÇÄ #M'©ü0Ée‚ÌN5W³¬Ò"¯úç’V;¯ñþâ׸œë“nݸˆ #(fP ¡˜B1†bѪbÅ&¢MÅ,ŠaD›ŠmD›Šyÿˆ‰')f- +ŽRL%Zœ%xK±—à0Ác‚ËD{‚Ó¯)v'xNphÏîñ¯ïã'ÿ@‚lI ’”ä*IY’¹$I“t&YM’›ä8Iu’ñ$ñIþS8(éP²¢$GÉ‘ ++%eJæ”*yTᩤUÉ® +e%ÙJÎUØ+)X2±$dÌ’Ÿ%MK¶V¨-É[r¸¤ré’Ù%ÁKž—t¯`_Á¿dI“&5L†˜D±cÇ$ P¾bÆÊÿÊÓÊöø½–L'™J2Žp›$3Hæ ˜<2u$a$Yðþ—<,‘Á{\òC²ïeÉ È É +H +H ¼O!!  v›ÜÞP+º?{g~vŸmá ‹æ^4£É}Mòk²_“þšügcÀÈ%(Q@  `ü€Ò”NÀ°e(Ë€ÑJ:Pòƒ”‹ œå&(GA¹ +ÊYPî‚r”Ë œå6(ÇA¹ÊyPîƒr Æ™ ±Ëc"ªˆŒ€!‚gHÛ;ï¼3ð®À;ï¼p…ÂÙÇgggggâggóZþÃAV@U¹ŠP¬@ÌPð@L"ˆÙ1­ æÄDƒ˜qPÆ”Q1¡ L(C’d…$o¡ÓÚ´¶ÅþÚÛ W +8S-*%  +×ÈÑW`ÿaŸÇHóùØüq¦?Nùǹÿ˜³ʸ€2B ¦ +”Aeø@’HäÔzj²e1ÊB”e(›Ö ¬@éFéD¼҄ЂҀÐÒ|ÒzÐxÒvx‰¤åðRA¿A»A·A¯A«A§a&Ëþ>Þ]tâÿà'Î +ÜÏî +òª¢¡öqθqæ]3ð‰ç€<Çå9<¯YzÍÖkÖž£÷Ä×\¾æô9¶¯)~MõsÈ_3ÿÊ`$€” % +(a@‰J P" +”X %(á@‰J@P"‚”˜ *„ÛŒðÂf˜+ÄëŒ9C¼Öý»‹µýOÅãdžéå£YøÿVHøã¯áRAâ eÕß—<»<”ç >tƒ<[í÷{_3Þžj³züÍøÌ¿ýuÖD®MKý$ͱ¹kÕ¸ÜBÞŽo®XéwIòK̃©eŸþéëß_Ø? ­¿ôe¿~à¯\øõWö;||jžÁ² \ No newline at end of file diff -Naur mxml-2.6/doc/makedocs.sh mxml-2.6-haiku/doc/makedocs.sh --- mxml-2.6/doc/makedocs.sh 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/makedocs.sh 2007-09-09 07:16:52.000000000 +0000 @@ -0,0 +1,30 @@ +#!/bin/sh +# +# "$Id: makedocs.sh 297 2007-09-09 07:16:52Z mike $" +# +# Script to make documentation... +# +# Copyright 2003-2007 by Michael Sweet. +# +# This program is free software; you can redistribute it and/or +# modify it under the terms of the GNU Library General Public +# License as published by the Free Software Foundation; either +# version 2, or (at your option) any later version. +# +# This program is distributed in the hope that it will be useful, +# but WITHOUT ANY WARRANTY; without even the implied warranty of +# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +# GNU General Public License for more details. +# + +htmldoc --verbose --path "hires;." --batch mxml.book -f mxml.pdf + +htmldoc --verbose --batch mxml.book --no-title -f mxml.html + +rm -rf mxml.d +mkdir mxml.d +htmldoc --verbose --batch mxml.book --no-title -t html -d mxml.d + +# +# End of "$Id: makedocs.sh 297 2007-09-09 07:16:52Z mike $". +# diff -Naur mxml-2.6/doc/mxml.book mxml-2.6-haiku/doc/mxml.book --- mxml-2.6/doc/mxml.book 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/mxml.book 2008-01-25 07:50:40.000000000 +0000 @@ -0,0 +1,11 @@ +#HTMLDOC 1.8.27.1 +-t pdf14 -f "mxml.pdf" --book --toclevels 3 --no-numbered --toctitle "Table of Contents" --title --titleimage "title.html" --linkstyle plain --size 4.25x6.875in --left 0.750in --right 0.50in --top 0.50in --bottom 0.50in --header .t. --header1 ... --footer h.1 --nup 1 --tocheader .t. --tocfooter ..i --duplex --portrait --color --no-pscommands --no-xrxcomments --compression=9 --jpeg=95 --fontsize 9.0 --fontspacing 1.2 --headingfont Helvetica --bodyfont Helvetica --headfootsize 8.0 --headfootfont Helvetica-Oblique --charset iso-8859-1 --links --embedfonts --pagemode outline --pagelayout single --firstpage c1 --pageeffect none --pageduration 10 --effectduration 1.0 --no-encryption --permissions all --owner-password "" --user-password "" --browserwidth 300 --no-strict --no-overflow +intro.html +install.html +basics.html +advanced.html +mxmldoc.html +license.html +relnotes.html +reference.html +schema.html diff -Naur mxml-2.6/doc/mxml.html mxml-2.6-haiku/doc/mxml.html --- mxml-2.6/doc/mxml.html 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/mxml.html 2009-05-17 17:31:51.000000000 +0000 @@ -0,0 +1,3952 @@ + + + +Mini-XML Programmers Manual, Version 2.6 + + + + + + +

Table of Contents

+
+
Introduction + +Building, Installing, and Packaging Mini-XML + +Getting Started with Mini-XML + +More Mini-XML Programming Techniques + +Using the mxmldoc Utility + +Mini-XML License +
+
Release Notes +
    +Library Reference + +XML Schema +
      +
      +

      0Introduction

      +

      This programmers manual describes Mini-XML version 2.6, a small XML + parsing library that you can use to read and write XML data files in + your C and C++ applications.

      +

      Mini-XML was initially developed for the +Gutenprint project to replace the rather large and unwieldy +libxml2 library with something substantially smaller and + easier-to-use. It all began one morning in June of 2003 when Robert + posted the following sentence to the developer's list:

      +
      It's bad enough that we require libxml2, but rolling our + own XML parser is a bit more than we can handle.
      +

      I then replied with:

      +
      Given the limited scope of what you use in XML, it + should be trivial to code a mini-XML API in a few hundred lines of + code.
      +

      I took my own challenge and coded furiously for two days to produced + the initial public release of Mini-XML, total lines of code: 696. + Robert promptly integrated Mini-XML into Gutenprint and removed + libxml2.

      +

      Thanks to lots of feedback and support from various developers, + Mini-XML has evolved since then to provide a more complete XML + implementation and now stands at a whopping 3,441 lines of code, + compared to 103,893 lines of code for libxml2 version 2.6.9.

      +

      Aside from Gutenprint, Mini-XML is used for the following + projects/software applications:

      + +

      Please email me (mxml @ easysw . com) if you would like your project + added or removed from this list, or if you have any comments/quotes you + would like me to publish about your experiences with Mini-XML.

      + + +

      Organization of This Document

      +

      This manual is organized into the following chapters and appendices:

      + + + +

      Notation Conventions

      +

      Various font and syntax conventions are used in this guide. Examples + and their meanings and uses are explained below:

      +
      +
      mxmldoc +
      mxmldoc(1)
      +
      The names of commands; the first mention of a command or function in + a chapter is followed by a manual page section number. +
      +
      +
      /var +
      /etc/hosts
      +
      File and directory names. +
      +
      +
      Request ID is Printer-123
      +
      Screen output. +
      +
      +
      lp -d printer filename ENTER
      +
      Literal user input; special keys like ENTER are in ALL + CAPS. +
      +
      +
      12.3
      +
      Numbers in the text are written using the period (.) to indicate the + decimal point. +
      +
      +
      + + +

      Abbreviations

      +

      The following abbreviations are used throughout this manual:

      +
      +
      Gb
      +
      Gigabytes, or 1073741824 bytes +
      +
      +
      kb
      +
      Kilobytes, or 1024 bytes +
      +
      +
      Mb
      +
      Megabytes, or 1048576 bytes +
      +
      +
      UTF-8, UTF-16
      +
      Unicode Transformation Format, 8-bit or 16-bit +
      +
      +
      W3C
      +
      World Wide Web Consortium +
      +
      +
      XML
      +
      Extensible Markup Language +
      +
      +
      + + +

      Other References

      +
      +
      The Unicode Standard, Version 4.0, Addison-Wesley, ISBN + 0-321-18578-1
      +
      The definition of the Unicode character set which is used for XML. +
      +
      +
      Extensible + Markup Language (XML) 1.0 (Third Edition)
      +
      The XML specification from the World Wide Web Consortium (W3C) +
      +
      +
      + + +

      Legal Stuff

      +

      The Mini-XML library is copyright 2003-2009 by Michael Sweet. License + terms are described in Appendix A - Mini-XML License +.

      +
      +

      1Building, Installing, and + Packaging Mini-XML

      +

      This chapter describes how to build, install, and package Mini-XML on + your system from the source archive. You will need an ANSI/ISO-C + compatible compiler to build Mini-XML - GCC works, as do most vendors' + C compilers. If you are building Mini-XML on Windows, we recommend + using the Visual C++ environment with the supplied solution file. For + other operating systems, you'll need a POSIX-compatible shell and +make program in addition to the C compiler.

      +

      Compiling Mini-XML

      +

      Mini-XML comes with both an autoconf-based configure script and a + Visual C++ solution that can be used to compile the library and + associated tools.

      +

      Compiling with Visual C++

      +

      Open the mxml.sln solution in the vcnet folder. + Choose the desired build configuration, "Debug" (the default) or + "Release", and then choose Build Solution from the + Build menu.

      +

      Compiling with Command-Line Tools

      +

      Type the following command to configure the Mini-XML source code for + your system:

      +
      +    ./configure ENTER
+
      +

      The default install prefix is /usr/local, which can be + overridden using the --prefix option:

      +
      +    ./configure --prefix=/foo ENTER
+
      +

      Other configure options can be found using the --help + option:

      +
      +    ./configure --help ENTER
+
      +

      Once you have configured the software, use the make(1) + program to do the build and run the test program to verify that things + are working, as follows:

      +
      +    make ENTER
+
      +

      Installing Mini-XML

      +

      If you are using Visual C++, copy the mxml.lib and and + mxml.h files to the Visual C++ lib and include + directories, respectively.

      +

      Otherwise, use the make command with the install + target to install Mini-XML in the configured directories:

      +
      +    make install ENTER
+
      +

      Creating Mini-XML Packages

      +

      Mini-XML includes two files that can be used to create binary + packages. The first file is mxml.spec which is used by the +rpmbuild(8) software to create Red Hat Package Manager ("RPM") + packages which are commonly used on Linux. Since rpmbuild + wants to compile the software on its own, you can provide it with the + Mini-XML tar file to build the package:

      +
      +    rpmbuild -ta mxml-version.tar.gz ENTER
+
      +

      The second file is mxml.list which is used by the +epm(1) program to create software packages in a variety of formats. + The epm program is available from the following URL:

      +
      +    http://www.easysw.com/epm/
+
      +

      Use the make command with the epm target to + create portable and native packages for your system:

      +
      +    make epm ENTER
+
      +

      The packages are stored in a subdirectory named dist for + your convenience. The portable packages utilize scripts and tar files + to install the software on the target system. After extracting the + package archive, use the mxml.install script to install the + software.

      +

      The native packages will be in the local OS's native format: RPM for + Red Hat Linux, DPKG for Debian Linux, PKG for Solaris, and so forth. + Use the corresponding commands to install the native packages.

      +
      +

      2Getting Started with Mini-XML

      +

      This chapter describes how to write programs that use Mini-XML to + access data in an XML file. Mini-XML provides the following + functionality:

      +
        +
      • Functions for creating and managing XML documents in memory.
        • +
      • Reading of UTF-8 and UTF-16 encoded XML files and strings.
        • +
      • Writing of UTF-8 encoded XML files and strings.
        • +
      • Support for arbitrary element names, attributes, and attribute + values with no preset limits, just available memory.
        • +
      • Support for integer, real, opaque ("cdata"), and text data types in + "leaf" nodes.
        • +
      • "Find", "index", and "walk" functions for easily accessing data in + an XML document.
        • +
      +

      Mini-XML doesn't do validation or other types of processing on the + data based upon schema files or other sources of definition + information, nor does it support character entities other than those + required by the XML specification.

      +

      The Basics

      +

      Mini-XML provides a single header file which you include:

      +
      +    #include <mxml.h>
+
      +

      The Mini-XML library is included with your program using the +-lmxml option:

      +
      +    gcc -o myprogram myprogram.c -lmxml ENTER
+
      +

      If you have the pkg-config(1) software installed, you can + use it to determine the proper compiler and linker options for your + installation:

      +
      +    pkg-config --cflags mxml ENTER
+    pkg-config --libs mxml ENTER
+
      +

      Nodes

      +

      Every piece of information in an XML file (elements, text, numbers) + is stored in memory in "nodes". Nodes are defined by the +mxml_node_t structure. The type + member defines the node type (element, integer, opaque, real, or + text) which determines which value you want to look at in the +value union.

      + + +
      + + + + + + + + + +
      Table 2-1: Mini-XML Node Value + Members
      ValueTypeNode member
      Customvoid * +node->value.custom.data
      Elementchar * +node->value.element.name
      Integerintnode->value.integer +
      Opaque (string)char * +node->value.opaque
      Realdoublenode->value.real
      Textchar *node->value.text.string +
      +
      +

      Each node also has a user_data member which allows you to + associate application-specific data with each node as needed.

      +

      New nodes are created using the +mxmlNewElement, mxmlNewInteger +, mxmlNewOpaque, +mxmlNewReal, mxmlNewText + mxmlNewTextf +mxmlNewXML functions. Only elements can have child nodes, + and the top node must be an element, usually the <?xml + version="1.0"?> node created by mxmlNewXML().

      +

      Nodes have pointers to the node above (parent), below ( +child), left (prev), and right (next) of the + current node. If you have an XML file like the following:

      +
      +    <?xml version="1.0"?>
+    <data>
+        <node>val1</node>
+        <node>val2</node>
+        <node>val3</node>
+        <group>
+            <node>val4</node>
+            <node>val5</node>
+            <node>val6</node>
+        </group>
+        <node>val7</node>
+        <node>val8</node>
+    </data>
+
      +

      the node tree for the file would look like the following in memory:

      +
      +    ?xml
+      |
+    data
+      |
+    node - node - node - group - node - node
+      |      |      |      |       |      |
+    val1   val2   val3     |     val7   val8
+                           |
+                         node - node - node
+                           |      |      |
+                         val4   val5   val6
+
      +

      where "-" is a pointer to the next node and "|" is a pointer to the + first child node.

      +

      Once you are done with the XML data, use the +mxmlDelete function to recursively free the memory that is used + for a particular node or the entire tree:

      +
      +    mxmlDelete(tree);
+
      + + +

      Creating XML Documents

      +

      You can create and update XML documents in memory using the various +mxmlNew functions. The following code will create the XML document + described in the previous section:

      +
      +    mxml_node_t *xml;    /* <?xml ... ?> */
+    mxml_node_t *data;   /* <data> */
+    mxml_node_t *node;   /* <node> */
+    mxml_node_t *group;  /* <group> */
+
+    xml = mxmlNewXML("1.0");
+
+    data = mxmlNewElement(xml, "data");
+
+        node = mxmlNewElement(data, "node");
+        mxmlNewText(node, 0, "val1");
+        node = mxmlNewElement(data, "node");
+        mxmlNewText(node, 0, "val2");
+        node = mxmlNewElement(data, "node");
+        mxmlNewText(node, 0, "val3");
+
+        group = mxmlNewElement(data, "group");
+
+            node = mxmlNewElement(group, "node");
+            mxmlNewText(node, 0, "val4");
+            node = mxmlNewElement(group, "node");
+            mxmlNewText(node, 0, "val5");
+            node = mxmlNewElement(group, "node");
+            mxmlNewText(node, 0, "val6");
+
+        node = mxmlNewElement(data, "node");
+        mxmlNewText(node, 0, "val7");
+        node = mxmlNewElement(data, "node");
+        mxmlNewText(node, 0, "val8");
+
      +

      We start by creating the <?xml version="1.0"?> node common + to all XML files using the mxmlNewXML + function:

      +
      +    xml = mxmlNewXML("1.0");
+
      +

      We then create the <data> node used for this document using + the mxmlNewElement function. The + first argument specifies the parent node (xml) while the + second specifies the element name (data):

      +
      +    data = mxmlNewElement(xml, "data");
+
      +

      Each <node>...</node> in the file is created using the +mxmlNewElement and mxmlNewText + functions. The first argument of mxmlNewText specifies the + parent node (node). The second argument specifies whether + whitespace appears before the text - 0 or false in this case. The last + argument specifies the actual text to add:

      +
      +    node = mxmlNewElement(data, "node");
+    mxmlNewText(node, 0, "val1");
+
      +

      The resulting in-memory XML document can then be saved or processed + just like one loaded from disk or a string.

      + + +

      Loading XML

      +

      You load an XML file using the +mxmlLoadFile function:

      +
      +    FILE *fp;
+    mxml_node_t *tree;
+
+    fp = fopen("filename.xml", "r");
+    tree = mxmlLoadFile(NULL, fp,
+                        MXML_TEXT_CALLBACK);
+    fclose(fp);
+
      +

      The first argument specifies an existing XML parent node, if any. + Normally you will pass NULL for this argument unless you are + combining multiple XML sources. The XML file must contain a complete + XML document including the ?xml element if the parent node is +NULL.

      +

      The second argument specifies the stdio file to read from, as opened + by fopen() or popen(). You can also use stdin + if you are implementing an XML filter program.

      +

      The third argument specifies a callback function which returns the + value type of the immediate children for a new element node: +MXML_CUSTOM, MXML_IGNORE, MXML_INTEGER, +MXML_OPAQUE, MXML_REAL, or MXML_TEXT. Load + callbacks are described in detail in Chapter + 3. The example code uses the MXML_TEXT_CALLBACK constant + which specifies that all data nodes in the document contain + whitespace-separated text values. Other standard callbacks include +MXML_IGNORE_CALLBACK, MXML_INTEGER_CALLBACK, +MXML_OPAQUE_CALLBACK, and MXML_REAL_CALLBACK.

      +

      The mxmlLoadString function + loads XML node trees from a string:

      + + +
      +    char buffer[8192];
+    mxml_node_t *tree;
+
+    ...
+    tree = mxmlLoadString(NULL, buffer,
+                          MXML_TEXT_CALLBACK);
+
      +

      The first and third arguments are the same as used for +mxmlLoadFile(). The second argument specifies the string or + character buffer to load and must be a complete XML document including + the ?xml element if the parent node is NULL.

      + + +

      Saving XML

      +

      You save an XML file using the +mxmlSaveFile function:

      +
      +    FILE *fp;
+    mxml_node_t *tree;
+
+    fp = fopen("filename.xml", "w");
+    mxmlSaveFile(tree, fp, MXML_NO_CALLBACK);
+    fclose(fp);
+
      +

      The first argument is the XML node tree to save. It should normally + be a pointer to the top-level ?xml node in your XML document.

      +

      The second argument is the stdio file to write to, as opened by +fopen() or popen(). You can also use stdout if + you are implementing an XML filter program.

      +

      The third argument is the whitespace callback to use when saving the + file. Whitespace callbacks are covered in detail in +Chapter 3. The previous example code uses the MXML_NO_CALLBACK + constant to specify that no special whitespace handling is required.

      +

      The mxmlSaveAllocString, + and mxmlSaveString functions + save XML node trees to strings:

      +
      +    char buffer[8192];
+    char *ptr;
+    mxml_node_t *tree;
+
+    ...
+    mxmlSaveString(tree, buffer, sizeof(buffer),
+                   MXML_NO_CALLBACK);
+
+    ...
+    ptr = mxmlSaveAllocString(tree, MXML_NO_CALLBACK);
+
      +

      The first and last arguments are the same as used for +mxmlSaveFile(). The mxmlSaveString function takes pointer + and size arguments for saving the XML document to a fixed-size buffer, + while mxmlSaveAllocString() returns a string buffer that was + allocated using malloc().

      +

      Controlling Line Wrapping

      +

      When saving XML documents, Mini-XML normally wraps output lines at + column 75 so that the text is readable in terminal windows. The +mxmlSetWrapMargin function overrides the default wrap + margin:

      +
      +    /* Set the margin to 132 columns */
+    mxmlSetWrapMargin(132);
+
+    /* Disable wrapping */
+    mxmlSetWrapMargin(0);
+
      + + +

      Finding and Iterating Nodes

      +

      The mxmlWalkPrev and +mxmlWalkNextfunctions can be used to iterate through the + XML node tree:

      +
      +    mxml_node_t *node;
+    
+    node = mxmlWalkPrev(current, tree,
+                        MXML_DESCEND);
+
+    node = mxmlWalkNext(current, tree,
+                        MXML_DESCEND);
+
      +

      In addition, you can find a named element/node using the +mxmlFindElement function:

      +
      +    mxml_node_t *node;
+    
+    node = mxmlFindElement(tree, tree, "name",
+                           "attr", "value",
+                           MXML_DESCEND);
+
      +

      The name, attr, and value arguments can be + passed as NULL to act as wildcards, e.g.:

      + + +
      +    /* Find the first "a" element */
+    node = mxmlFindElement(tree, tree, "a",
+                           NULL, NULL,
+                           MXML_DESCEND);
+
      + + +
      +    /* Find the first "a" element with "href"
+       attribute */
+    node = mxmlFindElement(tree, tree, "a",
+                           "href", NULL,
+                           MXML_DESCEND);
+
      + + +
      +    /* Find the first "a" element with "href"
+       to a URL */
+    node = mxmlFindElement(tree, tree, "a",
+                           "href",
+                           "http://www.easysw.com/",
+                           MXML_DESCEND);
+
      + + +
      +    /* Find the first element with a "src"
+       attribute */
+    node = mxmlFindElement(tree, tree, NULL,
+                           "src", NULL,
+                           MXML_DESCEND);
+
      + + +
      +    /* Find the first element with a "src"
+       = "foo.jpg" */
+    node = mxmlFindElement(tree, tree, NULL,
+                           "src", "foo.jpg",
+                           MXML_DESCEND);
+
      +

      You can also iterate with the same function:

      +
      +    mxml_node_t *node;
+
+    for (node = mxmlFindElement(tree, tree,
+                                "name",
+                                NULL, NULL,
+                                MXML_DESCEND);
+         node != NULL;
+         node = mxmlFindElement(node, tree,
+                                "name",
+                                NULL, NULL,
+                                MXML_DESCEND))
+    {
+      ... do something ...
+    }
+
      + + +

      The MXML_DESCEND argument can actually be one of three + constants:

      +
        +
      • MXML_NO_DESCEND means to not to look at any child nodes in + the element hierarchy, just look at siblings at the same level or + parent nodes until the top node or top-of-tree is reached. +

        The previous node from "group" would be the "node" element to the + left, while the next node from "group" would be the "node" element to + the right. +
        +

        +
        • +
      • MXML_DESCEND_FIRST means that it is OK to descend to the + first child of a node, but not to descend further when searching. + You'll normally use this when iterating through direct children of a + parent node, e.g. all of the "node" and "group" elements under the + "?xml" parent node in the example above. +

        This mode is only applicable to the search function; the walk + functions treat this as MXML_DESCEND since every call is a + first time. +
        +

        +
        • +
      • MXML_DESCEND means to keep descending until you hit the + bottom of the tree. The previous node from "group" would be the "val3" + node and the next node would be the first node element under "group". +

        If you were to walk from the root node "?xml" to the end of the tree + with mxmlWalkNext(), the order would be:

        +

        ?xml data node val1 node val2 node val3 group node val4 node val5 + node val6 node val7 node val8

        +

        If you started at "val8" and walked using mxmlWalkPrev(), + the order would be reversed, ending at "?xml".

        +
        • +
      +
      +

      3More Mini-XML Programming + Techniques

      +

      This chapter shows additional ways to use the Mini-XML library in + your programs.

      +

      Load Callbacks

      +

      Chapter 2 introduced the +mxmlLoadFile() and +mxmlLoadString() functions. The last argument to these + functions is a callback function which is used to determine the value + type of each data node in an XML document.

      +

      Mini-XML defines several standard callbacks for simple XML data + files:

      +
        +
      • MXML_INTEGER_CALLBACK - All data nodes contain + whitespace-separated integers.
        • +
      • MXML_OPAQUE_CALLBACK - All data nodes contain opaque + strings ("CDATA").
        • +
      • MXML_REAL_CALLBACK - All data nodes contain + whitespace-separated floating-point numbers.
        • +
      • MXML_TEXT_CALLBACK - All data nodes contain + whitespace-separated strings.
        • +
      +

      You can provide your own callback functions for more complex XML + documents. Your callback function will receive a pointer to the current + element node and must return the value type of the immediate children + for that element node: MXML_INTEGER, MXML_OPAQUE, +MXML_REAL, or MXML_TEXT. The function is called after + the element and its attributes have been read, so you can look at the + element name, attributes, and attribute values to determine the proper + value type to return.

      + + +

      The following callback function looks for an attribute named "type" + or the element name to determine the value type for its child nodes:

      +
      +    mxml_type_t
+    type_cb(mxml_node_t *node)
+    {
+      const char *type;
+
+     /*
+      * You can lookup attributes and/or use the
+      * element name, hierarchy, etc...
+      */
+
+      type = mxmlElementGetAttr(node, "type");
+      if (type == NULL)
+	type = node->value.element.name;
+
+      if (!strcmp(type, "integer"))
+	return (MXML_INTEGER);
+      else if (!strcmp(type, "opaque"))
+	return (MXML_OPAQUE);
+      else if (!strcmp(type, "real"))
+	return (MXML_REAL);
+      else
+	return (MXML_TEXT);
+    }
+
      +

      To use this callback function, simply use the name when you call any + of the load functions:

      +
      +    FILE *fp;
+    mxml_node_t *tree;
+
+    fp = fopen("filename.xml", "r");
+    tree = mxmlLoadFile(NULL, fp, type_cb);
+    fclose(fp);
+
      +

      Save Callbacks

      +

      Chapter 2 also introduced the +mxmlSaveFile(), +mxmlSaveString(), and +mxmlSaveAllocString() functions. The last argument to these + functions is a callback function which is used to automatically insert + whitespace in an XML document.

      +

      Your callback function will be called up to four times for each + element node with a pointer to the node and a "where" value of +MXML_WS_BEFORE_OPEN, MXML_WS_AFTER_OPEN, +MXML_WS_BEFORE_CLOSE, or MXML_WS_AFTER_CLOSE. The callback + function should return NULL if no whitespace should be added + and the string to insert (spaces, tabs, carriage returns, and newlines) + otherwise.

      +

      The following whitespace callback can be used to add whitespace to + XHTML output to make it more readable in a standard text editor:

      +
      +    const char *
+    whitespace_cb(mxml_node_t *node,
+                  int where)
+    {
+      const char *name;
+
+     /*
+      * We can conditionally break to a new line
+      * before or after any element. These are
+      * just common HTML elements...
+      */
+
+      name = node->value.element.name;
+
+      if (!strcmp(name, "html") ||
+          !strcmp(name, "head") ||
+          !strcmp(name, "body") ||
+	  !strcmp(name, "pre") ||
+          !strcmp(name, "p") ||
+	  !strcmp(name, "h1") ||
+          !strcmp(name, "h2") ||
+          !strcmp(name, "h3") ||
+	  !strcmp(name, "h4") ||
+          !strcmp(name, "h5") ||
+          !strcmp(name, "h6"))
+      {
+       /*
+	* Newlines before open and after
+        * close...
+	*/
+
+	if (where == MXML_WS_BEFORE_OPEN ||
+            where == MXML_WS_AFTER_CLOSE)
+	  return ("\n");
+      }
+      else if (!strcmp(name, "dl") ||
+               !strcmp(name, "ol") ||
+               !strcmp(name, "ul"))
+      {
+       /*
+	* Put a newline before and after list
+        * elements...
+	*/
+
+	return ("\n");
+      }
+      else if (!strcmp(name, "dd") ||
+               !strcmp(name, "dt") ||
+               !strcmp(name, "li"))
+      {
+       /*
+	* Put a tab before <li>'s, * <dd>'s,
+        * and <dt>'s, and a newline after them...
+	*/
+
+	if (where == MXML_WS_BEFORE_OPEN)
+	  return ("\t");
+	else if (where == MXML_WS_AFTER_CLOSE)
+	  return ("\n");
+      }
+
+     /*
+      * Return NULL for no added whitespace...
+      */
+
+      return (NULL);
+    }
+
      +

      To use this callback function, simply use the name when you call any + of the save functions:

      +
      +    FILE *fp;
+    mxml_node_t *tree;
+
+    fp = fopen("filename.xml", "w");
+    mxmlSaveFile(tree, fp, whitespace_cb);
+    fclose(fp);
+
      + + +

      Custom Data Types

      +

      Mini-XML supports custom data types via global load and save + callbacks. Only a single set of callbacks can be active at any time, + however your callbacks can store additional information in order to + support multiple custom data types as needed. The MXML_CUSTOM + node type identifies custom data nodes.

      +

      The load callback receives a pointer to the current data node and a + string of opaque character data from the XML source with character + entities converted to the corresponding UTF-8 characters. For example, + if we wanted to support a custom date/time type whose value is encoded + as "yyyy-mm-ddThh:mm:ssZ" (ISO format), the load callback would look + like the following:

      +
      +    typedef struct
+    {
+      unsigned      year,    /* Year */
+                    month,   /* Month */
+                    day,     /* Day */
+                    hour,    /* Hour */
+                    minute,  /* Minute */
+                    second;  /* Second */
+      time_t        unix;    /* UNIX time */
+    } iso_date_time_t;
+
+    int
+    load_custom(mxml_node_t *node,
+                const char *data)
+    {
+      iso_date_time_t *dt;
+      struct tm tmdata;
+
+     /*
+      * Allocate data structure...
+      */
+
+      dt = calloc(1, sizeof(iso_date_time_t));
+
+     /*
+      * Try reading 6 unsigned integers from the
+      * data string...
+      */
+
+      if (sscanf(data, "%u-%u-%uT%u:%u:%uZ",
+                 &(dt->year), &(dt->month),
+                 &(dt->day), &(dt->hour),
+                 &(dt->minute),
+                 &(dt->second)) != 6)
+      {
+       /*
+        * Unable to read numbers, free the data
+        * structure and return an error...
+        */
+
+        free(dt);
+
+        return (-1);
+      }
+
+     /*
+      * Range check values...
+      */
+
+      if (dt->month <1 || dt->month > 12 ||
+          dt->day  <1 || dt->day > 31 ||
+          dt->hour  <0 || dt->hour > 23 ||
+          dt->minute  <0 || dt->minute > 59 ||
+          dt->second  <0 || dt->second > 59)
+      {
+       /*
+        * Date information is out of range...
+        */
+
+        free(dt);
+
+        return (-1);
+      }
+
+     /*
+      * Convert ISO time to UNIX time in
+      * seconds...
+      */
+
+      tmdata.tm_year = dt->year - 1900;
+      tmdata.tm_mon  = dt->month - 1;
+      tmdata.tm_day  = dt->day;
+      tmdata.tm_hour = dt->hour;
+      tmdata.tm_min  = dt->minute;
+      tmdata.tm_sec  = dt->second;
+
+      dt->unix = gmtime(&tmdata);
+
+     /*
+      * Assign custom node data and destroy
+      * function pointers...
+      */
+
+      node->value.custom.data    = dt;
+      node->value.custom.destroy = free;
+
+     /*
+      * Return with no errors...
+      */
+
+      return (0);
+    }
+
      +

      The function itself can return 0 on success or -1 if it is unable to + decode the custom data or the data contains an error. Custom data nodes + contain a void pointer to the allocated custom data for the + node and a pointer to a destructor function which will free the custom + data when the node is deleted.

      +

      The save callback receives the node pointer and returns an allocated + string containing the custom data value. The following save callback + could be used for our ISO date/time type:

      +
      +    char *
+    save_custom(mxml_node_t *node)
+    {
+      char data[255];
+      iso_date_time_t *dt;
+
+
+      dt = (iso_date_time_t *)node->custom.data;
+
+      snprintf(data, sizeof(data),
+               "%04u-%02u-%02uT%02u:%02u:%02uZ",
+               dt->year, dt->month, dt->day,
+               dt->hour, dt->minute, dt->second);
+
+      return (strdup(data));
+    }
+
      +

      You register the callback functions using the +mxmlSetCustomHandlers() function:

      +
      +    mxmlSetCustomHandlers(load_custom,
+                          save_custom);
+
      + + +

      Changing Node Values

      +

      All of the examples so far have concentrated on creating and loading + new XML data nodes. Many applications, however, need to manipulate or + change the nodes during their operation, so Mini-XML provides functions + to change node values safely and without leaking memory.

      +

      Existing nodes can be changed using the +mxmlSetElement(), +mxmlSetInteger(), mxmlSetOpaque() +, mxmlSetReal(), +mxmlSetText(), and +mxmlSetTextf() functions. For example, use the following + function call to change a text node to contain the text "new" with + leading whitespace:

      +
      +    mxml_node_t *node;
+
+    mxmlSetText(node, 1, "new");
+
      +

      Formatted Text

      +

      The mxmlNewTextf() and +mxmlSetTextf() functions create and change text nodes, + respectively, using printf-style format strings and arguments. + For example, use the following function call to create a new text node + containing a constructed filename:

      +
      +    mxml_node_t *node;
+
+    node = mxmlNewTextf(node, 1, "%s/%s",
+                        path, filename);
+
      +

      Indexing

      +

      Mini-XML provides functions for managing indices of nodes. The + current implementation provides the same functionality as +mxmlFindElement(). The advantage of using an index is that + searching and enumeration of elements is significantly faster. The only + disadvantage is that each index is a static snapshot of the XML + document, so indices are not well suited to XML data that is updated + more often than it is searched. The overhead of creating an index is + approximately equal to walking the XML document tree. Nodes in the + index are sorted by element name and attribute value.

      +

      Indices are stored in mxml_index_t + structures. The mxmlIndexNew() + function creates a new index:

      +
      +    mxml_node_t *tree;
+    mxml_index_t *ind;
+
+    ind = mxmlIndexNew(tree, "element",
+                       "attribute");
+
      +

      The first argument is the XML node tree to index. Normally this will + be a pointer to the ?xml element.

      +

      The second argument contains the element to index; passing NULL + indexes all element nodes alphabetically.

      +

      The third argument contains the attribute to index; passing NULL + causes only the element name to be indexed.

      +

      Once the index is created, the +mxmlIndexEnum(), mxmlIndexFind() +, and mxmlIndexReset() + functions are used to access the nodes in the index. The +mxmlIndexReset() function resets the "current" node pointer + in the index, allowing you to do new searches and enumerations on the + same index. Typically you will call this function prior to your calls + to mxmlIndexEnum() and +mxmlIndexFind().

      +

      The mxmlIndexEnum() function + enumerates each of the nodes in the index and can be used in a loop as + follows:

      +
      +    mxml_node_t *node;
+
+    mxmlIndexReset(ind);
+
+    while ((node = mxmlIndexEnum(ind)) != NULL)
+    {
+      // do something with node
+    }
+
      +

      The mxmlIndexFind() function + locates the next occurrence of the named element and attribute value in + the index. It can be used to find all matching elements in an index, as + follows:

      +
      +    mxml_node_t *node;
+
+    mxmlIndexReset(ind);
+
+    while ((node = mxmlIndexFind(ind, "element",
+                                 "attr-value"))
+                != NULL)
+    {
+      // do something with node
+    }
+
      +

      The second and third arguments represent the element name and + attribute value, respectively. A NULL pointer is used to + return all elements or attributes in the index. Passing NULL + for both the element name and attribute value is equivalent to calling +mxmlIndexEnum.

      +

      When you are done using the index, delete it using the +mxmlIndexDelete() function:

      +
      +    mxmlIndexDelete(ind);
+
      +

      SAX (Stream) Loading of Documents

      +

      Mini-XML supports an implementation of the Simple API for XML (SAX) + which allows you to load and process an XML document as a stream of + nodes. Aside from allowing you to process XML documents of any size, + the Mini-XML implementation also allows you to retain portions of the + document in memory for later processing.

      +

      The mxmlSAXLoadFd, +mxmlSAXLoadFile, and +mxmlSAXLoadString functions provide the SAX loading APIs. Each + function works like the corresponding mxmlLoad function but + uses a callback to process each node as it is read.

      +

      The callback function receives the node, an event code, and a user + data pointer you supply:

      +
      +    void
+    sax_cb(mxml_node_t *node,
+           mxml_sax_event_t event,
+           void *data)
+    {
+      ... do something ...
+    }
+
      +

      The event will be one of the following:

      +
        +
      • MXML_SAX_CDATA - CDATA was just read
        • +
      • MXML_SAX_COMMENT - A comment was just read
        • +
      • MXML_SAX_DATA - Data (custom, integer, opaque, real, or + text) was just read
        • +
      • MXML_SAX_DIRECTIVE - A processing directive was just read
        • +
      • MXML_SAX_ELEMENT_CLOSE - A close element was just read ( +</element>)
        • +
      • MXML_SAX_ELEMENT_OPEN - An open element was just read ( +<element>)
        • +
      +

      Elements are released after the close element is processed. + All other nodes are released after they are processed. The SAX callback + can retain the node using the +mxmlRetain function. For example, the following SAX callback + will retain all nodes, effectively simulating a normal in-memory load:

      +
      +    void
+    sax_cb(mxml_node_t *node,
+           mxml_sax_event_t event,
+           void *data)
+    {
+      if (event != MXML_SAX_ELEMENT_CLOSE)
+        mxmlRetain(node);
+    }
+
      +

      More typically the SAX callback will only retain a small portion of + the document that is needed for post-processing. For example, the + following SAX callback will retain the title and headings in an XHTML + file. It also retains the (parent) elements like <html>, +<head>, and <body>, and processing directives like +<?xml ... ?> and <!DOCTYPE ... >:

      + + +
      +    void
+    sax_cb(mxml_node_t *node,
+           mxml_sax_event_t event,
+           void *data)
+    {
+      if (event == MXML_SAX_ELEMENT_OPEN)
+      {
+       /*
+        * Retain headings and titles...
+        */
+
+        char *name = node->value.element.name;
+
+        if (!strcmp(name, "html") ||
+            !strcmp(name, "head") ||
+            !strcmp(name, "title") ||
+            !strcmp(name, "body") ||
+            !strcmp(name, "h1") ||
+            !strcmp(name, "h2") ||
+            !strcmp(name, "h3") ||
+            !strcmp(name, "h4") ||
+            !strcmp(name, "h5") ||
+            !strcmp(name, "h6"))
+          mxmlRetain(node);
+      }
+      else if (event == MXML_SAX_DIRECTIVE)
+        mxmlRetain(node);
+      else if (event == MXML_SAX_DATA &&
+               node->parent->ref_count > 1)
+      {
+       /*
+        * If the parent was retained, then retain
+        * this data node as well.
+        */
+
+        mxmlRetain(node);
+      }
+    }
+
      +

      The resulting skeleton document tree can then be searched just like + one loaded using the mxmlLoad functions. For example, a filter + that reads an XHTML document from stdin and then shows the title and + headings in the document would look like:

      +
      +    mxml_node_t *doc, *title, *body, *heading;
+
+    doc = mxmlSAXLoadFd(NULL, 0,
+                        MXML_TEXT_CALLBACK,
+                        sax_cb, NULL);
+
+    title = mxmlFindElement(doc, doc, "title",
+                            NULL, NULL,
+                            MXML_DESCEND);
+
+    if (title)
+      print_children(title);
+
+    body = mxmlFindElement(doc, doc, "body",
+                           NULL, NULL,
+                           MXML_DESCEND);
+
+    if (body)
+    {
+      for (heading = body->child;
+           heading;
+           heading = heading->next)
+        print_children(heading);
+    }
+
      +
      +

      4Using the mxmldoc Utility

      +

      This chapter describes how to use mxmldoc(1) program to + automatically generate documentation from C and C++ source files.

      +

      The Basics

      +

      Originally developed to generate the Mini-XML and CUPS API + documentation, mxmldoc is now a general-purpose utility which + scans C and C++ source files to produce HTML and man page documentation + along with an XML file representing the functions, types, and + definitions in those source files. Unlike popular documentation + generators like Doxygen or Javadoc, mxmldoc uses in-line + comments rather than comment headers, allowing for more "natural" code + documentation.

      +

      By default, mxmldoc produces HTML documentation. For + example, the following command will scan all of the C source and header + files in the current directory and produce a HTML documentation file + called filename.html:

      +
      +    mxmldoc *.h *.c >filename.html ENTER
+
      +

      You can also specify an XML file to create which contains all of the + information from the source files. For example, the following command + creates an XML file called filename.xml in addition to the + HTML file:

      +
      +    mxmldoc filename.xml *.h *.c >filename.html ENTER
+
      +

      The --no-output option disables the normal HTML output:

      +
      +    mxmldoc --no-output filename.xml *.h *.c ENTER
+
      +

      You can then run mxmldoc again with the XML file alone to + generate the HTML documentation:

      +
      +    mxmldoc filename.xml >filename.html ENTER
+
      +

      Creating Man Pages

      +

      The --man filename option tells mxmldoc to create a + man page instead of HTML documentation, for example:

      +
      +    mxmldoc --man filename filename.xml \
+        >filename.man ENTER
+
+    mxmldoc --man filename *.h *.c \
+        >filename.man ENTER
+
      +

      Creating Xcode Documentation Sets

      +

      The --docset directory.docset option tells mxmldoc + to create an Xcode documentation set containing the HTML documentation, + for example:

      +
      +    mxmldoc --docset foo.docset *.h *.c foo.xml ENTER
+
      +

      Xcode documentation sets can only be built on Mac OS X with Xcode 3.0 + or higher installed.

      +

      Commenting Your Code

      +

      As noted previously, mxmldoc looks for in-line comments to + describe the functions, types, and constants in your code. Mxmldoc + will document all public names it finds in your source files - any + names starting with the underscore character (_) or names that are + documented with the @private@ directive are + treated as private and are undocumented.

      +

      Comments appearing directly before a function or type definition are + used to document that function or type. Comments appearing after + argument, definition, return type, or variable declarations are used to + document that argument, definition, return type, or variable. For + example, the following code excerpt defines a key/value structure and a + function that creates a new instance of that structure:

      +
      +    /* A key/value pair. This is used with the
+       dictionary structure. */
+
+    struct keyval
+    {
+      char *key; /* Key string */
+      char *val; /* Value string */
+    };
+
+    /* Create a new key/value pair. */
+
+    struct keyval * /* New key/value pair */
+    new_keyval(
+        const char *key, /* Key string */
+	const char *val) /* Value string */
+    {
+      ...
+    }
+
      +

      Mxmldoc also knows to remove extra asterisks (*) from the + comment string, so the comment string:

      +
      +    /*
+     * Compute the value of PI.
+     *
+     * The function connects to an Internet server
+     * that streams audio of mathematical monks
+     * chanting the first 100 digits of PI.
+     */
+
      +

      will be shown as:

      +
      +    Compute the value of PI.
+
+    The function connects to an Internet server
+    that streams audio of mathematical monks
+    chanting the first 100 digits of PI.
+
      +

      Comments can also include the following + special @name ...@ directive strings:

      +
        +
      • @deprecated@ - flags the item as deprecated to discourage + its use
        • +
      • @private@ - flags the item as private so it will not be + included in the documentation
        • +
      • @since ...@ - flags the item as new since a particular + release. The text following the @since up to the closing @ + is highlighted in the generated documentation, e.g. @since CUPS + 1.3@.
        • +
      + + +

      Titles, Sections, and Introductions

      +

      Mxmldoc also provides options to set the title, section, and + introduction text for the generated documentation. The --title text + option specifies the title for the documentation. The title string is + usually put in quotes:

      +
      +    mxmldoc filename.xml \
+        --title "My Famous Documentation" \
+        >filename.html ENTER
+
      +

      The --section name option specifies the section for the + documentation. For HTML documentation, the name is placed in a HTML + comment such as:

      +
      +    <!-- SECTION: name -->
+
      +

      For man pages, the section name is usually just a number ("3"), or a + number followed by a vendor name ("3acme"). The section name is used in + the .TH directive in the man page:

      +
      +    .TH mylibrary 3acme "My Title" ...
+
      +

      The default section name for man page output is "3". There is no + default section name for HTML output.

      +

      Finally, the --intro filename option specifies a file to + embed after the title and section but before the generated + documentation. For HTML documentation, the file must consist of valid + HTML without the usual DOCTYPE, html, and body + elements. For man page documentation, the file must consist of valid +nroff(1) text.

      +
      +

      AMini-XML License

      +

      The Mini-XML library and included programs are provided under the + terms of the GNU Library General Public License (LGPL) with the + following exceptions:

      +
        +
      1. Static linking of applications to the Mini-XML library does not + constitute a derivative work and does not require the author to provide + source code for the application, use the shared Mini-XML libraries, or + link their applications against a user-supplied version of Mini-XML. +

        If you link the application to a modified version of Mini-XML, + then the changes to Mini-XML must be provided under the terms of the + LGPL in sections 1, 2, and 4.

        +
        2. +
      2. You do not have to provide a copy of the Mini-XML license with + programs that are linked to the Mini-XML library, nor do you have to + identify the Mini-XML license in your program or documentation as + required by section 6 of the LGPL.
        3. +
      + + +

      GNU LIBRARY GENERAL PUBLIC LICENSE

      +

      Version 2, June 1991 +
      Copyright (C) 1991 Free Software Foundation, Inc. +
      59 Temple Place - Suite 330, Boston, MA 02111-1307, USA +
      Everyone is permitted to copy and distribute verbatim copies of + this license document, but changing it is not allowed. +
      [This is the first released version of the library GPL. It is + numbered 2 because it goes with version 2 of the ordinary GPL.]

      +

      Preamble

      +

      The licenses for most software are designed to take away your freedom + to share and change it. By contrast, the GNU General Public Licenses + are intended to guarantee your freedom to share and change free + software--to make sure the software is free for all its users.

      +

      This license, the Library General Public License, applies to some + specially designated Free Software Foundation software, and to any + other libraries whose authors decide to use it. You can use it for your + libraries, too.

      +

      When we speak of free software, we are referring to freedom, not + price. Our General Public Licenses are designed to make sure that you + have the freedom to distribute copies of free software (and charge for + this service if you wish), that you receive source code or can get it + if you want it, that you can change the software or use pieces of it in + new free programs; and that you know you can do these things.

      +

      To protect your rights, we need to make restrictions that forbid + anyone to deny you these rights or to ask you to surrender the rights. + These restrictions translate to certain responsibilities for you if you + distribute copies of the library, or if you modify it.

      +

      For example, if you distribute copies of the library, whether gratis + or for a fee, you must give the recipients all the rights that we gave + you. You must make sure that they, too, receive or can get the source + code. If you link a program with the library, you must provide complete + object files to the recipients so that they can relink them with the + library, after making changes to the library and recompiling it. And + you must show them these terms so they know their rights.

      +

      Our method of protecting your rights has two steps: (1) copyright the + library, and (2) offer you this license which gives you legal + permission to copy, distribute and/or modify the library.

      +

      Also, for each distributor's protection, we want to make certain that + everyone understands that there is no warranty for this free library. + If the library is modified by someone else and passed on, we want its + recipients to know that what they have is not the original version, so + that any problems introduced by others will not reflect on the original + authors' reputations.

      +

      Finally, any free program is threatened constantly by software + patents. We wish to avoid the danger that companies distributing free + software will individually obtain patent licenses, thus in effect + transforming the program into proprietary software. To prevent this, we + have made it clear that any patent must be licensed for everyone's free + use or not licensed at all.

      +

      Most GNU software, including some libraries, is covered by the + ordinary GNU General Public License, which was designed for utility + programs. This license, the GNU Library General Public License, applies + to certain designated libraries. This license is quite different from + the ordinary one; be sure to read it in full, and don't assume that + anything in it is the same as in the ordinary license.

      +

      The reason we have a separate public license for some libraries is + that they blur the distinction we usually make between modifying or + adding to a program and simply using it. Linking a program with a + library, without changing the library, is in some sense simply using + the library, and is analogous to running a utility program or + application program. However, in a textual and legal sense, the linked + executable is a combined work, a derivative of the original library, + and the ordinary General Public License treats it as such.

      +

      Because of this blurred distinction, using the ordinary General + Public License for libraries did not effectively promote software + sharing, because most developers did not use the libraries. We + concluded that weaker conditions might promote sharing better.

      +

      However, unrestricted linking of non-free programs would deprive the + users of those programs of all benefit from the free status of the + libraries themselves. This Library General Public License is intended + to permit developers of non-free programs to use free libraries, while + preserving your freedom as a user of such programs to change the free + libraries that are incorporated in them. (We have not seen how to + achieve this as regards changes in header files, but we have achieved + it as regards changes in the actual functions of the Library.) The hope + is that this will lead to faster development of free libraries.

      +

      The precise terms and conditions for copying, distribution and + modification follow. Pay close attention to the difference between a + "work based on the libary" and a "work that uses the library". The + former contains code derived from the library, while the latter only + works together with the library.

      +

      Note that it is possible for a library to be covered by the ordinary + General Public License rather than by this special one.

      +

      TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND + MODIFICATION

      +

      0. This License Agreement applies to any software + library which contains a notice placed by the copyright holder or other + authorized party saying it may be distributed under the terms of this + Library General Public License (also called "this License"). Each + licensee is addressed as "you".

      +

      A "library" means a collection of software functions and/or data + prepared so as to be conveniently linked with application programs + (which use some of those functions and data) to form executables.

      +

      The "Library", below, refers to any such software library or work + which has been distributed under these terms. A "work based on the + Library" means either the Library or any derivative work under + copyright law: that is to say, a work containing the Library or a + portion of it, either verbatim or with modifications and/or translated + straightforwardly into another language. (Hereinafter, translation is + included without limitation in the term "modification".)

      +

      "Source code" for a work means the preferred form of the work for + making modifications to it. For a library, complete source code means + all the source code for all modules it contains, plus any associated + interface definition files, plus the scripts used to control + compilation and installation of the library.

      +

      Activities other than copying, distribution and modification are not + covered by this License; they are outside its scope. The act of running + a program using the Library is not restricted, and output from such a + program is covered only if its contents constitute a work based on the + Library (independent of the use of the Library in a tool for writing + it). Whether that is true depends on what the Library does and what the + program that uses the Library does.

      +

      1. You may copy and distribute verbatim copies of + the Library's complete source code as you receive it, in any medium, + provided that you conspicuously and appropriately publish on each copy + an appropriate copyright notice and disclaimer of warranty; keep intact + all the notices that refer to this License and to the absence of any + warranty; and distribute a copy of this License along with the Library.

      +

      You may charge a fee for the physical act of transferring a copy, and + you may at your option offer warranty protection in exchange for a fee.

      +

      2. You may modify your copy or copies of the Library + or any portion of it, thus forming a work based on the Library, and + copy and distribute such modifications or work under the terms of + Section 1 above, provided that you also meet all of these conditions:

      +
        +

        a) The modified work must itself be a software + library.

        +

        b) You must cause the files modified to carry + prominent notices stating that you changed the files and the date of + any change.

        +

        c) You must cause the whole of the work to be + licensed at no charge to all third parties under the terms of this + License.

        +

        d) If a facility in the modified Library refers to a + function or a table of data to be supplied by an application program + that uses the facility, other than as an argument passed when the + facility is invoked, then you must make a good faith effort to ensure + that, in the event an application does not supply such function or + table, the facility still operates, and performs whatever part of its + purpose remains meaningful.

        +

        (For example, a function in a library to compute square roots has a + purpose that is entirely well-defined independent of the application. + Therefore, Subsection 2d requires that any application-supplied + function or table used by this function must be optional: if the + application does not supply it, the square root function must still + compute square roots.)

        +
      +

      These requirements apply to the modified work as a whole. If + identifiable sections of that work are not derived from the Library, + and can be reasonably considered independent and separate works in + themselves, then this License, and its terms, do not apply to those + sections when you distribute them as separate works. But when you + distribute the same sections as part of a whole which is a work based + on the Library, the distribution of the whole must be on the terms of + this License, whose permissions for other licensees extend to the + entire whole, and thus to each and every part regardless of who wrote + it.

      +

      Thus, it is not the intent of this section to claim rights or contest + your rights to work written entirely by you; rather, the intent is to + exercise the right to control the distribution of derivative or + collective works based on the Library.

      +

      In addition, mere aggregation of another work not based on the + Library with the Library (or with a work based on the Library) on a + volume of a storage or distribution medium does not bring the other + work under the scope of this License.

      +

      3. You may opt to apply the terms of the ordinary + GNU General Public License instead of this License to a given copy of + the Library. To do this, you must alter all the notices that refer to + this License, so that they refer to the ordinary GNU General Public + License, version 2, instead of to this License. (If a newer version + than version 2 of the ordinary GNU General Public License has appeared, + then you can specify that version instead if you wish.) Do not make any + other change in these notices.

      +

      Once this change is made in a given copy, it is irreversible for that + copy, so the ordinary GNU General Public License applies to all + subsequent copies and derivative works made from that copy.

      +

      This option is useful when you wish to copy part of the code of the + Library into a program that is not a library.

      +

      4. You may copy and distribute the Library (or a + portion or derivative of it, under Section 2) in object code or + executable form under the terms of Sections 1 and 2 above provided that + you accompany it with the complete corresponding machine-readable + source code, which must be distributed under the terms of Sections 1 + and 2 above on a medium customarily used for software interchange.

      +

      If distribution of object code is made by offering access to copy + from a designated place, then offering equivalent access to copy the + source code from the same place satisfies the requirement to distribute + the source code, even though third parties are not compelled to copy + the source along with the object code.

      +

      5. A program that contains no derivative of any + portion of the Library, but is designed to work with the Library by + being compiled or linked with it, is called a "work that uses the + Library". Such a work, in isolation, is not a derivative work of the + Library, and therefore falls outside the scope of this License.

      +

      However, linking a "work that uses the Library" with the Library + creates an executable that is a derivative of the Library (because it + contains portions of the Library), rather than a "work that uses the + library". The executable is therefore covered by this License. Section + 6 states terms for distribution of such executables.

      +

      When a "work that uses the Library" uses material from a header file + that is part of the Library, the object code for the work may be a + derivative work of the Library even though the source code is not. + Whether this is true is especially significant if the work can be + linked without the Library, or if the work is itself a library. The + threshold for this to be true is not precisely defined by law.

      +

      If such an object file uses only numerical parameters, data structure + layouts and accessors, and small macros and small inline functions (ten + lines or less in length), then the use of the object file is + unrestricted, regardless of whether it is legally a derivative work. + (Executables containing this object code plus portions of the Library + will still fall under Section 6.)

      +

      Otherwise, if the work is a derivative of the Library, you may + distribute the object code for the work under the terms of Section 6. + Any executables containing that work also fall under Section 6, whether + or not they are linked directly with the Library itself.

      +

      6. As an exception to the Sections above, you may + also compile or link a "work that uses the Library" with the Library to + produce a work containing portions of the Library, and distribute that + work under terms of your choice, provided that the terms permit + modification of the work for the customer's own use and reverse + engineering for debugging such modifications.

      +

      You must give prominent notice with each copy of the work that the + Library is used in it and that the Library and its use are covered by + this License. You must supply a copy of this License. If the work + during execution displays copyright notices, you must include the + copyright notice for the Library among them, as well as a reference + directing the user to the copy of this License. Also, you must do one + of these things:

      +
        a) Accompany the work with the complete + corresponding machine-readable source code for the Library including + whatever changes were used in the work (which must be distributed under + Sections 1 and 2 above); and, if the work is an executable linked with + the Library, with the complete machine-readable "work that uses the + Library", as object code and/or source code, so that the user can + modify the Library and then relink to produce a modified executable + containing the modified Library. (It is understood that the user who + changes the contents of definitions files in the Library will not + necessarily be able to recompile the application to use the modified + definitions.) +

        b) Accompany the work with a written offer, valid + for at least three years, to give the same user the materials specified + in Subsection 6a, above, for a charge no more than the cost of + performing this distribution.

        +

        c) If distribution of the work is made by offering + access to copy from a designated place, offer equivalent access to copy + the above specified materials from the same place.

        +

        d) Verify that the user has already received a copy + of these materials or that you have already sent this user a copy.

        +
      +

      For an executable, the required form of the "work that uses the + Library" must include any data and utility programs needed for + reproducing the executable from it. However, as a special exception, + the source code distributed need not include anything that is normally + distributed (in either source or binary form) with the major components + (compiler, kernel, and so on) of the operating system on which the + executable runs, unless that component itself accompanies the + executable.

      +

      It may happen that this requirement contradicts the license + restrictions of other proprietary libraries that do not normally + accompany the operating system. Such a contradiction means you cannot + use both them and the Library together in an executable that you + distribute.

      +

      7. You may place library facilities that are a work + based on the Library side-by-side in a single library together with + other library facilities not covered by this License, and distribute + such a combined library, provided that the separate distribution of the + work based on the Library and of the other library facilities is + otherwise permitted, and provided that you do these two things:

      +
        a) Accompany the combined library with a copy of + the same work based on the Library, uncombined with any other library + facilities. This must be distributed under the terms of the Sections + above. +

        b) Give prominent notice with the combined library + of the fact that part of it is a work based on the Library, and + explaining where to find the accompanying uncombined form of the same + work.

        +
      +

      8. You may not copy, modify, sublicense, link with, + or distribute the Library except as expressly provided under this + License. Any attempt otherwise to copy, modify, sublicense, link with, + or distribute the Library is void, and will automatically terminate + your rights under this License. However, parties who have received + copies, or rights, from you under this License will not have their + licenses terminated so long as such parties remain in full compliance.

      +

      9. You are not required to accept this License, + since you have not signed it. However, nothing else grants you + permission to modify or distribute the Library or its derivative works. + These actions are prohibited by law if you do not accept this License. + Therefore, by modifying or distributing the Library (or any work based + on the Library), you indicate your acceptance of this License to do so, + and all its terms and conditions for copying, distributing or modifying + the Library or works based on it.

      +

      10. Each time you redistribute the Library (or any + work based on the Library), the recipient automatically receives a + license from the original licensor to copy, distribute, link with or + modify the Library subject to these terms and conditions. You may not + impose any further restrictions on the recipients' exercise of the + rights granted herein. You are not responsible for enforcing compliance + by third parties to this License.

      +

      11. If, as a consequence of a court judgment or + allegation of patent infringement or for any other reason (not limited + to patent issues), conditions are imposed on you (whether by court + order, agreement or otherwise) that contradict the conditions of this + License, they do not excuse you from the conditions of this License. If + you cannot distribute so as to satisfy simultaneously your obligations + under this License and any other pertinent obligations, then as a + consequence you may not distribute the Library at all. For example, if + a patent license would not permit royalty-free redistribution of the + Library by all those who receive copies directly or indirectly through + you, then the only way you could satisfy both it and this License would + be to refrain entirely from distribution of the Library.

      +

      If any portion of this section is held invalid or unenforceable under + any particular circumstance, the balance of the section is intended to + apply, and the section as a whole is intended to apply in other + circumstances.

      +

      It is not the purpose of this section to induce you to infringe any + patents or other property right claims or to contest validity of any + such claims; this section has the sole purpose of protecting the + integrity of the free software distribution system which is implemented + by public license practices. Many people have made generous + contributions to the wide range of software distributed through that + system in reliance on consistent application of that system; it is up + to the author/donor to decide if he or she is willing to distribute + software through any other system and a licensee cannot impose that + choice.

      +

      This section is intended to make thoroughly clear what is believed to + be a consequence of the rest of this License.

      +

      12. If the distribution and/or use of the Library is + restricted in certain countries either by patents or by copyrighted + interfaces, the original copyright holder who places the Library under + this License may add an explicit geographical distribution limitation + excluding those countries, so that distribution is permitted only in or + among countries not thus excluded. In such case, this License + incorporates the limitation as if written in the body of this License.

      +

      13. The Free Software Foundation may publish revised + and/or new versions of the Library General Public License from time to + time. Such new versions will be similar in spirit to the present + version, but may differ in detail to address new problems or concerns.

      +

      Each version is given a distinguishing version number. If the Library + specifies a version number of this License which applies to it and "any + later version", you have the option of following the terms and + conditions either of that version or of any later version published by + the Free Software Foundation. If the Library does not specify a license + version number, you may choose any version ever published by the Free + Software Foundation.

      +

      14. If you wish to incorporate parts of the Library + into other free programs whose distribution conditions are incompatible + with these, write to the author to ask for permission. For software + which is copyrighted by the Free Software Foundation, write to the Free + Software Foundation; we sometimes make exceptions for this. Our + decision will be guided by the two goals of preserving the free status + of all derivatives of our free software and of promoting the sharing + and reuse of software generally.

      +

      NO WARRANTY

      +

      15. BECAUSE THE LIBRARY IS LICENSED FREE OF CHARGE, + THERE IS NO WARRANTY FOR THE LIBRARY, TO THE EXTENT PERMITTED BY + APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT + HOLDERS AND/OR OTHER PARTIES PROVIDE THE LIBRARY "AS IS" WITHOUT + WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT + LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A + PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE + OF THE LIBRARY IS WITH YOU. SHOULD THE LIBRARY PROVE DEFECTIVE, YOU + ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION.

      +

      16. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR + AGREED TO IN WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO + MAY MODIFY AND/OR REDISTRIBUTE THE LIBRARY AS PERMITTED ABOVE, BE + LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL + OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE + LIBRARY (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING + RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A + FAILURE OF THE LIBRARY TO OPERATE WITH ANY OTHER SOFTWARE), EVEN IF + SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH + DAMAGES.

      +

      END OF TERMS AND CONDITIONS

      +

      How to Apply These Terms to Your New Libraries

      +

      If you develop a new library, and you want it to be of the greatest + possible use to the public, we recommend making it free software that + everyone can redistribute and change. You can do so by permitting + redistribution under these terms (or, alternatively, under the terms of + the ordinary General Public License).

      +

      To apply these terms, attach the following notices to the library. It + is safest to attach them to the start of each source file to most + effectively convey the exclusion of warranty; and each file should have + at least the "copyright" line and a pointer to where the full notice is + found.

      +
        +

        one line to give the library's name and an idea of what it does. +
        Copyright (C) year name of author

        +

        This library is free software; you can redistribute it and/or modify + it under the terms of the GNU Lesser General Public License as + published by the Free Software Foundation; either version 2.1 of the + License, or (at your option) any later version.

        +

        This library is distributed in the hope that it will be useful, but + WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Lesser + General Public License for more details.

        +

        You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA

        +
      +

      Also add information on how to contact you by electronic and paper + mail.

      +

      You should also get your employer (if you work as a programmer) or + your school, if any, to sign a "copyright disclaimer" for the library, + if necessary. Here is a sample; alter the names:

      +
        +

        Yoyodyne, Inc., hereby disclaims all copyright interest in the + library `Frob' (a library for tweaking knobs) written by James Random + Hacker.

        +

        signature of Ty Coon, 1 April 1990 Ty Coon, President of + Vice

        +
      +

      That's all there is to it!

      +
      +

      BRelease Notes

      +

      Changes in Mini-XML 2.6

      +
        +
      • Documentation fixes (STR #91, STR #92)
        • +
      • The mxmldoc program did not handle typedef comments properly (STR + #72)
        • +
      • Added support for "long long" printf formats.
        • +
      • The XML parser now ignores BOMs in UTF-8 XML files (STR #89)
        • +
      • The mxmldoc program now supports generating Xcode documentation + sets.
        • +
      • mxmlSave*() did not output UTF-8 correctly on some platforms.
        • +
      • mxmlNewXML() now adds encoding="utf-8" in the ?xml directive to + avoid problems with non-conformant XML parsers that assume something + other than UTF-8 as the default encoding.
        • +
      • Wrapping was not disabled when mxmlSetWrapMargin(0) was called, and + "<?xml ... ?>" was always followed by a newline (STR #76)
        • +
      • The mxml.pc.in file was broken (STR #79)
        • +
      • The mxmldoc program now handles "typedef enum name {} name" + correctly (STR #72)
        • +
      +

      Changes in Mini-XML 2.5

      +
        +
      • The mxmldoc program now makes greater use of CSS and supports a + --css option to embed an alternate stylesheet.
        • +
      • The mxmldoc program now supports --header and --footer options to + insert documentation content before and after the generated content.
        • +
      • The mxmldoc program now supports a --framed option to generate + framed HTML output.
        • +
      • The mxmldoc program now creates a table of contents including any + headings in the --intro file when generating HTML output.
        • +
      • The man pages and man page output from mxmldoc did not use "\-" for + dashes (STR #68)
        • +
      • The debug version of the Mini-XML DLL could not be built (STR #65)
        • +
      • Processing instructions and directives did not work when not at the + top level of a document (STR #67)
        • +
      • Spaces around the "=" in attributes were not supported (STR #67)
        • +
      +

      Changes in Mini-XML 2.4

      +
        +
      • Fixed shared library build problems on HP-UX and Mac OS X.
        • +
      • The mxmldoc program did not output argument descriptions for + functions properly.
        • +
      • All global settings (custom, error, and entity callbacks and the + wrap margin) are now managed separately for each thread.
        • +
      • Added mxmlElementDeleteAttr() function (STR #59)
        • +
      • mxmlElementSetAttrf() did not work (STR #57)
        • +
      • mxmlLoad*() incorrectly treated declarations as parent elements (STR + #56)
        • +
      • mxmlLoad*() incorrectly allowed attributes without values (STR #47)
        • +
      • Fixed Visual C++ build problems (STR #49)
        • +
      • mxmlLoad*() did not return NULL when an element contained an error + (STR #46)
        • +
      • Added support for the apos character entity (STR #54)
        • +
      • Fixed whitespace detection with Unicode characters (STR #48)
        • +
      • mxmlWalkNext() and mxmlWalkPrev() did not work correctly when called + with a node with no children as the top node (STR #53)
        • +
      +

      Changes in Mini-XML 2.3

      +
        +
      • Added two exceptions to the LGPL to support static linking of + applications against Mini-XML
        • +
      • The mxmldoc utility can now generate man pages, too.
        • +
      • Added a mxmlNewXML() function
        • +
      • Added a mxmlElementSetAttrf() function (STR #43)
        • +
      • Added a snprintf() emulation function for the test program (STR #32)
        • +
      • Added the _CRT_SECURE_NO_DEPRECATE definition when building on VC++ + 2005 (STR #36)
        • +
      • mxmlLoad*() did not detect missing > characters in elements (STR + #41)
        • +
      • mxmlLoad*() did not detect missing close tags at the end of an XML + document (STR #45)
        • +
      • Added user_data and ref_count members to mxml_node_t structure
        • +
      • Added mxmlReleaseNode() and mxmlRetainNode() APIs for + reference-counted nodes
        • +
      • Added mxmlSetWrapMargin() to control the wrapping of XML output
        • +
      • Added conditional check for EINTR error code for certain Windows + compilers that do not define it (STR #33)
        • +
      • The mxmldoc program now generates correct HTML 4.0 output - + previously it generated invalid XHTML
        • +
      • The mxmldoc program now supports "@deprecated@, "@private@", and + "@since version@" comments
        • +
      • Fixed function and enumeration type bugs in mxmldoc
        • +
      • Fixed the XML schema for mxmldoc
        • +
      • The mxmldoc program now supports --intro, --section, and --title + options
        • +
      • The mxmlLoad*() functions could leak a node on an error (STR #27)
        • +
      • The mxml_vsnprintf() function could get in an infinite loop on a + buffer overflow (STR #25)
        • +
      • Added new mxmlNewCDATA() and mxmlSetCDATA() functions to create and + set CDATA nodes, which are really just special element nodes
        • +
      • Added new MXML_IGNORE type and MXML_IGNORE_CB callback to ignore + non-element nodes, e.g. whitespace
        • +
      • mxmlLoad*() did not treat custom data as opaque, so whitespace + characters would be lost
        • +
      +

      Changes in Mini-XML 2.2.2

      +
        +
      • mxmlLoad*() did not treat custom data as opaque, so whitespace + characters would be lost.
        • +
      +

      Changes in Mini-XML 2.2.1

      +
        +
      • mxmlLoadFd(), mxmlLoadFile(), and mxmlLoadString() now correctly + return NULL on error (STR #21)
        • +
      • mxmlNewInteger(), mxmlNewOpaque(), mxmlNewReal(), mxmlNewText(), and + mxmlNewTextf() incorrectly required a parent node (STR #22)
        • +
      • Fixed an XML output bug in mxmldoc.
        • +
      • The "make install" target now uses the install command to set the + proper permissions on UNIX/Linux/OSX.
        • +
      • Fixed a MingW/Cygwin compilation problem (STR #18)
        • +
      +

      Changes in Mini-XML 2.2

      +
        +
      • Added shared library support (STR #17)
        • +
      • mxmlLoad*() now returns an error when an XML stream contains illegal + control characters (STR #10)
        • +
      • mxmlLoad*() now returns an error when an element contains two + attributes with the same name in conformance with the XML spec (STR + #16)
        • +
      • Added support for CDATA (STR #14, STR #15)
        • +
      • Updated comment and processing instruction handling - no entity + support per XML specification.
        • +
      • Added checking for invalid comment termination ("--->" is not + allowed)
        • +
      +

      Changes in Mini-XML 2.1

      +
        +
      • Added support for custom data nodes (STR #6)
        • +
      • Now treat UTF-8 sequences which are longer than necessary as an + error (STR #4)
        • +
      • Fixed entity number support (STR #8)
        • +
      • Fixed mxmlLoadString() bug with UTF-8 (STR #7)
        • +
      • Fixed entity lookup bug (STR #5)
        • +
      • Added mxmlLoadFd() and mxmlSaveFd() functions.
        • +
      • Fixed multi-word UTF-16 handling.
        • +
      +

      Changes in Mini-XML 2.0

      +
        +
      • New programmers manual.
        • +
      • Added Visual C++ project files for Microsoft Windows users.
        • +
      • Added optimizations to mxmldoc, mxmlSaveFile(), and mxmlIndexNew() + (STR #2)
        • +
      • mxmlEntityAddCallback() now returns an integer status (STR #2)
        • +
      • Added UTF-16 support (input only; all output is UTF-8)
        • +
      • Added index functions to build a searchable index of XML nodes.
        • +
      • Added character entity callback interface to support additional + character entities beyond those defined in the XHTML specification.
        • +
      • Added support for XHTML character entities.
        • +
      • The mxmldoc utility now produces XML output which conforms to an + updated XML schema, described in the file "doc/mxmldoc.xsd".
        • +
      • Changed the whitespace callback interface to return strings instead + of a single character, allowing for greater control over the formatting + of XML files written using Mini-XML. THIS CHANGE WILL REQUIRE CHANGES + TO YOUR 1.x CODE IF YOU USE WHITESPACE CALLBACKS.
        • +
      • The mxmldoc utility now produces XML output which conforms to an + updated XML schema, described in the file "doc/mxmldoc.xsd".
        • +
      • Changed the whitespace callback interface to return strings instead + of a single character, allowing for greater control over the formatting + of XML files written using Mini-XML. THIS CHANGE WILL REQUIRE CHANGES + TO YOUR 1.x CODE IF YOU USE WHITESPACE CALLBACKS.
        • +
      • The mxmldoc utility is now capable of documenting C++ classes, + functions, and structures, and correctly handles C++ comments.
        • +
      • Added new modular tests for mxmldoc.
        • +
      • Updated the mxmldoc output to be more compatible with embedding in + manuals produced with HTMLDOC.
        • +
      • The makefile incorrectly included a "/" separator between the + destination path and install path. This caused problems when building + and installing with MingW.
        • +
      +

      Changes in Mini-XML 1.3

      +
        +
      • Fixes for mxmldoc.
        • +
      • Added support for reading standard HTML entity names.
        • +
      • mxmlLoadString/File() did not decode character entities in element + names, attribute names, or attribute values.
        • +
      • mxmlLoadString/File() would crash when loading non- conformant XML + data under an existing parent (top) node.
        • +
      • Fixed several bugs in the mxmldoc utility.
        • +
      • Added new error callback function to catch a variety of errors and + log them to someplace other than stderr.
        • +
      • The mxmlElementSetAttr() function now allows for NULL attribute + values.
        • +
      • The load and save functions now properly handle quoted element and + attribute name strings properly, e.g. for !DOCTYPE declarations.
        • +
      +

      Changes in Mini-XML 1.2

      +
        +
      • Added new "set" methods to set the value of a node.
        • +
      • Added new formatted text methods mxmlNewTextf() and mxmlSetTextf() + to create/set a text node value using printf-style formats.
        • +
      • Added new standard callbacks for use with the mxmlLoad functions.
        • +
      • Updated the HTML documentation to include examples of the walk and + load function output.
        • +
      • Added --with/without-ansi configure option to control the strdup() + function check.
        • +
      • Added --with/without-snprintf configure option to control the + snprintf() and vsnprintf() function checks.
        • +
      +

      Changes in Mini-XML 1.1.2

      +
        +
      • The mxml(3) man page wasn't updated for the string functions.
        • +
      • mxmlSaveString() returned the wrong number of characters.
        • +
      • mxml_add_char() updated the buffer pointer in the wrong place.
        • +
      +

      Changes in Mini-XML 1.1.1

      +
        +
      • The private mxml_add_ch() function did not update the + start-of-buffer pointer which could cause a crash when using + mxmlSaveString().
        • +
      • The private mxml_write_ws() function called putc() instead of using + the proper callback which could cause a crash when using + mxmlSaveString().
        • +
      • Added a mxmlSaveAllocString() convenience function for saving an XML + node tree to an allocated string.
        • +
      +

      Changes in Mini-XML 1.1

      +
        +
      • The mxmlLoadFile() function now uses dynamically allocated string + buffers for element names, attribute names, and attribute values. + Previously they were capped at 16383, 255, and 255 bytes, respectively.
        • +
      • Added a new mxmlLoadString() function for loading an XML node tree + from a string.
        • +
      • Added a new mxmlSaveString() function for saving an XML node tree to + a string.
        • +
      • Add emulation of strdup() if the local platform does not provide the + function.
        • +
      +

      Changes in Mini-XML 1.0

      +
        +
      • The mxmldoc program now handles function arguments, structures, + unions, enumerations, classes, and typedefs properly.
        • +
      • Documentation provided via mxmldoc and more in-line comments in the + code.
        • +
      • Added man pages and packaging files.
        • +
      +

      Changes in Mini-XML 0.93

      +
        +
      • New mxmldoc example program that is also used to create and update + code documentation using XML and produce HTML reference pages.
        • +
      • Added mxmlAdd() and mxmlRemove() functions to add and remove nodes + from a tree. This provides more flexibility over where the nodes are + inserted and allows nodes to be moved within the tree as needed.
        • +
      • mxmlLoadFile() now correctly handles comments.
        • +
      • mxmlLoadFile() now supports the required "gt", "quot", and "nbsp" + character entities.
        • +
      • mxmlSaveFile() now uses newlines as whitespace when valid to do so.
        • +
      • mxmlFindElement() now also takes attribute name and attribute value + string arguments to limit the search to specific elements with + attributes and/or values.
        • + NULL pointers can be used as "wildcards". +
      • Added uninstall target to makefile, and auto-reconfig if Makefile.in + or configure.in are changed.
        • +
      • mxmlFindElement(), mxmlWalkNext(), and mxmlWalkPrev() now all + provide "descend" arguments to control whether they descend into child + nodes in the tree.
        • +
      • Fixed some whitespace issues in mxmlLoadFile().
        • +
      • Fixed Unicode output and whitespace issues in mxmlSaveFile().
        • +
      • mxmlSaveFile() now supports a whitespace callback to provide more + human-readable XML output under program control.
        • +
      +

      Changes in Mini-XML 0.92

      +
        +
      • mxmlSaveFile() didn't return a value on success.
        • +
      +

      Changes in Mini-XML 0.91

      +
        +
      • mxmlWalkNext() would go into an infinite loop.
        • +
      +

      Changes in Mini-XML 0.9

      +
        +
      • Initial public release.
        • +
      +
      +
      +

      CLibrary Reference

      +

      Contents

      +
        +
      • Functions + +
        • +
      • Data Types + +
        • +
      • Structures + +
        • +
      • Unions + +
        • +
      • Constants + +
        • +

        Functions

        +

        mxmlAdd

        +

        Add a node to a tree.

        +

        void mxmlAdd ( +
            mxml_node_t *parent, +
            int where, +
            mxml_node_t *child, +
            mxml_node_t *node +
        );

        +

        Parameters

        +
        +
        parent
        +
        Parent node
        +
        where
        +
        Where to add, MXML_ADD_BEFORE or MXML_ADD_AFTER
        +
        child
        +
        Child node for where or MXML_ADD_TO_PARENT
        +
        node
        +
        Node to add
        +
        +

        Discussion

        +

        Adds the specified node to the parent. If the + child argument is not NULL, puts the new node before or after the + specified child depending on the value of the where argument. If the + child argument is NULL, puts the new node at the beginning of the child + list (MXML_ADD_BEFORE) or at the end of the child list + (MXML_ADD_AFTER). The constant MXML_ADD_TO_PARENT can be used to + specify a NULL child pointer.

        +

        mxmlDelete

        +

        Delete a node and all of its children.

        +

        void mxmlDelete ( +
            mxml_node_t *node +
        );

        +

        Parameters

        +
        +
        node
        +
        Node to delete
        +
        +

        Discussion

        +

        If the specified node has a parent, this function + first removes the node from its parent using the mxmlRemove() function.

        +

        + + Mini-XML 2.4 mxmlElementDeleteAttr +

        +

        Delete an attribute.

        +

        void mxmlElementDeleteAttr ( +
            mxml_node_t *node, +
            const char *name +
        );

        +

        Parameters

        +
        +
        node
        +
        Element
        +
        name
        +
        Attribute name
        +
        +

        mxmlElementGetAttr

        +

        Get an attribute.

        +

        const char *mxmlElementGetAttr ( +
            mxml_node_t *node, +
            const char *name +
        );

        +

        Parameters

        +
        +
        node
        +
        Element node
        +
        name
        +
        Name of attribute
        +
        +

        Return Value

        +

        Attribute value or NULL

        +

        Discussion

        +

        This function returns NULL if the node is not an + element or the named attribute does not exist.

        +

        mxmlElementSetAttr

        +

        Set an attribute.

        +

        void mxmlElementSetAttr ( +
            mxml_node_t *node, +
            const char *name, +
            const char *value +
        );

        +

        Parameters

        +
        +
        node
        +
        Element node
        +
        name
        +
        Name of attribute
        +
        value
        +
        Attribute value
        +
        +

        Discussion

        +

        If the named attribute already exists, the value + of the attribute is replaced by the new string value. The string value + is copied into the element node. This function does nothing if the node + is not an element.

        +

        + + Mini-XML 2.3 mxmlElementSetAttrf

        +

        Set an attribute with a formatted value.

        +

        void mxmlElementSetAttrf ( +
            mxml_node_t *node, +
            const char *name, +
            const char *format, +
            ... +
        );

        +

        Parameters

        +
        +
        node
        +
        Element node
        +
        name
        +
        Name of attribute
        +
        format
        +
        Printf-style attribute value
        +
        ...
        +
        Additional arguments as needed
        +
        +

        Discussion

        +

        If the named attribute already exists, the value + of the attribute is replaced by the new formatted string. The formatted + string value is copied into the element node. This function does + nothing if the node is not an element.

        +

        +mxmlEntityAddCallback

        +

        Add a callback to convert entities to Unicode.

        +

        int mxmlEntityAddCallback ( +
            mxml_entity_cb_t cb +
        );

        +

        Parameters

        +
        +
        cb
        +
        Callback function to add
        +
        +

        Return Value

        +

        0 on success, -1 on failure

        +

        mxmlEntityGetName

        +

        Get the name that corresponds to the character + value.

        +

        const char *mxmlEntityGetName ( +
            int val +
        );

        +

        Parameters

        +
        +
        val
        +
        Character value
        +
        +

        Return Value

        +

        Entity name or NULL

        +

        Discussion

        +

        If val does not need to be represented by a named + entity, NULL is returned.

        +

        mxmlEntityGetValue

        +

        Get the character corresponding to a named + entity.

        +

        int mxmlEntityGetValue ( +
            const char *name +
        );

        +

        Parameters

        +
        +
        name
        +
        Entity name
        +
        +

        Return Value

        +

        Character value or -1 on error

        +

        Discussion

        +

        The entity name can also be a numeric constant. -1 + is returned if the name is not known.

        +

        +mxmlEntityRemoveCallback

        +

        Remove a callback.

        +

        void mxmlEntityRemoveCallback ( +
            mxml_entity_cb_t cb +
        );

        +

        Parameters

        +
        +
        cb
        +
        Callback function to remove
        +
        +

        mxmlFindElement

        +

        Find the named element.

        +

        mxml_node_t *mxmlFindElement + ( +
            mxml_node_t *node, +
            mxml_node_t *top, +
            const char *name, +
            const char *attr, +
            const char *value, +
            int descend +
        );

        +

        Parameters

        +
        +
        node
        +
        Current node
        +
        top
        +
        Top node
        +
        name
        +
        Element name or NULL for any
        +
        attr
        +
        Attribute name, or NULL for none
        +
        value
        +
        Attribute value, or NULL for any
        +
        descend
        +
        Descend into tree - MXML_DESCEND, + MXML_NO_DESCEND, or MXML_DESCEND_FIRST
        +
        +

        Return Value

        +

        Element node or NULL

        +

        Discussion

        +

        The search is constrained by the name, attribute + name, and value; any NULL names or values are treated as wildcards, so + different kinds of searches can be implemented by looking for all + elements of a given name or all elements with a specific attribute. The + descend argument determines whether the search descends into child + nodes; normally you will use MXML_DESCEND_FIRST for the initial search + and MXML_NO_DESCEND to find additional direct descendents of the node. + The top node argument constrains the search to a particular node's + children.

        +

        mxmlIndexDelete

        +

        Delete an index.

        +

        void mxmlIndexDelete ( +
            mxml_index_t *ind +
        );

        +

        Parameters

        +
        +
        ind
        +
        Index to delete
        +
        +

        mxmlIndexEnum

        +

        Return the next node in the index.

        +

        mxml_node_t *mxmlIndexEnum ( +
            mxml_index_t *ind +
        );

        +

        Parameters

        +
        +
        ind
        +
        Index to enumerate
        +
        +

        Return Value

        +

        Next node or NULL if there is none

        +

        Discussion

        +

        Nodes are returned in the sorted order of the + index.

        +

        mxmlIndexFind

        +

        Find the next matching node.

        +

        mxml_node_t *mxmlIndexFind ( +
            mxml_index_t *ind, +
            const char *element, +
            const char *value +
        );

        +

        Parameters

        +
        +
        ind
        +
        Index to search
        +
        element
        +
        Element name to find, if any
        +
        value
        +
        Attribute value, if any
        +
        +

        Return Value

        +

        Node or NULL if none found

        +

        Discussion

        +

        You should call mxmlIndexReset() prior to using + this function for the first time with a particular set of "element" and + "value" strings. Passing NULL for both "element" and "value" is + equivalent to calling mxmlIndexEnum().

        +

        mxmlIndexNew

        +

        Create a new index.

        +

        mxml_index_t *mxmlIndexNew + ( +
            mxml_node_t *node, +
            const char *element, +
            const char *attr +
        );

        +

        Parameters

        +
        +
        node
        +
        XML node tree
        +
        element
        +
        Element to index or NULL for all
        +
        attr
        +
        Attribute to index or NULL for none
        +
        +

        Return Value

        +

        New index

        +

        Discussion

        +

        The index will contain all nodes that contain the + named element and/or attribute. If both "element" and "attr" are NULL, + then the index will contain a sorted list of the elements in the node + tree. Nodes are sorted by element name and optionally by attribute + value if the "attr" argument is not NULL.

        +

        mxmlIndexReset

        +

        Reset the enumeration/find pointer in the index + and return the first node in the index.

        +

        mxml_node_t *mxmlIndexReset + ( +
            mxml_index_t *ind +
        );

        +

        Parameters

        +
        +
        ind
        +
        Index to reset
        +
        +

        Return Value

        +

        First node or NULL if there is none

        +

        Discussion

        +

        This function should be called prior to using + mxmlIndexEnum() or mxmlIndexFind() for the first time.

        +

        mxmlLoadFd

        +

        Load a file descriptor into an XML node tree.

        +

        mxml_node_t *mxmlLoadFd ( +
            mxml_node_t *top, +
            int fd, +
            mxml_load_cb_t cb +
        );

        +

        Parameters

        +
        +
        top
        +
        Top node
        +
        fd
        +
        File descriptor to read from
        +
        cb
        +
        Callback function or MXML_NO_CALLBACK
        +
        +

        Return Value

        +

        First node or NULL if the file could not be read.

        +

        Discussion

        +

        The nodes in the specified file are added to the + specified top node. If no top node is provided, the XML file MUST be + well-formed with a single parent node like <?xml> for the entire file. + The callback function returns the value type that should be used for + child nodes. If MXML_NO_CALLBACK is specified then all child nodes will + be either MXML_ELEMENT or MXML_TEXT nodes. +
        +
        The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK, + MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading + child nodes of the specified type.

        +

        mxmlLoadFile

        +

        Load a file into an XML node tree.

        +

        mxml_node_t *mxmlLoadFile ( +
            mxml_node_t *top, +
            FILE *fp, +
            mxml_load_cb_t cb +
        );

        +

        Parameters

        +
        +
        top
        +
        Top node
        +
        fp
        +
        File to read from
        +
        cb
        +
        Callback function or MXML_NO_CALLBACK
        +
        +

        Return Value

        +

        First node or NULL if the file could not be read.

        +

        Discussion

        +

        The nodes in the specified file are added to the + specified top node. If no top node is provided, the XML file MUST be + well-formed with a single parent node like <?xml> for the entire file. + The callback function returns the value type that should be used for + child nodes. If MXML_NO_CALLBACK is specified then all child nodes will + be either MXML_ELEMENT or MXML_TEXT nodes. +
        +
        The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK, + MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading + child nodes of the specified type.

        +

        mxmlLoadString

        +

        Load a string into an XML node tree.

        +

        mxml_node_t *mxmlLoadString + ( +
            mxml_node_t *top, +
            const char *s, +
            mxml_load_cb_t cb +
        );

        +

        Parameters

        +
        +
        top
        +
        Top node
        +
        s
        +
        String to load
        +
        cb
        +
        Callback function or MXML_NO_CALLBACK
        +
        +

        Return Value

        +

        First node or NULL if the string has errors.

        +

        Discussion

        +

        The nodes in the specified string are added to the + specified top node. If no top node is provided, the XML string MUST be + well-formed with a single parent node like <?xml> for the entire + string. The callback function returns the value type that should be + used for child nodes. If MXML_NO_CALLBACK is specified then all child + nodes will be either MXML_ELEMENT or MXML_TEXT nodes. +
        +
        The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK, + MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading + child nodes of the specified type.

        +

        + + Mini-XML 2.3 mxmlNewCDATA

        +

        Create a new CDATA node.

        +

        mxml_node_t *mxmlNewCDATA ( +
            mxml_node_t *parent, +
            const char *data +
        );

        +

        Parameters

        +
        +
        parent
        +
        Parent node or MXML_NO_PARENT
        +
        data
        +
        Data string
        +
        +

        Return Value

        +

        New node

        +

        Discussion

        +

        The new CDATA node is added to the end of the + specified parent's child list. The constant MXML_NO_PARENT can be used + to specify that the new CDATA node has no parent. The data string must + be nul-terminated and is copied into the new node. CDATA nodes use the + MXML_ELEMENT type.

        +

        + + Mini-XML 2.1 mxmlNewCustom

        +

        Create a new custom data node.

        +

        mxml_node_t *mxmlNewCustom ( +
            mxml_node_t *parent, +
            void *data, +
            mxml_custom_destroy_cb_t + destroy +
        );

        +

        Parameters

        +
        +
        parent
        +
        Parent node or MXML_NO_PARENT
        +
        data
        +
        Pointer to data
        +
        destroy
        +
        Function to destroy data
        +
        +

        Return Value

        +

        New node

        +

        Discussion

        +

        The new custom node is added to the end of the + specified parent's child list. The constant MXML_NO_PARENT can be used + to specify that the new element node has no parent. NULL can be passed + when the data in the node is not dynamically allocated or is separately + managed.

        +

        mxmlNewElement

        +

        Create a new element node.

        +

        mxml_node_t *mxmlNewElement + ( +
            mxml_node_t *parent, +
            const char *name +
        );

        +

        Parameters

        +
        +
        parent
        +
        Parent node or MXML_NO_PARENT
        +
        name
        +
        Name of element
        +
        +

        Return Value

        +

        New node

        +

        Discussion

        +

        The new element node is added to the end of the + specified parent's child list. The constant MXML_NO_PARENT can be used + to specify that the new element node has no parent.

        +

        mxmlNewInteger

        +

        Create a new integer node.

        +

        mxml_node_t *mxmlNewInteger + ( +
            mxml_node_t *parent, +
            int integer +
        );

        +

        Parameters

        +
        +
        parent
        +
        Parent node or MXML_NO_PARENT
        +
        integer
        +
        Integer value
        +
        +

        Return Value

        +

        New node

        +

        Discussion

        +

        The new integer node is added to the end of the + specified parent's child list. The constant MXML_NO_PARENT can be used + to specify that the new integer node has no parent.

        +

        mxmlNewOpaque

        +

        Create a new opaque string.

        +

        mxml_node_t *mxmlNewOpaque ( +
            mxml_node_t *parent, +
            const char *opaque +
        );

        +

        Parameters

        +
        +
        parent
        +
        Parent node or MXML_NO_PARENT
        +
        opaque
        +
        Opaque string
        +
        +

        Return Value

        +

        New node

        +

        Discussion

        +

        The new opaque node is added to the end of the + specified parent's child list. The constant MXML_NO_PARENT can be used + to specify that the new opaque node has no parent. The opaque string + must be nul-terminated and is copied into the new node.

        +

        mxmlNewReal

        +

        Create a new real number node.

        +

        mxml_node_t *mxmlNewReal ( +
            mxml_node_t *parent, +
            double real +
        );

        +

        Parameters

        +
        +
        parent
        +
        Parent node or MXML_NO_PARENT
        +
        real
        +
        Real number value
        +
        +

        Return Value

        +

        New node

        +

        Discussion

        +

        The new real number node is added to the end of + the specified parent's child list. The constant MXML_NO_PARENT can be + used to specify that the new real number node has no parent.

        +

        mxmlNewText

        +

        Create a new text fragment node.

        +

        mxml_node_t *mxmlNewText ( +
            mxml_node_t *parent, +
            int whitespace, +
            const char *string +
        );

        +

        Parameters

        +
        +
        parent
        +
        Parent node or MXML_NO_PARENT
        +
        whitespace
        +
        1 = leading whitespace, 0 = no whitespace
        +
        string
        +
        String
        +
        +

        Return Value

        +

        New node

        +

        Discussion

        +

        The new text node is added to the end of the + specified parent's child list. The constant MXML_NO_PARENT can be used + to specify that the new text node has no parent. The whitespace + parameter is used to specify whether leading whitespace is present + before the node. The text string must be nul-terminated and is copied + into the new node.

        +

        mxmlNewTextf

        +

        Create a new formatted text fragment node.

        +

        mxml_node_t *mxmlNewTextf ( +
            mxml_node_t *parent, +
            int whitespace, +
            const char *format, +
            ... +
        );

        +

        Parameters

        +
        +
        parent
        +
        Parent node or MXML_NO_PARENT
        +
        whitespace
        +
        1 = leading whitespace, 0 = no whitespace
        +
        format
        +
        Printf-style frmat string
        +
        ...
        +
        Additional args as needed
        +
        +

        Return Value

        +

        New node

        +

        Discussion

        +

        The new text node is added to the end of the + specified parent's child list. The constant MXML_NO_PARENT can be used + to specify that the new text node has no parent. The whitespace + parameter is used to specify whether leading whitespace is present + before the node. The format string must be nul-terminated and is + formatted into the new node.

        +

        + + Mini-XML 2.3 mxmlNewXML

        +

        Create a new XML document tree.

        +

        mxml_node_t *mxmlNewXML ( +
            const char *version +
        );

        +

        Parameters

        +
        +
        version
        +
        Version number to use
        +
        +

        Return Value

        +

        New ?xml node

        +

        Discussion

        +

        The "version" argument specifies the version + number to put in the ?xml element node. If NULL, version 1.0 is + assumed.

        +

        + + Mini-XML 2.3 mxmlRelease

        +

        Release a node.

        +

        int mxmlRelease ( +
            mxml_node_t *node +
        );

        +

        Parameters

        +
        +
        node
        +
        Node
        +
        +

        Return Value

        +

        New reference count

        +

        Discussion

        +

        When the reference count reaches zero, the node + (and any children) is deleted via mxmlDelete().

        +

        mxmlRemove

        +

        Remove a node from its parent.

        +

        void mxmlRemove ( +
            mxml_node_t *node +
        );

        +

        Parameters

        +
        +
        node
        +
        Node to remove
        +
        +

        Discussion

        +

        Does not free memory used by the node - use + mxmlDelete() for that. This function does nothing if the node has no + parent.

        +

        + + Mini-XML 2.3 mxmlRetain

        +

        Retain a node.

        +

        int mxmlRetain ( +
            mxml_node_t *node +
        );

        +

        Parameters

        +
        +
        node
        +
        Node
        +
        +

        Return Value

        +

        New reference count

        +

        + + Mini-XML 2.3 mxmlSAXLoadFd

        +

        Load a file descriptor into an XML node tree + using a SAX callback.

        +

        mxml_node_t *mxmlSAXLoadFd ( +
            mxml_node_t *top, +
            int fd, +
            mxml_load_cb_t cb, +
            mxml_sax_cb_t sax_cb, +
            void *sax_data +
        );

        +

        Parameters

        +
        +
        top
        +
        Top node
        +
        fd
        +
        File descriptor to read from
        +
        cb
        +
        Callback function or MXML_NO_CALLBACK
        +
        sax_cb
        +
        SAX callback or MXML_NO_CALLBACK
        +
        sax_data
        +
        SAX user data
        +
        +

        Return Value

        +

        First node or NULL if the file could not be read.

        +

        Discussion

        +

        The nodes in the specified file are added to the + specified top node. If no top node is provided, the XML file MUST be + well-formed with a single parent node like <?xml> for the entire file. + The callback function returns the value type that should be used for + child nodes. If MXML_NO_CALLBACK is specified then all child nodes will + be either MXML_ELEMENT or MXML_TEXT nodes. +
        +
        The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK, + MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading + child nodes of the specified type. +
        +
        The SAX callback must call mxmlRetain() for any nodes that need to + be kept for later use. Otherwise, nodes are deleted when the parent + node is closed or after each data, comment, CDATA, or directive node.

        +

        + + Mini-XML 2.3 mxmlSAXLoadFile

        +

        Load a file into an XML node tree using a SAX + callback.

        +

        mxml_node_t *mxmlSAXLoadFile + ( +
            mxml_node_t *top, +
            FILE *fp, +
            mxml_load_cb_t cb, +
            mxml_sax_cb_t sax_cb, +
            void *sax_data +
        );

        +

        Parameters

        +
        +
        top
        +
        Top node
        +
        fp
        +
        File to read from
        +
        cb
        +
        Callback function or MXML_NO_CALLBACK
        +
        sax_cb
        +
        SAX callback or MXML_NO_CALLBACK
        +
        sax_data
        +
        SAX user data
        +
        +

        Return Value

        +

        First node or NULL if the file could not be read.

        +

        Discussion

        +

        The nodes in the specified file are added to the + specified top node. If no top node is provided, the XML file MUST be + well-formed with a single parent node like <?xml> for the entire file. + The callback function returns the value type that should be used for + child nodes. If MXML_NO_CALLBACK is specified then all child nodes will + be either MXML_ELEMENT or MXML_TEXT nodes. +
        +
        The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK, + MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading + child nodes of the specified type. +
        +
        The SAX callback must call mxmlRetain() for any nodes that need to + be kept for later use. Otherwise, nodes are deleted when the parent + node is closed or after each data, comment, CDATA, or directive node.

        +

        + + Mini-XML 2.3 mxmlSAXLoadString

        +

        Load a string into an XML node tree using a SAX + callback.

        +

        mxml_node_t + *mxmlSAXLoadString ( +
            mxml_node_t *top, +
            const char *s, +
            mxml_load_cb_t cb, +
            mxml_sax_cb_t sax_cb, +
            void *sax_data +
        );

        +

        Parameters

        +
        +
        top
        +
        Top node
        +
        s
        +
        String to load
        +
        cb
        +
        Callback function or MXML_NO_CALLBACK
        +
        sax_cb
        +
        SAX callback or MXML_NO_CALLBACK
        +
        sax_data
        +
        SAX user data
        +
        +

        Return Value

        +

        First node or NULL if the string has errors.

        +

        Discussion

        +

        The nodes in the specified string are added to the + specified top node. If no top node is provided, the XML string MUST be + well-formed with a single parent node like <?xml> for the entire + string. The callback function returns the value type that should be + used for child nodes. If MXML_NO_CALLBACK is specified then all child + nodes will be either MXML_ELEMENT or MXML_TEXT nodes. +
        +
        The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK, + MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading + child nodes of the specified type. +
        +
        The SAX callback must call mxmlRetain() for any nodes that need to + be kept for later use. Otherwise, nodes are deleted when the parent + node is closed or after each data, comment, CDATA, or directive node.

        +

        mxmlSaveAllocString +

        +

        Save an XML node tree to an allocated string.

        +

        char *mxmlSaveAllocString ( +
            mxml_node_t *node, +
            mxml_save_cb_t cb +
        );

        +

        Parameters

        +
        +
        node
        +
        Node to write
        +
        cb
        +
        Whitespace callback or MXML_NO_CALLBACK
        +
        +

        Return Value

        +

        Allocated string or NULL

        +

        Discussion

        +

        This function returns a pointer to a string + containing the textual representation of the XML node tree. The string + should be freed using the free() function when you are done with it. + NULL is returned if the node would produce an empty string or if the + string cannot be allocated. +
        +
        The callback argument specifies a function that returns a + whitespace string or NULL before and after each element. If + MXML_NO_CALLBACK is specified, whitespace will only be added before + MXML_TEXT nodes with leading whitespace and before attribute names + inside opening element tags.

        +

        mxmlSaveFd

        +

        Save an XML tree to a file descriptor.

        +

        int mxmlSaveFd ( +
            mxml_node_t *node, +
            int fd, +
            mxml_save_cb_t cb +
        );

        +

        Parameters

        +
        +
        node
        +
        Node to write
        +
        fd
        +
        File descriptor to write to
        +
        cb
        +
        Whitespace callback or MXML_NO_CALLBACK
        +
        +

        Return Value

        +

        0 on success, -1 on error.

        +

        Discussion

        +

        The callback argument specifies a function that + returns a whitespace string or NULL before and after each element. If + MXML_NO_CALLBACK is specified, whitespace will only be added before + MXML_TEXT nodes with leading whitespace and before attribute names + inside opening element tags.

        +

        mxmlSaveFile

        +

        Save an XML tree to a file.

        +

        int mxmlSaveFile ( +
            mxml_node_t *node, +
            FILE *fp, +
            mxml_save_cb_t cb +
        );

        +

        Parameters

        +
        +
        node
        +
        Node to write
        +
        fp
        +
        File to write to
        +
        cb
        +
        Whitespace callback or MXML_NO_CALLBACK
        +
        +

        Return Value

        +

        0 on success, -1 on error.

        +

        Discussion

        +

        The callback argument specifies a function that + returns a whitespace string or NULL before and after each element. If + MXML_NO_CALLBACK is specified, whitespace will only be added before + MXML_TEXT nodes with leading whitespace and before attribute names + inside opening element tags.

        +

        mxmlSaveString

        +

        Save an XML node tree to a string.

        +

        int mxmlSaveString ( +
            mxml_node_t *node, +
            char *buffer, +
            int bufsize, +
            mxml_save_cb_t cb +
        );

        +

        Parameters

        +
        +
        node
        +
        Node to write
        +
        buffer
        +
        String buffer
        +
        bufsize
        +
        Size of string buffer
        +
        cb
        +
        Whitespace callback or MXML_NO_CALLBACK
        +
        +

        Return Value

        +

        Size of string

        +

        Discussion

        +

        This function returns the total number of bytes + that would be required for the string but only copies (bufsize - 1) + characters into the specified buffer. +
        +
        The callback argument specifies a function that returns a + whitespace string or NULL before and after each element. If + MXML_NO_CALLBACK is specified, whitespace will only be added before + MXML_TEXT nodes with leading whitespace and before attribute names + inside opening element tags.

        +

        + + Mini-XML 2.3 mxmlSetCDATA

        +

        Set the element name of a CDATA node.

        +

        int mxmlSetCDATA ( +
            mxml_node_t *node, +
            const char *data +
        );

        +

        Parameters

        +
        +
        node
        +
        Node to set
        +
        data
        +
        New data string
        +
        +

        Return Value

        +

        0 on success, -1 on failure

        +

        Discussion

        +

        The node is not changed if it is not a CDATA + element node.

        +

        + + Mini-XML 2.1 mxmlSetCustom

        +

        Set the data and destructor of a custom data + node.

        +

        int mxmlSetCustom ( +
            mxml_node_t *node, +
            void *data, +
            mxml_custom_destroy_cb_t + destroy +
        );

        +

        Parameters

        +
        +
        node
        +
        Node to set
        +
        data
        +
        New data pointer
        +
        destroy
        +
        New destructor function
        +
        +

        Return Value

        +

        0 on success, -1 on failure

        +

        Discussion

        +

        The node is not changed if it is not a custom + node.

        +

        +mxmlSetCustomHandlers

        +

        Set the handling functions for custom data.

        +

        void mxmlSetCustomHandlers ( +
            mxml_custom_load_cb_t + load, +
            mxml_custom_save_cb_t save +
        );

        +

        Parameters

        +
        +
        load
        +
        Load function
        +
        save
        +
        Save function
        +
        +

        Discussion

        +

        The load function accepts a node pointer and a + data string and must return 0 on success and non-zero on error. +
        +
        The save function accepts a node pointer and must return a malloc'd + string on success and NULL on error.

        +

        mxmlSetElement

        +

        Set the name of an element node.

        +

        int mxmlSetElement ( +
            mxml_node_t *node, +
            const char *name +
        );

        +

        Parameters

        +
        +
        node
        +
        Node to set
        +
        name
        +
        New name string
        +
        +

        Return Value

        +

        0 on success, -1 on failure

        +

        Discussion

        +

        The node is not changed if it is not an element + node.

        +

        mxmlSetErrorCallback +

        +

        Set the error message callback.

        +

        void mxmlSetErrorCallback ( +
            mxml_error_cb_t cb +
        );

        +

        Parameters

        +
        +
        cb
        +
        Error callback function
        +
        +

        mxmlSetInteger

        +

        Set the value of an integer node.

        +

        int mxmlSetInteger ( +
            mxml_node_t *node, +
            int integer +
        );

        +

        Parameters

        +
        +
        node
        +
        Node to set
        +
        integer
        +
        Integer value
        +
        +

        Return Value

        +

        0 on success, -1 on failure

        +

        Discussion

        +

        The node is not changed if it is not an integer + node.

        +

        mxmlSetOpaque

        +

        Set the value of an opaque node.

        +

        int mxmlSetOpaque ( +
            mxml_node_t *node, +
            const char *opaque +
        );

        +

        Parameters

        +
        +
        node
        +
        Node to set
        +
        opaque
        +
        Opaque string
        +
        +

        Return Value

        +

        0 on success, -1 on failure

        +

        Discussion

        +

        The node is not changed if it is not an opaque + node.

        +

        mxmlSetReal

        +

        Set the value of a real number node.

        +

        int mxmlSetReal ( +
            mxml_node_t *node, +
            double real +
        );

        +

        Parameters

        +
        +
        node
        +
        Node to set
        +
        real
        +
        Real number value
        +
        +

        Return Value

        +

        0 on success, -1 on failure

        +

        Discussion

        +

        The node is not changed if it is not a real number + node.

        +

        mxmlSetText

        +

        Set the value of a text node.

        +

        int mxmlSetText ( +
            mxml_node_t *node, +
            int whitespace, +
            const char *string +
        );

        +

        Parameters

        +
        +
        node
        +
        Node to set
        +
        whitespace
        +
        1 = leading whitespace, 0 = no whitespace
        +
        string
        +
        String
        +
        +

        Return Value

        +

        0 on success, -1 on failure

        +

        Discussion

        +

        The node is not changed if it is not a text node.

        +

        mxmlSetTextf

        +

        Set the value of a text node to a formatted + string.

        +

        int mxmlSetTextf ( +
            mxml_node_t *node, +
            int whitespace, +
            const char *format, +
            ... +
        );

        +

        Parameters

        +
        +
        node
        +
        Node to set
        +
        whitespace
        +
        1 = leading whitespace, 0 = no whitespace
        +
        format
        +
        Printf-style format string
        +
        ...
        +
        Additional arguments as needed
        +
        +

        Return Value

        +

        0 on success, -1 on failure

        +

        Discussion

        +

        The node is not changed if it is not a text node.

        +

        + + Mini-XML 2.3 mxmlSetWrapMargin

        +

        Set the the wrap margin when saving XML data.

        +

        void mxmlSetWrapMargin ( +
            int column +
        );

        +

        Parameters

        +
        +
        column
        +
        Column for wrapping, 0 to disable wrapping
        +
        +

        Discussion

        +

        Wrapping is disabled when "column" is 0.

        +

        mxmlWalkNext

        +

        Walk to the next logical node in the tree.

        +

        mxml_node_t *mxmlWalkNext ( +
            mxml_node_t *node, +
            mxml_node_t *top, +
            int descend +
        );

        +

        Parameters

        +
        +
        node
        +
        Current node
        +
        top
        +
        Top node
        +
        descend
        +
        Descend into tree - MXML_DESCEND, + MXML_NO_DESCEND, or MXML_DESCEND_FIRST
        +
        +

        Return Value

        +

        Next node or NULL

        +

        Discussion

        +

        The descend argument controls whether the first + child is considered to be the next node. The top node argument + constrains the walk to the node's children.

        +

        mxmlWalkPrev

        +

        Walk to the previous logical node in the tree.

        +

        mxml_node_t *mxmlWalkPrev ( +
            mxml_node_t *node, +
            mxml_node_t *top, +
            int descend +
        );

        +

        Parameters

        +
        +
        node
        +
        Current node
        +
        top
        +
        Top node
        +
        descend
        +
        Descend into tree - MXML_DESCEND, + MXML_NO_DESCEND, or MXML_DESCEND_FIRST
        +
        +

        Return Value

        +

        Previous node or NULL

        +

        Discussion

        +

        The descend argument controls whether the previous + node's last child is considered to be the previous node. The top node + argument constrains the walk to the node's children.

        +

        Data Types

        +

        mxml_attr_t

        +

        An XML element attribute value.

        +

        typedef struct mxml_attr_s + mxml_attr_t;

        +

        +mxml_custom_destroy_cb_t

        +

        Custom data destructor

        +

        typedef void (*mxml_custom_destroy_cb_t)(void *);

        +

        +mxml_custom_load_cb_t

        +

        Custom data load callback function

        +

        typedef int (*mxml_custom_load_cb_t)( +mxml_node_t *, const char *);

        +

        +mxml_custom_save_cb_t

        +

        Custom data save callback function

        +

        typedef char *(*mxml_custom_save_cb_t)( +mxml_node_t *);

        +

        + + Mini-XML 2.1 mxml_custom_t

        +

        An XML custom value.

        +

        typedef struct mxml_custom_s + mxml_custom_t;

        +

        mxml_element_t

        +

        An XML element value.

        +

        typedef struct mxml_element_s + mxml_element_t;

        +

        mxml_entity_cb_t

        +

        Entity callback function

        +

        typedef int (*mxml_entity_cb_t)(const char *);

        +

        mxml_error_cb_t

        +

        Error callback function

        +

        typedef void (*mxml_error_cb_t)(const char *);

        +

        mxml_index_t

        +

        An XML node index.

        +

        typedef struct mxml_index_s + mxml_index_t;

        +

        mxml_load_cb_t

        +

        Load callback function

        +

        typedef mxml_type_t + (*mxml_load_cb_t)(mxml_node_t *);

        +

        mxml_node_t

        +

        An XML node.

        +

        typedef struct mxml_node_s + mxml_node_t;

        +

        mxml_save_cb_t

        +

        Save callback function

        +

        typedef const char *(*mxml_save_cb_t)( +mxml_node_t *, int);

        +

        mxml_sax_cb_t

        +

        SAX callback function

        +

        typedef void (*mxml_sax_cb_t)( +mxml_node_t *, mxml_sax_event_t, void *);

        +

        mxml_sax_event_t

        +

        SAX event type.

        +

        typedef enum +mxml_sax_event_e mxml_sax_event_t;

        +

        mxml_text_t

        +

        An XML text value.

        +

        typedef struct mxml_text_s + mxml_text_t;

        +

        mxml_type_t

        +

        The XML node type.

        +

        typedef enum mxml_type_e + mxml_type_t;

        +

        mxml_value_t

        +

        An XML node value.

        +

        typedef union mxml_value_u + mxml_value_t;

        +

        Structures

        +

        mxml_attr_s

        +

        An XML element attribute value.

        +

        struct mxml_attr_s { +
            char *name; +
            char *value; +
        };

        +

        Members

        +
        +
        name
        +
        Attribute name
        +
        value
        +
        Attribute value
        +
        +

        + + Mini-XML 2.1 mxml_custom_s

        +

        An XML custom value.

        +

        struct mxml_custom_s { +
            void *data; +
            mxml_custom_destroy_cb_t + destroy; +
        };

        +

        Members

        +
        +
        data
        +
        Pointer to (allocated) custom data
        +
        destroy
        +
        Pointer to destructor function
        +
        +

        mxml_element_s

        +

        An XML element value.

        +

        struct mxml_element_s { +
            mxml_attr_t *attrs; +
            char *name; +
            int num_attrs; +
        };

        +

        Members

        +
        +
        attrs
        +
        Attributes
        +
        name
        +
        Name of element
        +
        num_attrs
        +
        Number of attributes
        +
        +

        mxml_index_s

        +

        An XML node index.

        +

        struct mxml_index_s { +
            int alloc_nodes; +
            char *attr; +
            int cur_node; +
            mxml_node_t **nodes; +
            int num_nodes; +
        };

        +

        Members

        +
        +
        alloc_nodes
        +
        Allocated nodes in index
        +
        attr
        +
        Attribute used for indexing or NULL
        +
        cur_node
        +
        Current node
        +
        nodes
        +
        Node array
        +
        num_nodes
        +
        Number of nodes in index
        +
        +

        mxml_node_s

        +

        An XML node.

        +

        struct mxml_node_s { +
            struct mxml_node_s *child; +
            struct mxml_node_s *last_child; +
            struct mxml_node_s *next; +
            struct mxml_node_s *parent; +
            struct mxml_node_s *prev; +
            int ref_count; +
            mxml_type_t type; +
            void *user_data; +
            mxml_value_t value; +
        };

        +

        Members

        +
        +
        child
        +
        First child node
        +
        last_child
        +
        Last child node
        +
        next
        +
        Next node under same parent
        +
        parent
        +
        Parent node
        +
        prev
        +
        Previous node under same parent
        +
        ref_count
        +
        Use count
        +
        type
        +
        Node type
        +
        user_data
        +
        User data
        +
        value
        +
        Node value
        +
        +

        mxml_text_s

        +

        An XML text value.

        +

        struct mxml_text_s { +
            char *string; +
            int whitespace; +
        };

        +

        Members

        +
        +
        string
        +
        Fragment string
        +
        whitespace
        +
        Leading whitespace?
        +
        +

        Unions

        +

        mxml_value_u

        +

        An XML node value.

        +

        union mxml_value_u { +
            mxml_custom_t custom; +
            mxml_element_t element; +
            int integer; +
            char *opaque; +
            double real; +
            mxml_text_t text; +
        };

        +

        Members

        +
        +
        custom + +  Mini-XML 2.1 
        +
        Custom data
        +
        element
        +
        Element
        +
        integer
        +
        Integer number
        +
        opaque
        +
        Opaque string
        +
        real
        +
        Real number
        +
        text
        +
        Text fragment
        +
        +

        Constants

        +

        mxml_sax_event_e

        +

        SAX event type.

        +

        Constants

        +
        +
        MXML_SAX_CDATA
        +
        CDATA node
        +
        MXML_SAX_COMMENT
        +
        Comment node
        +
        MXML_SAX_DATA
        +
        Data node
        +
        MXML_SAX_DIRECTIVE
        +
        Processing directive node
        +
        MXML_SAX_ELEMENT_CLOSE
        +
        Element closed
        +
        MXML_SAX_ELEMENT_OPEN
        +
        Element opened
        +
        +

        mxml_type_e

        +

        The XML node type.

        +

        Constants

        +
        +
        MXML_CUSTOM + +  Mini-XML 2.1 
        +
        Custom data
        +
        MXML_ELEMENT
        +
        XML element with attributes
        +
        MXML_IGNORE + +  Mini-XML 2.3 
        +
        Ignore/throw away node
        +
        MXML_INTEGER
        +
        Integer value
        +
        MXML_OPAQUE
        +
        Opaque string
        +
        MXML_REAL
        +
        Real value
        +
        MXML_TEXT
        +
        Text fragment
        +
        +
      +
      +

      DXML Schema

      +

      This appendix provides the XML schema that is used for the XML files + produced by mxmldoc. This schema is available on-line at:

      +
      +    http://www.easysw.com/~mike/mxmldoc.xsd
+
      +

      mxmldoc.xsd

      +
      
+<?xml version="1.0"?>
+<xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema">
+  <xsd:annotation>
+    <xsd:documentation xml:lang="en">
+      Mini-XML 2.3 documentation schema for mxmldoc output.
+      Copyright 2003-2007 by Michael Sweet.
+    </xsd:documentation>
+  </xsd:annotation>
+
+  <!-- basic element definitions -->
+  <xsd:element name="argument" type="argumentType"/>
+  <xsd:element name="class" type="classType"/>
+  <xsd:element name="constant" type="constantType"/>
+  <xsd:element name="description" type="xsd:string"/>
+  <xsd:element name="enumeration" type="enumerationType"/>
+  <xsd:element name="function" type="functionType"/>
+  <xsd:element name="mxmldoc" type="mxmldocType"/>
+  <xsd:element name="namespace" type="namespaceType"/>
+  <xsd:element name="returnvalue" type="returnvalueType"/>
+  <xsd:element name="seealso" type="identifierList"/>
+  <xsd:element name="struct" type="structType"/>
+  <xsd:element name="typedef" type="typedefType"/>
+  <xsd:element name="type" type="xsd:string"/>
+  <xsd:element name="union" type="unionType"/>
+  <xsd:element name="variable" type="variableType"/>
+
+  <!-- descriptions of complex elements -->
+  <xsd:complexType name="argumentType">
+    <xsd:sequence>
+      <xsd:element ref="type" minOccurs="1" maxOccurs="1"/>
+      <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+    </xsd:sequence>
+    <xsd:attribute name="default" type="xsd:string" use="optional"/>
+    <xsd:attribute name="name" type="identifier" use="required"/>
+    <xsd:attribute name="direction" type="direction" use="optional"
+     default="I"/>
+  </xsd:complexType>
+
+  <xsd:complexType name="classType">
+    <xsd:sequence>
+      <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+      <xsd:choice minOccurs="0" maxOccurs="unbounded">
+	<xsd:element ref="class"/>
+	<xsd:element ref="enumeration"/>
+	<xsd:element ref="function"/>
+	<xsd:element ref="struct"/>
+	<xsd:element ref="typedef"/>
+	<xsd:element ref="union"/>
+	<xsd:element ref="variable"/>
+      </xsd:choice>
+    </xsd:sequence>
+    <xsd:attribute name="name" type="identifier" use="required"/>
+    <xsd:attribute name="parent" type="xsd:string" use="optional"/>
+  </xsd:complexType>
+
+  <xsd:complexType name="constantType">
+    <xsd:sequence>
+      <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+    </xsd:sequence>
+    <xsd:attribute name="name" type="identifier" use="required"/>
+  </xsd:complexType>
+
+  <xsd:complexType name="enumerationType">
+    <xsd:sequence>
+      <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+      <xsd:element ref="constant" minOccurs="1" maxOccurs="unbounded"/>
+    </xsd:sequence>
+    <xsd:attribute name="name" type="identifier" use="required"/>
+  </xsd:complexType>
+
+  <xsd:complexType name="functionType">
+    <xsd:sequence>
+      <xsd:element ref="returnvalue" minOccurs="0" maxOccurs="1"/>
+      <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+      <xsd:element ref="argument" minOccurs="1" maxOccurs="unbounded"/>
+      <xsd:element ref="seealso" minOccurs="0" maxOccurs="1"/>
+    </xsd:sequence>
+    <xsd:attribute name="name" type="identifier" use="required"/>
+    <xsd:attribute name="scope" type="scope" use="optional"/>
+  </xsd:complexType>
+
+  <xsd:complexType name="mxmldocType">
+    <xsd:choice minOccurs="0" maxOccurs="unbounded">
+      <xsd:element ref="class"/>
+      <xsd:element ref="enumeration"/>
+      <xsd:element ref="function"/>
+      <xsd:element ref="namespace"/>
+      <xsd:element ref="struct"/>
+      <xsd:element ref="typedef"/>
+      <xsd:element ref="union"/>
+      <xsd:element ref="variable"/>
+    </xsd:choice>
+  </xsd:complexType>
+
+  <xsd:complexType name="namespaceType">
+    <xsd:sequence>
+      <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+      <xsd:choice minOccurs="0" maxOccurs="unbounded">
+	<xsd:element ref="class"/>
+	<xsd:element ref="enumeration"/>
+	<xsd:element ref="function"/>
+	<xsd:element ref="struct"/>
+	<xsd:element ref="typedef"/>
+	<xsd:element ref="union"/>
+	<xsd:element ref="variable"/>
+      </xsd:choice>
+    </xsd:sequence>
+    <xsd:attribute name="name" type="identifier" use="required"/>
+  </xsd:complexType>
+
+  <xsd:complexType name="returnvalueType">
+    <xsd:sequence>
+      <xsd:element ref="type" minOccurs="1" maxOccurs="1"/>
+      <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+    </xsd:sequence>
+  </xsd:complexType>
+
+  <xsd:complexType name="structType">
+    <xsd:sequence>
+      <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+      <xsd:choice minOccurs="0" maxOccurs="unbounded">
+	<xsd:element ref="variable"/>
+	<xsd:element ref="function"/>
+      </xsd:choice>
+    </xsd:sequence>
+    <xsd:attribute name="name" type="identifier" use="required"/>
+  </xsd:complexType>
+
+  <xsd:complexType name="typedefType">
+    <xsd:sequence>
+      <xsd:element ref="type" minOccurs="1" maxOccurs="1"/>
+      <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+    </xsd:sequence>
+    <xsd:attribute name="name" type="identifier" use="required"/>
+  </xsd:complexType>
+
+  <xsd:complexType name="unionType">
+    <xsd:sequence>
+      <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+      <xsd:element ref="variable" minOccurs="0" maxOccurs="unbounded"/>
+    </xsd:sequence>
+    <xsd:attribute name="name" type="identifier" use="required"/>
+  </xsd:complexType>
+
+  <xsd:complexType name="variableType">
+    <xsd:sequence>
+      <xsd:element ref="type" minOccurs="1" maxOccurs="1"/>
+      <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+    </xsd:sequence>
+    <xsd:attribute name="name" type="identifier" use="required"/>
+  </xsd:complexType>
+
+  <!-- data types -->
+  <xsd:simpleType name="direction">
+    <xsd:restriction base="xsd:string">
+      <xsd:enumeration value="I"/>
+      <xsd:enumeration value="O"/>
+      <xsd:enumeration value="IO"/>
+    </xsd:restriction>
+  </xsd:simpleType>
+
+  <xsd:simpleType name="identifier">
+    <xsd:restriction base="xsd:string">
+      <xsd:pattern value="[a-zA-Z_(.]([a-zA-Z_(.,)* 0-9])*"/>
+    </xsd:restriction>
+  </xsd:simpleType>
+
+  <xsd:simpleType name="identifierList">
+    <xsd:list itemType="identifier"/>
+  </xsd:simpleType>
+
+  <xsd:simpleType name="scope">
+    <xsd:restriction base="xsd:string">
+      <xsd:enumeration value=""/>
+      <xsd:enumeration value="private"/>
+      <xsd:enumeration value="protected"/>
+      <xsd:enumeration value="public"/>
+    </xsd:restriction>
+  </xsd:simpleType>
+</xsd:schema>
+
      + + diff -Naur mxml-2.6/doc/mxmldoc.html mxml-2.6-haiku/doc/mxmldoc.html --- mxml-2.6/doc/mxmldoc.html 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/mxmldoc.html 2009-05-17 06:04:58.000000000 +0000 @@ -0,0 +1,204 @@ + + + +

      4Using the mxmldoc +Utility

      + +

      This chapter describes how to use mxmldoc(1) program to +automatically generate documentation from C and C++ source +files.

      + + +

      The Basics

      + +

      Originally developed to generate the Mini-XML and CUPS API +documentation, mxmldoc is now a general-purpose utility +which scans C and C++ source files to produce HTML and man page +documentation along with an XML file representing the functions, +types, and definitions in those source files. Unlike popular +documentation generators like Doxygen or Javadoc, mxmldoc +uses in-line comments rather than comment headers, allowing for more +"natural" code documentation.

      + +

      By default, mxmldoc produces HTML documentation. For +example, the following command will scan all of the C source and +header files in the current directory and produce a HTML +documentation file called filename.html:

      + +
      +    mxmldoc *.h *.c >filename.html ENTER
+
      + +

      You can also specify an XML file to create which contains all of +the information from the source files. For example, the following +command creates an XML file called filename.xml in +addition to the HTML file:

      + +
      +    mxmldoc filename.xml *.h *.c >filename.html ENTER
+
      + +

      The --no-output option disables the normal HTML +output:

      + +
      +    mxmldoc --no-output filename.xml *.h *.c ENTER
+
      + +

      You can then run mxmldoc again with the XML file alone +to generate the HTML documentation:

      + +
      +    mxmldoc filename.xml >filename.html ENTER
+
      + +

      Creating Man Pages

      + +

      The --man filename option tells mxmldoc to +create a man page instead of HTML documentation, for example:

      + +
      +    mxmldoc --man filename filename.xml \
+        >filename.man ENTER
+
+    mxmldoc --man filename *.h *.c \
+        >filename.man ENTER
+
      + +

      Creating Xcode Documentation Sets

      + +

      The --docset directory.docset option tells mxmldoc to +create an Xcode documentation set containing the HTML documentation, for +example:

      + +
      +    mxmldoc --docset foo.docset *.h *.c foo.xml ENTER
+
      + +

      Xcode documentation sets can only be built on Mac OS X with Xcode 3.0 or +higher installed.

      + + +

      Commenting Your Code

      + +

      As noted previously, mxmldoc looks for in-line comments +to describe the functions, types, and constants in your code. +Mxmldoc will document all public names it finds in your +source files - any names starting with the underscore character (_) +or names that are documented with the @private@ directive are treated as private +and are undocumented.

      + +

      Comments appearing directly before a function or type definition +are used to document that function or type. Comments appearing after +argument, definition, return type, or variable declarations are used +to document that argument, definition, return type, or variable. For +example, the following code excerpt defines a key/value structure +and a function that creates a new instance of that structure:

      + +
      +    /* A key/value pair. This is used with the
+       dictionary structure. */
+
+    struct keyval
+    {
+      char *key; /* Key string */
+      char *val; /* Value string */
+    };
+
+    /* Create a new key/value pair. */
+
+    struct keyval * /* New key/value pair */
+    new_keyval(
+        const char *key, /* Key string */
+	const char *val) /* Value string */
+    {
+      ...
+    }
+
      + +

      Mxmldoc also knows to remove extra asterisks (*) from +the comment string, so the comment string:

      + +
      +    /*
+     * Compute the value of PI.
+     *
+     * The function connects to an Internet server
+     * that streams audio of mathematical monks
+     * chanting the first 100 digits of PI.
+     */
+
      + +

      will be shown as:

      + +
      +    Compute the value of PI.
+
+    The function connects to an Internet server
+    that streams audio of mathematical monks
+    chanting the first 100 digits of PI.
+
      + +

      Comments can also include the +following special @name ...@ directive strings:

      + +
        + +
      • @deprecated@ - flags the item as deprecated to + discourage its use
        • + +
      • @private@ - flags the item as private so it + will not be included in the documentation
        • + +
      • @since ...@ - flags the item as new since a + particular release. The text following the @since + up to the closing @ is highlighted in the generated + documentation, e.g. @since CUPS 1.3@.
        • + +
      + + + +

      Titles, Sections, and Introductions

      + +

      Mxmldoc also provides options to set the title, section, +and introduction text for the generated documentation. The +--title text option specifies the title for the +documentation. The title string is usually put in quotes:

      + +
      +    mxmldoc filename.xml \
+        --title "My Famous Documentation" \
+        >filename.html ENTER
+
      + +

      The --section name option specifies the section for +the documentation. For HTML documentation, the name is placed in +a HTML comment such as:

      + +
      +    <!-- SECTION: name -->
+
      + +

      For man pages, the section name is usually just a number ("3"), +or a number followed by a vendor name ("3acme"). The section name is +used in the .TH directive in the man page:

      + +
      +    .TH mylibrary 3acme "My Title" ...
+
      + +

      The default section name for man page output is "3". There is no +default section name for HTML output.

      + +

      Finally, the --intro filename option specifies a file to +embed after the title and section but before the generated +documentation. For HTML documentation, the file must consist of +valid HTML without the usual DOCTYPE, html, and +body elements. For man page documentation, the file must +consist of valid nroff(1) text.

      + + + diff -Naur mxml-2.6/doc/mxmldoc.man mxml-2.6-haiku/doc/mxmldoc.man --- mxml-2.6/doc/mxmldoc.man 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/mxmldoc.man 2009-05-05 13:38:00.000000000 +0000 @@ -0,0 +1,198 @@ +.\" +.\" "$Id: mxmldoc.man 390 2009-05-05 13:38:00Z mike $" +.\" +.\" mxmldoc man page for mini-XML, a small XML-like file parsing library. +.\" +.\" Copyright 2003-2009 by Michael Sweet. +.\" +.\" This program is free software; you can redistribute it and/or +.\" modify it under the terms of the GNU Library General Public +.\" License as published by the Free Software Foundation; either +.\" version 2, or (at your option) any later version. +.\" +.\" This program is distributed in the hope that it will be useful, +.\" but WITHOUT ANY WARRANTY; without even the implied warranty of +.\" MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +.\" GNU General Public License for more details. +.\" +.TH mxmldoc 1 "Mini-XML" "4 May 2009" "Michael Sweet" +.SH NAME +mxmldoc \- mini-xml documentation generator +.SH SYNOPSIS +.B mxmldoc +\-\-no-output [ +.I filename.xml +] +.I source file(s) +] +.br +.B mxmldoc +[ \-\-footer +.I footerfile +] [ \-\-header +.I headerfile +] [ \-\-intro +.I introfile +] [ \-\-section +.I section +] [ \-\-title +.I title +] [ +.I filename.xml +] [ +.I source file(s) +] > +.I filename.html +.br +.B mxmldoc +\-\-docset +.I directory.docset +[ \-\-docversion +.I version +] [ \-\-feedname +.I name +] [ \-\-feedurl +.I url +] [ \-\-footer +.I footerfile +] [ \-\-header +.I headerfile +] [ \-\-intro +.I introfile +] [ \-\-section +.I section +] [ \-\-title +.I title +] [ +.I filename.xml +] [ +.I source file(s) +] +.br +.B mxmldoc +\-\-tokens +.I path +[ +.I filename.xml +] [ +.I source file(s) +] > tokens.xml +.br +.B mxmldoc +\-\-framed +.I basename +[ \-\-footer +.I footerfile +] [ \-\-header +.I headerfile +] [ \-\-intro +.I introfile +] [ \-\-section +.I section +] [ \-\-title +.I title +] [ +.I filename.xml +] [ +.I source file(s) +] +.br +.B mxmldoc +[ \-\-footer +.I footerfile +] [ \-\-header +.I headerfile +] [ \-\-intro +.I introfile +] \-\-man +.I manpage +[ \-\-section +.I section +] [ \-\-title +.I title +] [ +.I filename.xml +] [ +.I source file(s) +] > +.I filename.man +.SH DESCRIPTION +\fImxmldoc\fR scans the specified C and C++ source files to produce +an XML representation of globally accessible classes, constants, +enumerations, functions, structures, typedefs, unions, and variables +- the XML file is updated as necessary. By default, a HTML +representation of the XML file is written to the standard output. +Use the \fI\-\-no-output\fR option to disable the HTML output. +.PP +Man page source can be generated using the \fI\-\-man\fR option. +.PP +If no source files are specified then the current XML file is +converted to the standard output. +.PP +In general, any C or C++ source code is handled by \fImxmldoc\fR, +however it was specifically written to handle code with +documentation that is formatted according to the CUPS Developer +Guide which is available at "http://www.cups.org/documentation.php". +.SH OPTIONS +.TP 5 +\-\-docset directory.docset +.br +Creates an Xcode documentation set in the specified directory. +.TP 5 +\-\-docversion version +.br +Specifies the version number for the Xcode documentation set. +.TP 5 +\-\-feedname name +.br +Specifies the Xcode documentation set feed name, typically the project or +company name. +.TP 5 +\-\-feedurl url +.br +Specifies the Xcode documentation set feed URL which must point to an ATOM file +linking to updates. +.TP 5 +\-\-footer footerfile +.br +Inserts the specified file at the bottom of the output documentation. +.TP 5 +\-\-framed basename +.br +Creates HTML documentation using frames - one for the table-of-contents and +one for the body. +.TP 5 +\-\-header headerfile +.br +Inserts the specified file at the top of the output documentation. +.TP 5 +\-\-intro introfile +.br +Inserts the specified file before the table of contents. +.TP 5 +\-\-man manpage +.br +Generated a man page instead of HTML documentation. +.TP 5 +\-\-no-output +.br +Disables generation of documentation on the standard output. +.TP 5 +\-\-section section +.br +Sets the section/keywords in the output documentation. +.TP 5 +\-\-title title +.br +Sets the title of the output documentation. +.TP 5 +\-\-tokens +.br +Generates a Tokens.xml file for use with the Xcode documentation tools. +.SH SEE ALSO +mxml(3), Mini-XML Programmers Manual, http://www.minixml.org/ +.SH COPYRIGHT +Copyright 2003-2009 by Michael Sweet. +.\" +.\" End of "$Id: mxmldoc.man 390 2009-05-05 13:38:00Z mike $". +.\" diff -Naur mxml-2.6/doc/mxmldoc.xsd mxml-2.6-haiku/doc/mxmldoc.xsd --- mxml-2.6/doc/mxmldoc.xsd 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/mxmldoc.xsd 2007-04-18 19:25:26.000000000 +0000 @@ -0,0 +1,189 @@ + + + + + Mini-XML 2.3 documentation schema for mxmldoc output. + Copyright 2003-2007 by Michael Sweet. + + This program is free software; you can redistribute it and/or + modify it under the terms of the GNU Library General Public + License as published by the Free Software Foundation; either + version 2, or (at your option) any later version. + + This program is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + GNU General Public License for more details. + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff -Naur mxml-2.6/doc/reference.heading mxml-2.6-haiku/doc/reference.heading --- mxml-2.6/doc/reference.heading 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/reference.heading 2008-01-26 20:50:28.000000000 +0000 @@ -0,0 +1,4 @@ +

      CLibrary +Reference

      + diff -Naur mxml-2.6/doc/reference.html mxml-2.6-haiku/doc/reference.html --- mxml-2.6/doc/reference.html 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/reference.html 2009-10-26 02:35:54.000000000 +0000 @@ -0,0 +1,1635 @@ + + + +Documentation + + + + +
      +

      CLibrary +Reference

      + +

      Contents

      +
        +
      • Functions
        • +
      • Data Types
        • +
      • Structures
        • +
      • Unions
        • +
      • Constants
        • +

        Functions

        +

        mxmlAdd

        +

        Add a node to a tree.

        +

        +void mxmlAdd (
        +    mxml_node_t *parent,
        +    int where,
        +    mxml_node_t *child,
        +    mxml_node_t *node
        +);

        +

        Parameters

        +
        +
        parent
        +
        Parent node
        +
        where
        +
        Where to add, MXML_ADD_BEFORE or MXML_ADD_AFTER
        +
        child
        +
        Child node for where or MXML_ADD_TO_PARENT
        +
        node
        +
        Node to add
        +
        +

        Discussion

        +

        Adds the specified node to the parent. If the child argument is not +NULL, puts the new node before or after the specified child depending +on the value of the where argument. If the child argument is NULL, +puts the new node at the beginning of the child list (MXML_ADD_BEFORE) +or at the end of the child list (MXML_ADD_AFTER). The constant +MXML_ADD_TO_PARENT can be used to specify a NULL child pointer.

        +

        mxmlDelete

        +

        Delete a node and all of its children.

        +

        +void mxmlDelete (
        +    mxml_node_t *node
        +);

        +

        Parameters

        +
        +
        node
        +
        Node to delete
        +
        +

        Discussion

        +

        If the specified node has a parent, this function first removes the +node from its parent using the mxmlRemove() function.

        +

         Mini-XML 2.4 mxmlElementDeleteAttr

        +

        Delete an attribute.

        +

        +void mxmlElementDeleteAttr (
        +    mxml_node_t *node,
        +    const char *name
        +);

        +

        Parameters

        +
        +
        node
        +
        Element
        +
        name
        +
        Attribute name
        +
        +

        mxmlElementGetAttr

        +

        Get an attribute.

        +

        +const char *mxmlElementGetAttr (
        +    mxml_node_t *node,
        +    const char *name
        +);

        +

        Parameters

        +
        +
        node
        +
        Element node
        +
        name
        +
        Name of attribute
        +
        +

        Return Value

        +

        Attribute value or NULL

        +

        Discussion

        +

        This function returns NULL if the node is not an element or the +named attribute does not exist.

        +

        mxmlElementSetAttr

        +

        Set an attribute.

        +

        +void mxmlElementSetAttr (
        +    mxml_node_t *node,
        +    const char *name,
        +    const char *value
        +);

        +

        Parameters

        +
        +
        node
        +
        Element node
        +
        name
        +
        Name of attribute
        +
        value
        +
        Attribute value
        +
        +

        Discussion

        +

        If the named attribute already exists, the value of the attribute +is replaced by the new string value. The string value is copied +into the element node. This function does nothing if the node is +not an element.

        +

         Mini-XML 2.3 mxmlElementSetAttrf

        +

        Set an attribute with a formatted value.

        +

        +void mxmlElementSetAttrf (
        +    mxml_node_t *node,
        +    const char *name,
        +    const char *format,
        +    ...
        +);

        +

        Parameters

        +
        +
        node
        +
        Element node
        +
        name
        +
        Name of attribute
        +
        format
        +
        Printf-style attribute value
        +
        ...
        +
        Additional arguments as needed
        +
        +

        Discussion

        +

        If the named attribute already exists, the value of the attribute +is replaced by the new formatted string. The formatted string value is +copied into the element node. This function does nothing if the node +is not an element. + +

        +

        mxmlEntityAddCallback

        +

        Add a callback to convert entities to Unicode.

        +

        +int mxmlEntityAddCallback (
        +    mxml_entity_cb_t cb
        +);

        +

        Parameters

        +
        +
        cb
        +
        Callback function to add
        +
        +

        Return Value

        +

        0 on success, -1 on failure

        +

        mxmlEntityGetName

        +

        Get the name that corresponds to the character value.

        +

        +const char *mxmlEntityGetName (
        +    int val
        +);

        +

        Parameters

        +
        +
        val
        +
        Character value
        +
        +

        Return Value

        +

        Entity name or NULL

        +

        Discussion

        +

        If val does not need to be represented by a named entity, NULL is returned.

        +

        mxmlEntityGetValue

        +

        Get the character corresponding to a named entity.

        +

        +int mxmlEntityGetValue (
        +    const char *name
        +);

        +

        Parameters

        +
        +
        name
        +
        Entity name
        +
        +

        Return Value

        +

        Character value or -1 on error

        +

        Discussion

        +

        The entity name can also be a numeric constant. -1 is returned if the +name is not known.

        +

        mxmlEntityRemoveCallback

        +

        Remove a callback.

        +

        +void mxmlEntityRemoveCallback (
        +    mxml_entity_cb_t cb
        +);

        +

        Parameters

        +
        +
        cb
        +
        Callback function to remove
        +
        +

        mxmlFindElement

        +

        Find the named element.

        +

        +mxml_node_t *mxmlFindElement (
        +    mxml_node_t *node,
        +    mxml_node_t *top,
        +    const char *name,
        +    const char *attr,
        +    const char *value,
        +    int descend
        +);

        +

        Parameters

        +
        +
        node
        +
        Current node
        +
        top
        +
        Top node
        +
        name
        +
        Element name or NULL for any
        +
        attr
        +
        Attribute name, or NULL for none
        +
        value
        +
        Attribute value, or NULL for any
        +
        descend
        +
        Descend into tree - MXML_DESCEND, MXML_NO_DESCEND, or MXML_DESCEND_FIRST
        +
        +

        Return Value

        +

        Element node or NULL

        +

        Discussion

        +

        The search is constrained by the name, attribute name, and value; any +NULL names or values are treated as wildcards, so different kinds of +searches can be implemented by looking for all elements of a given name +or all elements with a specific attribute. The descend argument determines +whether the search descends into child nodes; normally you will use +MXML_DESCEND_FIRST for the initial search and MXML_NO_DESCEND to find +additional direct descendents of the node. The top node argument +constrains the search to a particular node's children.

        +

        mxmlIndexDelete

        +

        Delete an index.

        +

        +void mxmlIndexDelete (
        +    mxml_index_t *ind
        +);

        +

        Parameters

        +
        +
        ind
        +
        Index to delete
        +
        +

        mxmlIndexEnum

        +

        Return the next node in the index.

        +

        +mxml_node_t *mxmlIndexEnum (
        +    mxml_index_t *ind
        +);

        +

        Parameters

        +
        +
        ind
        +
        Index to enumerate
        +
        +

        Return Value

        +

        Next node or NULL if there is none

        +

        Discussion

        +

        Nodes are returned in the sorted order of the index.

        +

        mxmlIndexFind

        +

        Find the next matching node.

        +

        +mxml_node_t *mxmlIndexFind (
        +    mxml_index_t *ind,
        +    const char *element,
        +    const char *value
        +);

        +

        Parameters

        +
        +
        ind
        +
        Index to search
        +
        element
        +
        Element name to find, if any
        +
        value
        +
        Attribute value, if any
        +
        +

        Return Value

        +

        Node or NULL if none found

        +

        Discussion

        +

        You should call mxmlIndexReset() prior to using this function for +the first time with a particular set of "element" and "value" +strings. Passing NULL for both "element" and "value" is equivalent +to calling mxmlIndexEnum().

        +

        mxmlIndexNew

        +

        Create a new index.

        +

        +mxml_index_t *mxmlIndexNew (
        +    mxml_node_t *node,
        +    const char *element,
        +    const char *attr
        +);

        +

        Parameters

        +
        +
        node
        +
        XML node tree
        +
        element
        +
        Element to index or NULL for all
        +
        attr
        +
        Attribute to index or NULL for none
        +
        +

        Return Value

        +

        New index

        +

        Discussion

        +

        The index will contain all nodes that contain the named element and/or +attribute. If both "element" and "attr" are NULL, then the index will +contain a sorted list of the elements in the node tree. Nodes are +sorted by element name and optionally by attribute value if the "attr" +argument is not NULL.

        +

        mxmlIndexReset

        +

        Reset the enumeration/find pointer in the index and +return the first node in the index.

        +

        +mxml_node_t *mxmlIndexReset (
        +    mxml_index_t *ind
        +);

        +

        Parameters

        +
        +
        ind
        +
        Index to reset
        +
        +

        Return Value

        +

        First node or NULL if there is none

        +

        Discussion

        +

        This function should be called prior to using mxmlIndexEnum() or +mxmlIndexFind() for the first time.

        +

        mxmlLoadFd

        +

        Load a file descriptor into an XML node tree.

        +

        +mxml_node_t *mxmlLoadFd (
        +    mxml_node_t *top,
        +    int fd,
        +    mxml_load_cb_t cb
        +);

        +

        Parameters

        +
        +
        top
        +
        Top node
        +
        fd
        +
        File descriptor to read from
        +
        cb
        +
        Callback function or MXML_NO_CALLBACK
        +
        +

        Return Value

        +

        First node or NULL if the file could not be read.

        +

        Discussion

        +

        The nodes in the specified file are added to the specified top node. +If no top node is provided, the XML file MUST be well-formed with a +single parent node like <?xml> for the entire file. The callback +function returns the value type that should be used for child nodes. +If MXML_NO_CALLBACK is specified then all child nodes will be either +MXML_ELEMENT or MXML_TEXT nodes.
        +
        +The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK, +MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading +child nodes of the specified type.

        +

        mxmlLoadFile

        +

        Load a file into an XML node tree.

        +

        +mxml_node_t *mxmlLoadFile (
        +    mxml_node_t *top,
        +    FILE *fp,
        +    mxml_load_cb_t cb
        +);

        +

        Parameters

        +
        +
        top
        +
        Top node
        +
        fp
        +
        File to read from
        +
        cb
        +
        Callback function or MXML_NO_CALLBACK
        +
        +

        Return Value

        +

        First node or NULL if the file could not be read.

        +

        Discussion

        +

        The nodes in the specified file are added to the specified top node. +If no top node is provided, the XML file MUST be well-formed with a +single parent node like <?xml> for the entire file. The callback +function returns the value type that should be used for child nodes. +If MXML_NO_CALLBACK is specified then all child nodes will be either +MXML_ELEMENT or MXML_TEXT nodes.
        +
        +The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK, +MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading +child nodes of the specified type.

        +

        mxmlLoadString

        +

        Load a string into an XML node tree.

        +

        +mxml_node_t *mxmlLoadString (
        +    mxml_node_t *top,
        +    const char *s,
        +    mxml_load_cb_t cb
        +);

        +

        Parameters

        +
        +
        top
        +
        Top node
        +
        s
        +
        String to load
        +
        cb
        +
        Callback function or MXML_NO_CALLBACK
        +
        +

        Return Value

        +

        First node or NULL if the string has errors.

        +

        Discussion

        +

        The nodes in the specified string are added to the specified top node. +If no top node is provided, the XML string MUST be well-formed with a +single parent node like <?xml> for the entire string. The callback +function returns the value type that should be used for child nodes. +If MXML_NO_CALLBACK is specified then all child nodes will be either +MXML_ELEMENT or MXML_TEXT nodes.
        +
        +The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK, +MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading +child nodes of the specified type.

        +

         Mini-XML 2.3 mxmlNewCDATA

        +

        Create a new CDATA node.

        +

        +mxml_node_t *mxmlNewCDATA (
        +    mxml_node_t *parent,
        +    const char *data
        +);

        +

        Parameters

        +
        +
        parent
        +
        Parent node or MXML_NO_PARENT
        +
        data
        +
        Data string
        +
        +

        Return Value

        +

        New node

        +

        Discussion

        +

        The new CDATA node is added to the end of the specified parent's child +list. The constant MXML_NO_PARENT can be used to specify that the new +CDATA node has no parent. The data string must be nul-terminated and +is copied into the new node. CDATA nodes use the MXML_ELEMENT type. + +

        +

         Mini-XML 2.1 mxmlNewCustom

        +

        Create a new custom data node.

        +

        +mxml_node_t *mxmlNewCustom (
        +    mxml_node_t *parent,
        +    void *data,
        +    mxml_custom_destroy_cb_t destroy
        +);

        +

        Parameters

        +
        +
        parent
        +
        Parent node or MXML_NO_PARENT
        +
        data
        +
        Pointer to data
        +
        destroy
        +
        Function to destroy data
        +
        +

        Return Value

        +

        New node

        +

        Discussion

        +

        The new custom node is added to the end of the specified parent's child +list. The constant MXML_NO_PARENT can be used to specify that the new +element node has no parent. NULL can be passed when the data in the +node is not dynamically allocated or is separately managed. + +

        +

        mxmlNewElement

        +

        Create a new element node.

        +

        +mxml_node_t *mxmlNewElement (
        +    mxml_node_t *parent,
        +    const char *name
        +);

        +

        Parameters

        +
        +
        parent
        +
        Parent node or MXML_NO_PARENT
        +
        name
        +
        Name of element
        +
        +

        Return Value

        +

        New node

        +

        Discussion

        +

        The new element node is added to the end of the specified parent's child +list. The constant MXML_NO_PARENT can be used to specify that the new +element node has no parent.

        +

        mxmlNewInteger

        +

        Create a new integer node.

        +

        +mxml_node_t *mxmlNewInteger (
        +    mxml_node_t *parent,
        +    int integer
        +);

        +

        Parameters

        +
        +
        parent
        +
        Parent node or MXML_NO_PARENT
        +
        integer
        +
        Integer value
        +
        +

        Return Value

        +

        New node

        +

        Discussion

        +

        The new integer node is added to the end of the specified parent's child +list. The constant MXML_NO_PARENT can be used to specify that the new +integer node has no parent.

        +

        mxmlNewOpaque

        +

        Create a new opaque string.

        +

        +mxml_node_t *mxmlNewOpaque (
        +    mxml_node_t *parent,
        +    const char *opaque
        +);

        +

        Parameters

        +
        +
        parent
        +
        Parent node or MXML_NO_PARENT
        +
        opaque
        +
        Opaque string
        +
        +

        Return Value

        +

        New node

        +

        Discussion

        +

        The new opaque node is added to the end of the specified parent's child +list. The constant MXML_NO_PARENT can be used to specify that the new +opaque node has no parent. The opaque string must be nul-terminated and +is copied into the new node.

        +

        mxmlNewReal

        +

        Create a new real number node.

        +

        +mxml_node_t *mxmlNewReal (
        +    mxml_node_t *parent,
        +    double real
        +);

        +

        Parameters

        +
        +
        parent
        +
        Parent node or MXML_NO_PARENT
        +
        real
        +
        Real number value
        +
        +

        Return Value

        +

        New node

        +

        Discussion

        +

        The new real number node is added to the end of the specified parent's +child list. The constant MXML_NO_PARENT can be used to specify that +the new real number node has no parent.

        +

        mxmlNewText

        +

        Create a new text fragment node.

        +

        +mxml_node_t *mxmlNewText (
        +    mxml_node_t *parent,
        +    int whitespace,
        +    const char *string
        +);

        +

        Parameters

        +
        +
        parent
        +
        Parent node or MXML_NO_PARENT
        +
        whitespace
        +
        1 = leading whitespace, 0 = no whitespace
        +
        string
        +
        String
        +
        +

        Return Value

        +

        New node

        +

        Discussion

        +

        The new text node is added to the end of the specified parent's child +list. The constant MXML_NO_PARENT can be used to specify that the new +text node has no parent. The whitespace parameter is used to specify +whether leading whitespace is present before the node. The text +string must be nul-terminated and is copied into the new node.

        +

        mxmlNewTextf

        +

        Create a new formatted text fragment node.

        +

        +mxml_node_t *mxmlNewTextf (
        +    mxml_node_t *parent,
        +    int whitespace,
        +    const char *format,
        +    ...
        +);

        +

        Parameters

        +
        +
        parent
        +
        Parent node or MXML_NO_PARENT
        +
        whitespace
        +
        1 = leading whitespace, 0 = no whitespace
        +
        format
        +
        Printf-style frmat string
        +
        ...
        +
        Additional args as needed
        +
        +

        Return Value

        +

        New node

        +

        Discussion

        +

        The new text node is added to the end of the specified parent's child +list. The constant MXML_NO_PARENT can be used to specify that the new +text node has no parent. The whitespace parameter is used to specify +whether leading whitespace is present before the node. The format +string must be nul-terminated and is formatted into the new node.

        +

         Mini-XML 2.3 mxmlNewXML

        +

        Create a new XML document tree.

        +

        +mxml_node_t *mxmlNewXML (
        +    const char *version
        +);

        +

        Parameters

        +
        +
        version
        +
        Version number to use
        +
        +

        Return Value

        +

        New ?xml node

        +

        Discussion

        +

        The "version" argument specifies the version number to put in the +?xml element node. If NULL, version 1.0 is assumed. + +

        +

         Mini-XML 2.3 mxmlRelease

        +

        Release a node.

        +

        +int mxmlRelease (
        +    mxml_node_t *node
        +);

        +

        Parameters

        +
        +
        node
        +
        Node
        +
        +

        Return Value

        +

        New reference count

        +

        Discussion

        +

        When the reference count reaches zero, the node (and any children) +is deleted via mxmlDelete(). + +

        +

        mxmlRemove

        +

        Remove a node from its parent.

        +

        +void mxmlRemove (
        +    mxml_node_t *node
        +);

        +

        Parameters

        +
        +
        node
        +
        Node to remove
        +
        +

        Discussion

        +

        Does not free memory used by the node - use mxmlDelete() for that. +This function does nothing if the node has no parent.

        +

         Mini-XML 2.3 mxmlRetain

        +

        Retain a node.

        +

        +int mxmlRetain (
        +    mxml_node_t *node
        +);

        +

        Parameters

        +
        +
        node
        +
        Node
        +
        +

        Return Value

        +

        New reference count

        +

         Mini-XML 2.3 mxmlSAXLoadFd

        +

        Load a file descriptor into an XML node tree +using a SAX callback.

        +

        +mxml_node_t *mxmlSAXLoadFd (
        +    mxml_node_t *top,
        +    int fd,
        +    mxml_load_cb_t cb,
        +    mxml_sax_cb_t sax_cb,
        +    void *sax_data
        +);

        +

        Parameters

        +
        +
        top
        +
        Top node
        +
        fd
        +
        File descriptor to read from
        +
        cb
        +
        Callback function or MXML_NO_CALLBACK
        +
        sax_cb
        +
        SAX callback or MXML_NO_CALLBACK
        +
        sax_data
        +
        SAX user data
        +
        +

        Return Value

        +

        First node or NULL if the file could not be read.

        +

        Discussion

        +

        The nodes in the specified file are added to the specified top node. +If no top node is provided, the XML file MUST be well-formed with a +single parent node like <?xml> for the entire file. The callback +function returns the value type that should be used for child nodes. +If MXML_NO_CALLBACK is specified then all child nodes will be either +MXML_ELEMENT or MXML_TEXT nodes.
        +
        +The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK, +MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading +child nodes of the specified type.
        +
        +The SAX callback must call mxmlRetain() for any nodes that need to +be kept for later use. Otherwise, nodes are deleted when the parent +node is closed or after each data, comment, CDATA, or directive node. + +

        +

         Mini-XML 2.3 mxmlSAXLoadFile

        +

        Load a file into an XML node tree +using a SAX callback.

        +

        +mxml_node_t *mxmlSAXLoadFile (
        +    mxml_node_t *top,
        +    FILE *fp,
        +    mxml_load_cb_t cb,
        +    mxml_sax_cb_t sax_cb,
        +    void *sax_data
        +);

        +

        Parameters

        +
        +
        top
        +
        Top node
        +
        fp
        +
        File to read from
        +
        cb
        +
        Callback function or MXML_NO_CALLBACK
        +
        sax_cb
        +
        SAX callback or MXML_NO_CALLBACK
        +
        sax_data
        +
        SAX user data
        +
        +

        Return Value

        +

        First node or NULL if the file could not be read.

        +

        Discussion

        +

        The nodes in the specified file are added to the specified top node. +If no top node is provided, the XML file MUST be well-formed with a +single parent node like <?xml> for the entire file. The callback +function returns the value type that should be used for child nodes. +If MXML_NO_CALLBACK is specified then all child nodes will be either +MXML_ELEMENT or MXML_TEXT nodes.
        +
        +The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK, +MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading +child nodes of the specified type.
        +
        +The SAX callback must call mxmlRetain() for any nodes that need to +be kept for later use. Otherwise, nodes are deleted when the parent +node is closed or after each data, comment, CDATA, or directive node. + +

        +

         Mini-XML 2.3 mxmlSAXLoadString

        +

        Load a string into an XML node tree +using a SAX callback.

        +

        +mxml_node_t *mxmlSAXLoadString (
        +    mxml_node_t *top,
        +    const char *s,
        +    mxml_load_cb_t cb,
        +    mxml_sax_cb_t sax_cb,
        +    void *sax_data
        +);

        +

        Parameters

        +
        +
        top
        +
        Top node
        +
        s
        +
        String to load
        +
        cb
        +
        Callback function or MXML_NO_CALLBACK
        +
        sax_cb
        +
        SAX callback or MXML_NO_CALLBACK
        +
        sax_data
        +
        SAX user data
        +
        +

        Return Value

        +

        First node or NULL if the string has errors.

        +

        Discussion

        +

        The nodes in the specified string are added to the specified top node. +If no top node is provided, the XML string MUST be well-formed with a +single parent node like <?xml> for the entire string. The callback +function returns the value type that should be used for child nodes. +If MXML_NO_CALLBACK is specified then all child nodes will be either +MXML_ELEMENT or MXML_TEXT nodes.
        +
        +The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK, +MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading +child nodes of the specified type.
        +
        +The SAX callback must call mxmlRetain() for any nodes that need to +be kept for later use. Otherwise, nodes are deleted when the parent +node is closed or after each data, comment, CDATA, or directive node. + +

        +

        mxmlSaveAllocString

        +

        Save an XML node tree to an allocated string.

        +

        +char *mxmlSaveAllocString (
        +    mxml_node_t *node,
        +    mxml_save_cb_t cb
        +);

        +

        Parameters

        +
        +
        node
        +
        Node to write
        +
        cb
        +
        Whitespace callback or MXML_NO_CALLBACK
        +
        +

        Return Value

        +

        Allocated string or NULL

        +

        Discussion

        +

        This function returns a pointer to a string containing the textual +representation of the XML node tree. The string should be freed +using the free() function when you are done with it. NULL is returned +if the node would produce an empty string or if the string cannot be +allocated.
        +
        +The callback argument specifies a function that returns a whitespace +string or NULL before and after each element. If MXML_NO_CALLBACK +is specified, whitespace will only be added before MXML_TEXT nodes +with leading whitespace and before attribute names inside opening +element tags.

        +

        mxmlSaveFd

        +

        Save an XML tree to a file descriptor.

        +

        +int mxmlSaveFd (
        +    mxml_node_t *node,
        +    int fd,
        +    mxml_save_cb_t cb
        +);

        +

        Parameters

        +
        +
        node
        +
        Node to write
        +
        fd
        +
        File descriptor to write to
        +
        cb
        +
        Whitespace callback or MXML_NO_CALLBACK
        +
        +

        Return Value

        +

        0 on success, -1 on error.

        +

        Discussion

        +

        The callback argument specifies a function that returns a whitespace +string or NULL before and after each element. If MXML_NO_CALLBACK +is specified, whitespace will only be added before MXML_TEXT nodes +with leading whitespace and before attribute names inside opening +element tags.

        +

        mxmlSaveFile

        +

        Save an XML tree to a file.

        +

        +int mxmlSaveFile (
        +    mxml_node_t *node,
        +    FILE *fp,
        +    mxml_save_cb_t cb
        +);

        +

        Parameters

        +
        +
        node
        +
        Node to write
        +
        fp
        +
        File to write to
        +
        cb
        +
        Whitespace callback or MXML_NO_CALLBACK
        +
        +

        Return Value

        +

        0 on success, -1 on error.

        +

        Discussion

        +

        The callback argument specifies a function that returns a whitespace +string or NULL before and after each element. If MXML_NO_CALLBACK +is specified, whitespace will only be added before MXML_TEXT nodes +with leading whitespace and before attribute names inside opening +element tags.

        +

        mxmlSaveString

        +

        Save an XML node tree to a string.

        +

        +int mxmlSaveString (
        +    mxml_node_t *node,
        +    char *buffer,
        +    int bufsize,
        +    mxml_save_cb_t cb
        +);

        +

        Parameters

        +
        +
        node
        +
        Node to write
        +
        buffer
        +
        String buffer
        +
        bufsize
        +
        Size of string buffer
        +
        cb
        +
        Whitespace callback or MXML_NO_CALLBACK
        +
        +

        Return Value

        +

        Size of string

        +

        Discussion

        +

        This function returns the total number of bytes that would be +required for the string but only copies (bufsize - 1) characters +into the specified buffer.
        +
        +The callback argument specifies a function that returns a whitespace +string or NULL before and after each element. If MXML_NO_CALLBACK +is specified, whitespace will only be added before MXML_TEXT nodes +with leading whitespace and before attribute names inside opening +element tags.

        +

         Mini-XML 2.3 mxmlSetCDATA

        +

        Set the element name of a CDATA node.

        +

        +int mxmlSetCDATA (
        +    mxml_node_t *node,
        +    const char *data
        +);

        +

        Parameters

        +
        +
        node
        +
        Node to set
        +
        data
        +
        New data string
        +
        +

        Return Value

        +

        0 on success, -1 on failure

        +

        Discussion

        +

        The node is not changed if it is not a CDATA element node. + +

        +

         Mini-XML 2.1 mxmlSetCustom

        +

        Set the data and destructor of a custom data node.

        +

        +int mxmlSetCustom (
        +    mxml_node_t *node,
        +    void *data,
        +    mxml_custom_destroy_cb_t destroy
        +);

        +

        Parameters

        +
        +
        node
        +
        Node to set
        +
        data
        +
        New data pointer
        +
        destroy
        +
        New destructor function
        +
        +

        Return Value

        +

        0 on success, -1 on failure

        +

        Discussion

        +

        The node is not changed if it is not a custom node. + +

        +

        mxmlSetCustomHandlers

        +

        Set the handling functions for custom data.

        +

        +void mxmlSetCustomHandlers (
        +    mxml_custom_load_cb_t load,
        +    mxml_custom_save_cb_t save
        +);

        +

        Parameters

        +
        +
        load
        +
        Load function
        +
        save
        +
        Save function
        +
        +

        Discussion

        +

        The load function accepts a node pointer and a data string and must +return 0 on success and non-zero on error.
        +
        +The save function accepts a node pointer and must return a malloc'd +string on success and NULL on error.

        +

        mxmlSetElement

        +

        Set the name of an element node.

        +

        +int mxmlSetElement (
        +    mxml_node_t *node,
        +    const char *name
        +);

        +

        Parameters

        +
        +
        node
        +
        Node to set
        +
        name
        +
        New name string
        +
        +

        Return Value

        +

        0 on success, -1 on failure

        +

        Discussion

        +

        The node is not changed if it is not an element node.

        +

        mxmlSetErrorCallback

        +

        Set the error message callback.

        +

        +void mxmlSetErrorCallback (
        +    mxml_error_cb_t cb
        +);

        +

        Parameters

        +
        +
        cb
        +
        Error callback function
        +
        +

        mxmlSetInteger

        +

        Set the value of an integer node.

        +

        +int mxmlSetInteger (
        +    mxml_node_t *node,
        +    int integer
        +);

        +

        Parameters

        +
        +
        node
        +
        Node to set
        +
        integer
        +
        Integer value
        +
        +

        Return Value

        +

        0 on success, -1 on failure

        +

        Discussion

        +

        The node is not changed if it is not an integer node.

        +

        mxmlSetOpaque

        +

        Set the value of an opaque node.

        +

        +int mxmlSetOpaque (
        +    mxml_node_t *node,
        +    const char *opaque
        +);

        +

        Parameters

        +
        +
        node
        +
        Node to set
        +
        opaque
        +
        Opaque string
        +
        +

        Return Value

        +

        0 on success, -1 on failure

        +

        Discussion

        +

        The node is not changed if it is not an opaque node.

        +

        mxmlSetReal

        +

        Set the value of a real number node.

        +

        +int mxmlSetReal (
        +    mxml_node_t *node,
        +    double real
        +);

        +

        Parameters

        +
        +
        node
        +
        Node to set
        +
        real
        +
        Real number value
        +
        +

        Return Value

        +

        0 on success, -1 on failure

        +

        Discussion

        +

        The node is not changed if it is not a real number node.

        +

        mxmlSetText

        +

        Set the value of a text node.

        +

        +int mxmlSetText (
        +    mxml_node_t *node,
        +    int whitespace,
        +    const char *string
        +);

        +

        Parameters

        +
        +
        node
        +
        Node to set
        +
        whitespace
        +
        1 = leading whitespace, 0 = no whitespace
        +
        string
        +
        String
        +
        +

        Return Value

        +

        0 on success, -1 on failure

        +

        Discussion

        +

        The node is not changed if it is not a text node.

        +

        mxmlSetTextf

        +

        Set the value of a text node to a formatted string.

        +

        +int mxmlSetTextf (
        +    mxml_node_t *node,
        +    int whitespace,
        +    const char *format,
        +    ...
        +);

        +

        Parameters

        +
        +
        node
        +
        Node to set
        +
        whitespace
        +
        1 = leading whitespace, 0 = no whitespace
        +
        format
        +
        Printf-style format string
        +
        ...
        +
        Additional arguments as needed
        +
        +

        Return Value

        +

        0 on success, -1 on failure

        +

        Discussion

        +

        The node is not changed if it is not a text node.

        +

         Mini-XML 2.3 mxmlSetWrapMargin

        +

        Set the the wrap margin when saving XML data.

        +

        +void mxmlSetWrapMargin (
        +    int column
        +);

        +

        Parameters

        +
        +
        column
        +
        Column for wrapping, 0 to disable wrapping
        +
        +

        Discussion

        +

        Wrapping is disabled when "column" is 0. + +

        +

        mxmlWalkNext

        +

        Walk to the next logical node in the tree.

        +

        +mxml_node_t *mxmlWalkNext (
        +    mxml_node_t *node,
        +    mxml_node_t *top,
        +    int descend
        +);

        +

        Parameters

        +
        +
        node
        +
        Current node
        +
        top
        +
        Top node
        +
        descend
        +
        Descend into tree - MXML_DESCEND, MXML_NO_DESCEND, or MXML_DESCEND_FIRST
        +
        +

        Return Value

        +

        Next node or NULL

        +

        Discussion

        +

        The descend argument controls whether the first child is considered +to be the next node. The top node argument constrains the walk to +the node's children.

        +

        mxmlWalkPrev

        +

        Walk to the previous logical node in the tree.

        +

        +mxml_node_t *mxmlWalkPrev (
        +    mxml_node_t *node,
        +    mxml_node_t *top,
        +    int descend
        +);

        +

        Parameters

        +
        +
        node
        +
        Current node
        +
        top
        +
        Top node
        +
        descend
        +
        Descend into tree - MXML_DESCEND, MXML_NO_DESCEND, or MXML_DESCEND_FIRST
        +
        +

        Return Value

        +

        Previous node or NULL

        +

        Discussion

        +

        The descend argument controls whether the previous node's last child +is considered to be the previous node. The top node argument constrains +the walk to the node's children.

        +

        Data Types

        +

        mxml_attr_t

        +

        An XML element attribute value.

        +

        +typedef struct mxml_attr_s mxml_attr_t; +

        +

        mxml_custom_destroy_cb_t

        +

        Custom data destructor

        +

        +typedef void (*mxml_custom_destroy_cb_t)(void *); +

        +

        mxml_custom_load_cb_t

        +

        Custom data load callback function

        +

        +typedef int (*mxml_custom_load_cb_t)(mxml_node_t *, const char *); +

        +

        mxml_custom_save_cb_t

        +

        Custom data save callback function

        +

        +typedef char *(*mxml_custom_save_cb_t)(mxml_node_t *); +

        +

         Mini-XML 2.1 mxml_custom_t

        +

        An XML custom value.

        +

        +typedef struct mxml_custom_s mxml_custom_t; +

        +

        mxml_element_t

        +

        An XML element value.

        +

        +typedef struct mxml_element_s mxml_element_t; +

        +

        mxml_entity_cb_t

        +

        Entity callback function

        +

        +typedef int (*mxml_entity_cb_t)(const char *); +

        +

        mxml_error_cb_t

        +

        Error callback function

        +

        +typedef void (*mxml_error_cb_t)(const char *); +

        +

        mxml_index_t

        +

        An XML node index.

        +

        +typedef struct mxml_index_s mxml_index_t; +

        +

        mxml_load_cb_t

        +

        Load callback function

        +

        +typedef mxml_type_t (*mxml_load_cb_t)(mxml_node_t *); +

        +

        mxml_node_t

        +

        An XML node.

        +

        +typedef struct mxml_node_s mxml_node_t; +

        +

        mxml_save_cb_t

        +

        Save callback function

        +

        +typedef const char *(*mxml_save_cb_t)(mxml_node_t *, int); +

        +

        mxml_sax_cb_t

        +

        SAX callback function

        +

        +typedef void (*mxml_sax_cb_t)(mxml_node_t *, mxml_sax_event_t, void *); +

        +

        mxml_sax_event_t

        +

        SAX event type.

        +

        +typedef enum mxml_sax_event_e mxml_sax_event_t; +

        +

        mxml_text_t

        +

        An XML text value.

        +

        +typedef struct mxml_text_s mxml_text_t; +

        +

        mxml_type_t

        +

        The XML node type.

        +

        +typedef enum mxml_type_e mxml_type_t; +

        +

        mxml_value_t

        +

        An XML node value.

        +

        +typedef union mxml_value_u mxml_value_t; +

        +

        Structures

        +

        mxml_attr_s

        +

        An XML element attribute value.

        +

        struct mxml_attr_s {
        +    char *name;
        +    char *value;
        +};

        +

        Members

        +
        +
        name
        +
        Attribute name
        +
        value
        +
        Attribute value
        +
        +

         Mini-XML 2.1 mxml_custom_s

        +

        An XML custom value.

        +

        struct mxml_custom_s {
        +    void *data;
        +    mxml_custom_destroy_cb_t destroy;
        +};

        +

        Members

        +
        +
        data
        +
        Pointer to (allocated) custom data
        +
        destroy
        +
        Pointer to destructor function
        +
        +

        mxml_element_s

        +

        An XML element value.

        +

        struct mxml_element_s {
        +    mxml_attr_t *attrs;
        +    char *name;
        +    int num_attrs;
        +};

        +

        Members

        +
        +
        attrs
        +
        Attributes
        +
        name
        +
        Name of element
        +
        num_attrs
        +
        Number of attributes
        +
        +

        mxml_index_s

        +

        An XML node index.

        +

        struct mxml_index_s {
        +    int alloc_nodes;
        +    char *attr;
        +    int cur_node;
        +    mxml_node_t **nodes;
        +    int num_nodes;
        +};

        +

        Members

        +
        +
        alloc_nodes
        +
        Allocated nodes in index
        +
        attr
        +
        Attribute used for indexing or NULL
        +
        cur_node
        +
        Current node
        +
        nodes
        +
        Node array
        +
        num_nodes
        +
        Number of nodes in index
        +
        +

        mxml_node_s

        +

        An XML node.

        +

        struct mxml_node_s {
        +    struct mxml_node_s *child;
        +    struct mxml_node_s *last_child;
        +    struct mxml_node_s *next;
        +    struct mxml_node_s *parent;
        +    struct mxml_node_s *prev;
        +    int ref_count;
        +    mxml_type_t type;
        +    void *user_data;
        +    mxml_value_t value;
        +};

        +

        Members

        +
        +
        child
        +
        First child node
        +
        last_child
        +
        Last child node
        +
        next
        +
        Next node under same parent
        +
        parent
        +
        Parent node
        +
        prev
        +
        Previous node under same parent
        +
        ref_count
        +
        Use count
        +
        type
        +
        Node type
        +
        user_data
        +
        User data
        +
        value
        +
        Node value
        +
        +

        mxml_text_s

        +

        An XML text value.

        +

        struct mxml_text_s {
        +    char *string;
        +    int whitespace;
        +};

        +

        Members

        +
        +
        string
        +
        Fragment string
        +
        whitespace
        +
        Leading whitespace?
        +
        +

        Unions

        +

        mxml_value_u

        +

        An XML node value.

        +

        union mxml_value_u {
        +    mxml_custom_t custom;
        +    mxml_element_t element;
        +    int integer;
        +    char *opaque;
        +    double real;
        +    mxml_text_t text;
        +};

        +

        Members

        +
        +
        custom  Mini-XML 2.1 
        +
        Custom data
        +
        element
        +
        Element
        +
        integer
        +
        Integer number
        +
        opaque
        +
        Opaque string
        +
        real
        +
        Real number
        +
        text
        +
        Text fragment
        +
        +

        Constants

        +

        mxml_sax_event_e

        +

        SAX event type.

        +

        Constants

        +
        +
        MXML_SAX_CDATA
        +
        CDATA node
        +
        MXML_SAX_COMMENT
        +
        Comment node
        +
        MXML_SAX_DATA
        +
        Data node
        +
        MXML_SAX_DIRECTIVE
        +
        Processing directive node
        +
        MXML_SAX_ELEMENT_CLOSE
        +
        Element closed
        +
        MXML_SAX_ELEMENT_OPEN
        +
        Element opened
        +
        +

        mxml_type_e

        +

        The XML node type.

        +

        Constants

        +
        +
        MXML_CUSTOM  Mini-XML 2.1 
        +
        Custom data
        +
        MXML_ELEMENT
        +
        XML element with attributes
        +
        MXML_IGNORE  Mini-XML 2.3 
        +
        Ignore/throw away node
        +
        MXML_INTEGER
        +
        Integer value
        +
        MXML_OPAQUE
        +
        Opaque string
        +
        MXML_REAL
        +
        Real value
        +
        MXML_TEXT
        +
        Text fragment
        +
        +
      + + diff -Naur mxml-2.6/doc/relnotes.html mxml-2.6-haiku/doc/relnotes.html --- mxml-2.6/doc/relnotes.html 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/relnotes.html 2009-05-17 17:31:51.000000000 +0000 @@ -0,0 +1,518 @@ + + + +

      BRelease Notes

      + + +

      Changes in Mini-XML 2.6

      + +
        + +
      • Documentation fixes (STR #91, STR #92)
        • + +
      • The mxmldoc program did not handle typedef comments properly (STR + #72)
        • + +
      • Added support for "long long" printf formats.
        • + +
      • The XML parser now ignores BOMs in UTF-8 XML files (STR #89)
        • + +
      • The mxmldoc program now supports generating Xcode documentation + sets.
        • + +
      • mxmlSave*() did not output UTF-8 correctly on some platforms.
        • + +
      • mxmlNewXML() now adds encoding="utf-8" in the ?xml + directive to avoid problems with non-conformant XML parsers that assume + something other than UTF-8 as the default encoding.
        • + +
      • Wrapping was not disabled when mxmlSetWrapMargin(0) was called, and + "<?xml ... ?>" was always followed by a newline + (STR #76)
        • + +
      • The mxml.pc.in file was broken (STR #79)
        • + +
      • The mxmldoc program now handles "typedef enum name {} + name" correctly (STR #72)
        • + +
      + + +

      Changes in Mini-XML 2.5

      + +
        + +
      • The mxmldoc program now makes greater use of CSS and + supports a --css option to embed an alternate stylesheet.
        • + +
      • The mxmldoc program now supports --header and --footer + options to insert documentation content before and + after the generated content.
        • + +
      • The mxmldoc program now supports a --framed option to + generate framed HTML output.
        • + +
      • The mxmldoc program now creates a table of contents + including any headings in the --intro file when + generating HTML output.
        • + +
      • The man pages and man page output from mxmldoc did + not use "\-" for dashes (STR #68)
        • + +
      • The debug version of the Mini-XML DLL could not be + built (STR #65)
        • + +
      • Processing instructions and directives did not work + when not at the top level of a document (STR #67)
        • + +
      • Spaces around the "=" in attributes were not supported + (STR #67)
        • + +
      + + +

      Changes in Mini-XML 2.4

      + +
        + +
      • Fixed shared library build problems on HP-UX and Mac OS X.
        • + +
      • The mxmldoc program did not output argument descriptions + for functions properly.
        • + +
      • All global settings (custom, error, and entity callbacks + and the wrap margin) are now managed separately for each + thread.
        • + +
      • Added mxmlElementDeleteAttr() function (STR #59)
        • + +
      • mxmlElementSetAttrf() did not work (STR #57)
        • + +
      • mxmlLoad*() incorrectly treated declarations as parent + elements (STR #56)
        • + +
      • mxmlLoad*() incorrectly allowed attributes without + values (STR #47)
        • + +
      • Fixed Visual C++ build problems (STR #49)
        • + +
      • mxmlLoad*() did not return NULL when an element + contained an error (STR #46)
        • + +
      • Added support for the apos character entity (STR + #54)
      • Fixed whitespace detection with Unicode + characters (STR #48)
        • + +
      • mxmlWalkNext() and mxmlWalkPrev() did not work correctly + when called with a node with no children as the top node + (STR #53)
        • + +
      + + +

      Changes in Mini-XML 2.3

      + +
        + +
      • Added two exceptions to the LGPL to support static + linking of applications against Mini-XML
        • + +
      • The mxmldoc utility can now generate man pages, + too.
        • + +
      • Added a mxmlNewXML() function
        • + +
      • Added a mxmlElementSetAttrf() function (STR #43)
        • + +
      • Added a snprintf() emulation function for the test + program (STR #32)
        • + +
      • Added the _CRT_SECURE_NO_DEPRECATE definition when + building on VC++ 2005 (STR #36)
        • + +
      • mxmlLoad*() did not detect missing > characters in + elements (STR #41)
        • + +
      • mxmlLoad*() did not detect missing close tags at the + end of an XML document (STR #45)
        • + +
      • Added user_data and ref_count members to mxml_node_t + structure
        • + +
      • Added mxmlReleaseNode() and mxmlRetainNode() APIs for + reference-counted nodes
        • + +
      • Added mxmlSetWrapMargin() to control the wrapping of + XML output
        • + +
      • Added conditional check for EINTR error code for + certain Windows compilers that do not define it (STR + #33)
        • + +
      • The mxmldoc program now generates correct HTML 4.0 + output - previously it generated invalid XHTML
        • + +
      • The mxmldoc program now supports "@deprecated@, + "@private@", and "@since version@" comments
        • + +
      • Fixed function and enumeration type bugs in + mxmldoc
        • + +
      • Fixed the XML schema for mxmldoc
        • + +
      • The mxmldoc program now supports --intro, --section, + and --title options
        • + +
      • The mxmlLoad*() functions could leak a node on an + error (STR #27)
        • + +
      • The mxml_vsnprintf() function could get in an + infinite loop on a buffer overflow (STR #25)
        • + +
      • Added new mxmlNewCDATA() and mxmlSetCDATA() functions + to create and set CDATA nodes, which are really just + special element nodes
        • + +
      • Added new MXML_IGNORE type and MXML_IGNORE_CB + callback to ignore non-element nodes, e.g. + whitespace
        • + +
      • mxmlLoad*() did not treat custom data as opaque, so + whitespace characters would be lost
        • + +
      + + +

      Changes in Mini-XML 2.2.2

      + +
        + +
      • mxmlLoad*() did not treat custom data as opaque, so + whitespace characters would be lost.
        • + +
      + + +

      Changes in Mini-XML 2.2.1

      + +
        + +
      • mxmlLoadFd(), mxmlLoadFile(), and mxmlLoadString() + now correctly return NULL on error (STR #21)
        • + +
      • mxmlNewInteger(), mxmlNewOpaque(), mxmlNewReal(), + mxmlNewText(), and mxmlNewTextf() incorrectly required a + parent node (STR #22)
        • + +
      • Fixed an XML output bug in mxmldoc.
        • + +
      • The "make install" target now uses the install + command to set the proper permissions on + UNIX/Linux/OSX.
        • + +
      • Fixed a MingW/Cygwin compilation problem (STR + #18)
        • + +
      + + +

      Changes in Mini-XML 2.2

      + +
        + +
      • Added shared library support (STR #17)
        • + +
      • mxmlLoad*() now returns an error when an XML stream + contains illegal control characters (STR #10)
        • + +
      • mxmlLoad*() now returns an error when an element + contains two attributes with the same name in + conformance with the XML spec (STR #16)
        • + +
      • Added support for CDATA (STR #14, STR #15)
        • + +
      • Updated comment and processing instruction handling - + no entity support per XML specification.
        • + +
      • Added checking for invalid comment termination ("--->" + is not allowed)
        • + +
      + +

      Changes in Mini-XML 2.1

      + +
        + +
      • Added support for custom data nodes (STR #6)
        • + +
      • Now treat UTF-8 sequences which are longer than + necessary as an error (STR #4)
        • + +
      • Fixed entity number support (STR #8)
        • + +
      • Fixed mxmlLoadString() bug with UTF-8 (STR #7)
        • + +
      • Fixed entity lookup bug (STR #5)
        • + +
      • Added mxmlLoadFd() and mxmlSaveFd() functions.
        • + +
      • Fixed multi-word UTF-16 handling.
        • + +
      + +

      Changes in Mini-XML 2.0

      + +
        + +
      • New programmers manual.
        • + +
      • Added Visual C++ project files for Microsoft Windows + users.
        • + +
      • Added optimizations to mxmldoc, mxmlSaveFile(), and + mxmlIndexNew() (STR #2)
        • + +
      • mxmlEntityAddCallback() now returns an integer + status (STR #2)
        • + +
      • Added UTF-16 support (input only; all output is + UTF-8)
        • + +
      • Added index functions to build a searchable index of + XML nodes.
        • + +
      • Added character entity callback interface to support + additional character entities beyond those defined in + the XHTML specification.
        • + +
      • Added support for XHTML character entities.
        • + +
      • The mxmldoc utility now produces XML output which + conforms to an updated XML schema, described in the file + "doc/mxmldoc.xsd".
        • + +
      • Changed the whitespace callback interface to return + strings instead of a single character, allowing for + greater control over the formatting of XML files written + using Mini-XML. THIS CHANGE WILL REQUIRE CHANGES TO + YOUR 1.x CODE IF YOU USE WHITESPACE CALLBACKS.
        • + +
      • The mxmldoc utility now produces XML output which + conforms to an updated XML schema, described in the file + "doc/mxmldoc.xsd".
        • + +
      • Changed the whitespace callback interface to return + strings instead of a single character, allowing for + greater control over the formatting of XML files written + using Mini-XML. THIS CHANGE WILL REQUIRE CHANGES TO + YOUR 1.x CODE IF YOU USE WHITESPACE CALLBACKS.
        • + +
      • The mxmldoc utility is now capable of documenting C++ + classes, functions, and structures, and correctly + handles C++ comments.
        • + +
      • Added new modular tests for mxmldoc.
        • + +
      • Updated the mxmldoc output to be more compatible with + embedding in manuals produced with HTMLDOC.
        • + +
      • The makefile incorrectly included a "/" separator + between the destination path and install path. This + caused problems when building and installing with + MingW.
        • + +
      + +

      Changes in Mini-XML 1.3

      + +
        + +
      • Fixes for mxmldoc.
        • + +
      • Added support for reading standard HTML entity names.
        • + +
      • mxmlLoadString/File() did not decode character + entities in element names, attribute names, or + attribute values.
        • + +
      • mxmlLoadString/File() would crash when loading non- + conformant XML data under an existing parent (top) + node.
        • + +
      • Fixed several bugs in the mxmldoc utility.
        • + +
      • Added new error callback function to catch a variety + of errors and log them to someplace other than stderr.
        • + +
      • The mxmlElementSetAttr() function now allows for NULL + attribute values.
        • + +
      • The load and save functions now properly handle quoted + element and attribute name strings properly, e.g. for + !DOCTYPE declarations.
        • + +
      + +

      Changes in Mini-XML 1.2

      + +
        + +
      • Added new "set" methods to set the value of a node.
        • + +
      • Added new formatted text methods mxmlNewTextf() and + mxmlSetTextf() to create/set a text node value using + printf-style formats.
        • + +
      • Added new standard callbacks for use with the mxmlLoad + functions.
        • + +
      • Updated the HTML documentation to include examples of + the walk and load function output.
        • + +
      • Added --with/without-ansi configure option to control + the strdup() function check.
        • + +
      • Added --with/without-snprintf configure option to + control the snprintf() and vsnprintf() function + checks.
        • + +
      + +

      Changes in Mini-XML 1.1.2

      + +
        + +
      • The mxml(3) man page wasn't updated for the string + functions.
        • + +
      • mxmlSaveString() returned the wrong number of + characters.
        • + +
      • mxml_add_char() updated the buffer pointer in the + wrong place.
        • + +
      + +

      Changes in Mini-XML 1.1.1

      + +
        + +
      • The private mxml_add_ch() function did not update the + start-of-buffer pointer which could cause a crash when + using mxmlSaveString().
        • + +
      • The private mxml_write_ws() function called putc() + instead of using the proper callback which could cause + a crash when using mxmlSaveString().
        • + +
      • Added a mxmlSaveAllocString() convenience function for + saving an XML node tree to an allocated string.
        • + +
      + +

      Changes in Mini-XML 1.1

      + +
        + +
      • The mxmlLoadFile() function now uses dynamically + allocated string buffers for element names, attribute + names, and attribute values. Previously they were + capped at 16383, 255, and 255 bytes, respectively.
        • + +
      • Added a new mxmlLoadString() function for loading an + XML node tree from a string.
        • + +
      • Added a new mxmlSaveString() function for saving an + XML node tree to a string.
        • + +
      • Add emulation of strdup() if the local platform does + not provide the function.
        • + +
      + +

      Changes in Mini-XML 1.0

      + +
        + +
      • The mxmldoc program now handles function arguments, + structures, unions, enumerations, classes, and + typedefs properly.
        • + +
      • Documentation provided via mxmldoc and more in-line + comments in the code.
        • + +
      • Added man pages and packaging files.
        • + +
      + +

      Changes in Mini-XML 0.93

      + +
        + +
      • New mxmldoc example program that is also used to + create and update code documentation using XML and + produce HTML reference pages.
        • + +
      • Added mxmlAdd() and mxmlRemove() functions to add and + remove nodes from a tree. This provides more + flexibility over where the nodes are inserted and + allows nodes to be moved within the tree as needed.
        • + +
      • mxmlLoadFile() now correctly handles comments.
        • + +
      • mxmlLoadFile() now supports the required "gt", "quot", + and "nbsp" character entities.
        • + +
      • mxmlSaveFile() now uses newlines as whitespace + when valid to do so.
        • + +
      • mxmlFindElement() now also takes attribute name and + attribute value string arguments to limit the search + to specific elements with attributes and/or values.
        • + NULL pointers can be used as "wildcards". + +
      • Added uninstall target to makefile, and auto-reconfig + if Makefile.in or configure.in are changed.
        • + +
      • mxmlFindElement(), mxmlWalkNext(), and mxmlWalkPrev() + now all provide "descend" arguments to control whether + they descend into child nodes in the tree.
        • + +
      • Fixed some whitespace issues in mxmlLoadFile().
        • + +
      • Fixed Unicode output and whitespace issues in + mxmlSaveFile().
        • + +
      • mxmlSaveFile() now supports a whitespace callback to + provide more human-readable XML output under program + control.
        • + +
      + +

      Changes in Mini-XML 0.92

      + +
        + +
      • mxmlSaveFile() didn't return a value on success.
        • + +
      + +

      Changes in Mini-XML 0.91

      + +
        + +
      • mxmlWalkNext() would go into an infinite loop.
        • + +
      + +

      Changes in Mini-XML 0.9

      + +
        + +
      • Initial public release.
        • + +
      + + + diff -Naur mxml-2.6/doc/schema.html mxml-2.6-haiku/doc/schema.html --- mxml-2.6/doc/schema.html 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/schema.html 2007-04-26 22:21:37.000000000 +0000 @@ -0,0 +1,201 @@ + + + +

      DXML Schema

      + +

      This appendix provides the XML schema that is used for the XML +files produced by mxmldoc. This schema is available on-line +at:

      + +
      +    http://www.easysw.com/~mike/mxmldoc.xsd
+
      + +

      mxmldoc.xsd

      + +
      
+<?xml version="1.0"?>
+<xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema">
+  <xsd:annotation>
+    <xsd:documentation xml:lang="en">
+      Mini-XML 2.3 documentation schema for mxmldoc output.
+      Copyright 2003-2007 by Michael Sweet.
+    </xsd:documentation>
+  </xsd:annotation>
+
+  <!-- basic element definitions -->
+  <xsd:element name="argument" type="argumentType"/>
+  <xsd:element name="class" type="classType"/>
+  <xsd:element name="constant" type="constantType"/>
+  <xsd:element name="description" type="xsd:string"/>
+  <xsd:element name="enumeration" type="enumerationType"/>
+  <xsd:element name="function" type="functionType"/>
+  <xsd:element name="mxmldoc" type="mxmldocType"/>
+  <xsd:element name="namespace" type="namespaceType"/>
+  <xsd:element name="returnvalue" type="returnvalueType"/>
+  <xsd:element name="seealso" type="identifierList"/>
+  <xsd:element name="struct" type="structType"/>
+  <xsd:element name="typedef" type="typedefType"/>
+  <xsd:element name="type" type="xsd:string"/>
+  <xsd:element name="union" type="unionType"/>
+  <xsd:element name="variable" type="variableType"/>
+
+  <!-- descriptions of complex elements -->
+  <xsd:complexType name="argumentType">
+    <xsd:sequence>
+      <xsd:element ref="type" minOccurs="1" maxOccurs="1"/>
+      <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+    </xsd:sequence>
+    <xsd:attribute name="default" type="xsd:string" use="optional"/>
+    <xsd:attribute name="name" type="identifier" use="required"/>
+    <xsd:attribute name="direction" type="direction" use="optional"
+     default="I"/>
+  </xsd:complexType>
+
+  <xsd:complexType name="classType">
+    <xsd:sequence>
+      <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+      <xsd:choice minOccurs="0" maxOccurs="unbounded">
+	<xsd:element ref="class"/>
+	<xsd:element ref="enumeration"/>
+	<xsd:element ref="function"/>
+	<xsd:element ref="struct"/>
+	<xsd:element ref="typedef"/>
+	<xsd:element ref="union"/>
+	<xsd:element ref="variable"/>
+      </xsd:choice>
+    </xsd:sequence>
+    <xsd:attribute name="name" type="identifier" use="required"/>
+    <xsd:attribute name="parent" type="xsd:string" use="optional"/>
+  </xsd:complexType>
+
+  <xsd:complexType name="constantType">
+    <xsd:sequence>
+      <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+    </xsd:sequence>
+    <xsd:attribute name="name" type="identifier" use="required"/>
+  </xsd:complexType>
+
+  <xsd:complexType name="enumerationType">
+    <xsd:sequence>
+      <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+      <xsd:element ref="constant" minOccurs="1" maxOccurs="unbounded"/>
+    </xsd:sequence>
+    <xsd:attribute name="name" type="identifier" use="required"/>
+  </xsd:complexType>
+
+  <xsd:complexType name="functionType">
+    <xsd:sequence>
+      <xsd:element ref="returnvalue" minOccurs="0" maxOccurs="1"/>
+      <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+      <xsd:element ref="argument" minOccurs="1" maxOccurs="unbounded"/>
+      <xsd:element ref="seealso" minOccurs="0" maxOccurs="1"/>
+    </xsd:sequence>
+    <xsd:attribute name="name" type="identifier" use="required"/>
+    <xsd:attribute name="scope" type="scope" use="optional"/>
+  </xsd:complexType>
+
+  <xsd:complexType name="mxmldocType">
+    <xsd:choice minOccurs="0" maxOccurs="unbounded">
+      <xsd:element ref="class"/>
+      <xsd:element ref="enumeration"/>
+      <xsd:element ref="function"/>
+      <xsd:element ref="namespace"/>
+      <xsd:element ref="struct"/>
+      <xsd:element ref="typedef"/>
+      <xsd:element ref="union"/>
+      <xsd:element ref="variable"/>
+    </xsd:choice>
+  </xsd:complexType>
+
+  <xsd:complexType name="namespaceType">
+    <xsd:sequence>
+      <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+      <xsd:choice minOccurs="0" maxOccurs="unbounded">
+	<xsd:element ref="class"/>
+	<xsd:element ref="enumeration"/>
+	<xsd:element ref="function"/>
+	<xsd:element ref="struct"/>
+	<xsd:element ref="typedef"/>
+	<xsd:element ref="union"/>
+	<xsd:element ref="variable"/>
+      </xsd:choice>
+    </xsd:sequence>
+    <xsd:attribute name="name" type="identifier" use="required"/>
+  </xsd:complexType>
+
+  <xsd:complexType name="returnvalueType">
+    <xsd:sequence>
+      <xsd:element ref="type" minOccurs="1" maxOccurs="1"/>
+      <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+    </xsd:sequence>
+  </xsd:complexType>
+
+  <xsd:complexType name="structType">
+    <xsd:sequence>
+      <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+      <xsd:choice minOccurs="0" maxOccurs="unbounded">
+	<xsd:element ref="variable"/>
+	<xsd:element ref="function"/>
+      </xsd:choice>
+    </xsd:sequence>
+    <xsd:attribute name="name" type="identifier" use="required"/>
+  </xsd:complexType>
+
+  <xsd:complexType name="typedefType">
+    <xsd:sequence>
+      <xsd:element ref="type" minOccurs="1" maxOccurs="1"/>
+      <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+    </xsd:sequence>
+    <xsd:attribute name="name" type="identifier" use="required"/>
+  </xsd:complexType>
+
+  <xsd:complexType name="unionType">
+    <xsd:sequence>
+      <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+      <xsd:element ref="variable" minOccurs="0" maxOccurs="unbounded"/>
+    </xsd:sequence>
+    <xsd:attribute name="name" type="identifier" use="required"/>
+  </xsd:complexType>
+
+  <xsd:complexType name="variableType">
+    <xsd:sequence>
+      <xsd:element ref="type" minOccurs="1" maxOccurs="1"/>
+      <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+    </xsd:sequence>
+    <xsd:attribute name="name" type="identifier" use="required"/>
+  </xsd:complexType>
+
+  <!-- data types -->
+  <xsd:simpleType name="direction">
+    <xsd:restriction base="xsd:string">
+      <xsd:enumeration value="I"/>
+      <xsd:enumeration value="O"/>
+      <xsd:enumeration value="IO"/>
+    </xsd:restriction>
+  </xsd:simpleType>
+
+  <xsd:simpleType name="identifier">
+    <xsd:restriction base="xsd:string">
+      <xsd:pattern value="[a-zA-Z_(.]([a-zA-Z_(.,)* 0-9])*"/>
+    </xsd:restriction>
+  </xsd:simpleType>
+
+  <xsd:simpleType name="identifierList">
+    <xsd:list itemType="identifier"/>
+  </xsd:simpleType>
+
+  <xsd:simpleType name="scope">
+    <xsd:restriction base="xsd:string">
+      <xsd:enumeration value=""/>
+      <xsd:enumeration value="private"/>
+      <xsd:enumeration value="protected"/>
+      <xsd:enumeration value="public"/>
+    </xsd:restriction>
+  </xsd:simpleType>
+</xsd:schema>
+
      + + + diff -Naur mxml-2.6/doc/title.html mxml-2.6-haiku/doc/title.html --- mxml-2.6/doc/title.html 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/doc/title.html 2009-05-17 06:04:58.000000000 +0000 @@ -0,0 +1,37 @@ + + + + Mini-XML Programmers Manual + + + + + + + +
      + +

      Mini-XML Programmers Manual
      +Version 2.6

      + +

      MICHAEL R. SWEET

      + +
      + + +

      Mini-XML Programmers Manual, Version 2.6

      + +

      Copyright © 2003-2009 by Michael R. Sweet

      + +

      Permission is granted to copy, distribute and/or modify +this document under the terms of the GNU Library General Public +License, Version 2. A copy of this license is included in Appendix A - Mini-XML License.

      + +

      This book was created solely using free software +tools.

      + +

      First Printing: April 2007

      + + + diff -Naur mxml-2.6/install-sh mxml-2.6-haiku/install-sh --- mxml-2.6/install-sh 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/install-sh 2005-04-24 23:23:59.000000000 +0000 @@ -0,0 +1,251 @@ +#!/bin/sh +# +# install - install a program, script, or datafile +# This comes from X11R5 (mit/util/scripts/install.sh). +# +# Copyright 1991 by the Massachusetts Institute of Technology +# +# Permission to use, copy, modify, distribute, and sell this software and its +# documentation for any purpose is hereby granted without fee, provided that +# the above copyright notice appear in all copies and that both that +# copyright notice and this permission notice appear in supporting +# documentation, and that the name of M.I.T. not be used in advertising or +# publicity pertaining to distribution of the software without specific, +# written prior permission. M.I.T. makes no representations about the +# suitability of this software for any purpose. It is provided "as is" +# without express or implied warranty. +# +# Calling this script install-sh is preferred over install.sh, to prevent +# `make' implicit rules from creating a file called install from it +# when there is no Makefile. +# +# This script is compatible with the BSD install script, but was written +# from scratch. It can only install one file at a time, a restriction +# shared with many OS's install programs. + + +# set DOITPROG to echo to test this script + +# Don't use :- since 4.3BSD and earlier shells don't like it. +doit="${DOITPROG-}" + + +# put in absolute paths if you don't have them in your path; or use env. vars. + +mvprog="${MVPROG-mv}" +cpprog="${CPPROG-cp}" +chmodprog="${CHMODPROG-chmod}" +chownprog="${CHOWNPROG-chown}" +chgrpprog="${CHGRPPROG-chgrp}" +stripprog="${STRIPPROG-strip}" +rmprog="${RMPROG-rm}" +mkdirprog="${MKDIRPROG-mkdir}" + +transformbasename="" +transform_arg="" +instcmd="$mvprog" +chmodcmd="$chmodprog 0755" +chowncmd="" +chgrpcmd="" +stripcmd="" +rmcmd="$rmprog -f" +mvcmd="$mvprog" +src="" +dst="" +dir_arg="" + +while [ x"$1" != x ]; do + case $1 in + -c) instcmd="$cpprog" + shift + continue;; + + -d) dir_arg=true + shift + continue;; + + -m) chmodcmd="$chmodprog $2" + shift + shift + continue;; + + -o) chowncmd="$chownprog $2" + shift + shift + continue;; + + -g) chgrpcmd="$chgrpprog $2" + shift + shift + continue;; + + -s) stripcmd="$stripprog" + shift + continue;; + + -t=*) transformarg=`echo $1 | sed 's/-t=//'` + shift + continue;; + + -b=*) transformbasename=`echo $1 | sed 's/-b=//'` + shift + continue;; + + *) if [ x"$src" = x ] + then + src=$1 + else + # this colon is to work around a 386BSD /bin/sh bug + : + dst=$1 + fi + shift + continue;; + esac +done + +if [ x"$src" = x ] +then + echo "install: no input file specified" + exit 1 +else + : +fi + +if [ x"$dir_arg" != x ]; then + dst=$src + src="" + + if [ -d $dst ]; then + instcmd=: + chmodcmd="" + else + instcmd=$mkdirprog + fi +else + +# Waiting for this to be detected by the "$instcmd $src $dsttmp" command +# might cause directories to be created, which would be especially bad +# if $src (and thus $dsttmp) contains '*'. + + if [ -f $src -o -d $src ] + then + : + else + echo "install: $src does not exist" + exit 1 + fi + + if [ x"$dst" = x ] + then + echo "install: no destination specified" + exit 1 + else + : + fi + +# If destination is a directory, append the input filename; if your system +# does not like double slashes in filenames, you may need to add some logic + + if [ -d $dst ] + then + dst="$dst"/`basename $src` + else + : + fi +fi + +## this sed command emulates the dirname command +dstdir=`echo $dst | sed -e 's,[^/]*$,,;s,/$,,;s,^$,.,'` + +# Make sure that the destination directory exists. +# this part is taken from Noah Friedman's mkinstalldirs script + +# Skip lots of stat calls in the usual case. +if [ ! -d "$dstdir" ]; then +defaultIFS=' + ' +IFS="${IFS-${defaultIFS}}" + +oIFS="${IFS}" +# Some sh's can't handle IFS=/ for some reason. +IFS='%' +set - `echo ${dstdir} | sed -e 's@/@%@g' -e 's@^%@/@'` +IFS="${oIFS}" + +pathcomp='' + +while [ $# -ne 0 ] ; do + pathcomp="${pathcomp}${1}" + shift + + if [ ! -d "${pathcomp}" ] ; + then + $mkdirprog "${pathcomp}" + else + : + fi + + pathcomp="${pathcomp}/" +done +fi + +if [ x"$dir_arg" != x ] +then + $doit $instcmd $dst && + + if [ x"$chowncmd" != x ]; then $doit $chowncmd $dst; else : ; fi && + if [ x"$chgrpcmd" != x ]; then $doit $chgrpcmd $dst; else : ; fi && + if [ x"$stripcmd" != x ]; then $doit $stripcmd $dst; else : ; fi && + if [ x"$chmodcmd" != x ]; then $doit $chmodcmd $dst; else : ; fi +else + +# If we're going to rename the final executable, determine the name now. + + if [ x"$transformarg" = x ] + then + dstfile=`basename $dst` + else + dstfile=`basename $dst $transformbasename | + sed $transformarg`$transformbasename + fi + +# don't allow the sed command to completely eliminate the filename + + if [ x"$dstfile" = x ] + then + dstfile=`basename $dst` + else + : + fi + +# Make a temp file name in the proper directory. + + dsttmp=$dstdir/#inst.$$# + +# Move or copy the file name to the temp name + + $doit $instcmd $src $dsttmp && + + trap "rm -f ${dsttmp}" 0 && + +# and set any options; do chmod last to preserve setuid bits + +# If any of these fail, we abort the whole thing. If we want to +# ignore errors from any of these, just make sure not to ignore +# errors from the above "$doit $instcmd $src $dsttmp" command. + + if [ x"$chowncmd" != x ]; then $doit $chowncmd $dsttmp; else :;fi && + if [ x"$chgrpcmd" != x ]; then $doit $chgrpcmd $dsttmp; else :;fi && + if [ x"$stripcmd" != x ]; then $doit $stripcmd $dsttmp; else :;fi && + if [ x"$chmodcmd" != x ]; then $doit $chmodcmd $dsttmp; else :;fi && + +# Now rename the file to the real destination. + + $doit $rmcmd -f $dstdir/$dstfile && + $doit $mvcmd $dsttmp $dstdir/$dstfile + +fi && + + +exit 0 diff -Naur mxml-2.6/libmxml.so.2.6 mxml-2.6-haiku/libmxml.so.2.6 --- mxml-2.6/libmxml.so.2.6 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/libmxml.so.2.6 2009-10-26 02:44:10.000000000 +0000 @@ -0,0 +1,414 @@ +ELF4¥4 (DzDzDzDŠDŠ´Ìl†l–l–¸¸ar^]oDY Tig0eZ#jdfA\UR`)c-Imanb',?1/O 8V! 2PqQ6( +Wp4hSE>M.l &+"%5=9;*:FH<3@KJX$GNB[_7LCk|°k àk +DŠ \– d– À—øŸ‡G׌c\€d Ï_(UIà)Bðì(‹k§§d°g"Ò§2ßb6»<ý,c]ÎÞ°i HÄaO¤0 CÉhÜj{Àè\$5²¦¡;x)fdC¥h%Ëy $N|ØŽ¿˜i  +\(_* ÎgÈ#×ü,µJì!Œ·.ú'º" ÔeWkd*3/îLbSÀÈ&<ï°j*°J@;˜*$<^pÌ—µh&`-,fG:€fR`4ƒ8u9ƒ} u +ë1v‹Gë+‹p‹x …ö~‹E ƒÄøP‹PèÝüÿÿƒÄ…ÀtÚNƒÇ…öâ1Àeè[^_‰ì]ÉöU‰åƒì WVSè[Úu‹}‹E…ÿtEƒ?u@ƒ} t:…ÀtƒÄôPèYüÿÿ‰ÆƒÄë¶1öƒÄüV‹E PW訃Ä…Àt ƒÄôVèœüÿÿeè[^_‰ì]ÉöU‰åƒì WVSè[Ã*u‹}‹U…ÿtcƒ?u^ƒ} tX…ÒtTEƒÄøPRèµH‰ÆƒÄ…öu ‹GƒÄüP‹E PƒÕÿÿPèÙFë%´&ƒÄüV‹E PWèƒÄ…Àt ƒÄôVèüÿÿeè[^_‰ì]ÃU‰åƒì WVSè[Þt‹E‹x‹p …ÿ~A¶‹U ƒÄøR‹PèûÿÿƒÄ…Àu‹F…Àt ƒÄôPè¶ûÿÿ‹E‰F1ÀéOƒÆ…ÿÅ‹U‹B…Àu ƒÄôjè=úÿÿëƒÄøÅP‹U‹B Pèôúÿÿ‰ÆƒÄ…öt3‹U‰r ƒÄô‹BÁàÆ‹E Pèáúÿÿ‰ƒÄ…Àt‹U‹E‰Vÿ@1Àë‹UƒÄü‹BP‹E PƒÕÿÿPèÂE¸ÿÿÿÿeè[^_‰ì]ÃU‰åƒìVSè[çsè?F‰Á‹qƒþc~ƒÄôƒ\ÕÿÿPè~E¸ÿÿÿÿë´&‹EQ‰²ÿA1Àeè[^‰ì]ÃU‰åSè[ÃSs‹EƒÀÞƒø‡±‰Ú+”ƒÜŒÿÿÿâ´&¼'”rŒrŒrŒr°rŒrŒrŒrŒrŒrŒrŒrŒrŒrŒrŒrŒrŒrŒrŒrŒrŒrŒrŒrŒrŒr¤rŒrœrƒ{Õÿÿët&ƒÕÿÿ냂Õÿÿë +ƒ…Õÿÿë1À[‰ì]ÃU‰åƒì WVSè[ÃvrèE‰Æ1ÿ;~}‹UƒÄôFR‹¸ÿЃÄ…À} G;~|ä¸ÿÿÿÿeè[^_‰ì]ÉöU‰åƒìWVSè[Ã&rè¾D‰Â1ö‹B‰Á9Î}FB ‰Eôz‰}üB‹};<°u"Aÿ‰B9Æ}%ƒÄü)ðÁàP‹}ôW‹EüPèž÷ÿÿë ƒEôƒEüF9Î|ÆeØ[^_‰ì]ÃU‰åƒìWVSè[îqÇEüÇEøt&‹EüEø‰ÂÁê<ÑÿƒÄøƒ¬‰þÁæ‰Eô‹P‹URè~øÿÿƒÄ…Àt]} ‰}øët&‰}ü‹Eø+Eüƒø²‹uü‹UôÁæƒÄø‹P‹EPèEøÿÿƒÄ…Àt$‹uø‹UôÁæƒÄø‹P‹EPè%øÿÿ…Àt¸ÿÿÿÿë‹Uô‹DeØ[^_‰ì]ÃU‰å1À‹Uƒú tƒú t +ƒú tƒú +u¸‰ì]ÃvU‰åì VSè[ìp‹u‹E ‹M‰…ôßÿÿ•ôßÿÿ…àÿÿ‰…øßÿÿ‰…üßÿÿƒÄøjjƒè”ÿÿPQRVèÐ¥Øßÿÿ[^‰ì]ÃU‰åƒìVSè[ÃOp‹u‹M ‹UƒÄøjjƒ@›ÿÿPRQVè‘eè[^‰ì]ÃU‰åƒìSè[Ãp‹M‹UƒÄøjjƒ„³ÿÿPRE PQèV‹]è‰ì]ÃvU‰åì WVSè[ÃÓo‹E Ph µàÿÿV‹EPè{ƒÄ…À~@=þƒÄôVè„öÿÿë0¶ƒÄôxWèõÿÿ‰ÆƒÄ…öt‹E PWV‹EPè8‰ðë1À¥èßÿÿ[^_‰ì]ÃU‰åì WVSè[ÃKo‹u ‹}èÝA‰µôßÿÿµôßÿÿ•àÿÿ‰•øßÿÿ‰­üßÿÿƒÄøPƒ šÿÿPjWV‹EPè;'ƒÄ …À|~ƒÄøVj +èûƒÄ…À}¸ÿÿÿÿë ƒÄôVè¨ ¥Øßÿÿ[^_‰ì]ÃvU‰åƒì WVSè[ún‹}‹uèLAƒÄøPƒ” ÿÿPjV‹E PWèÈ&ƒÄ …À|7~C‹ƒ€8t‹E ƒÄøPj +èôÿÿ…À|ë$t&‹E ƒÄøPj +è^õÿÿ…À}¸ÿÿÿÿë ´&1Àeè[^_‰ì]ÃU‰åƒìWVSè[Ã*n‹uè¿@‹U ‰Uø}øU‰WƒÄøPƒ·ÿÿPjVW‹EPè,&ƒÄ …À} ¸ÿÿÿÿë/‰ö…À~ ƒÄøWj +èÕ$‹Eø;Gr ‹U‹E ÆDÿëÆ‹Eø+E eØ[^_‰ì]ÃU‰åì WVSè[Ûm‹E ‹}‹M‹U‰…ôßÿÿµôßÿÿ…àÿÿ‰…øßÿÿ‰…üßÿÿƒÄøRQƒè”ÿÿPWV‹EP軥Øßÿÿ[^_‰ì]ÉöU‰åƒì WVSè[Ã6m‹}‹u ‹M‹U‹EƒÄøPRƒ@›ÿÿPQVWèteè[^_‰ì]ÉöU‰åƒìVSè[Ãól‹u‹M‹U‹EƒÄøPRƒ„³ÿÿPQE PVè1eè[^‰ì]ÃU‰åƒì WVSè[òl‹u‹} èD?‰°œ‰¸ [^_‰ì]ÃU‰åƒìVSè[Ãl‹uè?‰0[^‰ì]ÃU‰åƒìVSè[Ã[l‹uèð>‰°˜[^‰ì]ÃU‰åƒì WVSè[Ã2l‹}‹u ‹E‹M‹‰ÐƒÀü9rzúÿ ‹EÒ‰ë ‹M‰‹UƒÄø‹P‹M‹Pèºòÿÿ‰ÂƒÄ…Òu-‹UƒÄô‹Pè#óÿÿ‹MƒÄø‹Pƒ<ÛÿÿPè²=¸ÿÿÿÿ釋M‹‹)Á‰ÈЉ‹E‰ƒÿ‹‰úˆëb´&ÿÿ ‹‰øÁø Àë:ÿÿÿ ‹‰øÁø à닉øÁø ðˆÿ‹‰øÁø $? €ˆÿ‹‰øÁø$? €ˆÿ‹‰ø$? €ˆÿ1Àeè[^_‰ì]ÃvU‰åƒì WVSè[à +k‹} ‹U‹B9BrƒÄôRèDƒÄ…ÀŒS‹U‹B¶0ÿB‹ƒø„6 …Àt齃ø„Ô鯉ð„À|)ƒþ ƒþ +„—ƒþ „Žƒþ …éé€þþuF‹U‹B9BrƒÄôR较ąÀŒÍ‹U‹B¶0ÿBþÿ…µÇé8ÿÿÿt&þÿuH‹U‹B9BrƒÄôRèpƒÄ…ÀŒ‹U‹B¶0ÿBþþ…gÇéêþÿÿ¶‰ð%à=Àud‹U‹B9BrƒÄôRèƒÄ…ÀŒ)‹U‹B1ÒŠ‹Eÿ@‰Ð%À=€…ƒæÁæƒâ? ÖƒþƒÄøVƒ¼ÛÿÿéÞ‰ð%ð=à…½‹U‹B9BrƒÄôR褃ąÀŒ³‹U‹B1ÒŠ‹Eÿ@‰Ð%À=€…‘ƒæÁæƒâ? Ö‹U‹B9BrƒÄôRèXƒÄ…ÀŒg‹U‹B1ÒŠ‹Eÿ@‰Ð%À=€…EÁæƒâ? ÖþÿƒÄøVƒ¼Ûÿÿé þÿþ…¦é£ýÿÿ‰ð%ø=ð…‹U‹B9BrƒÄôRèՃąÀŒä‹U‹B1ÒŠ‹Eÿ@‰Ð%À=€…ƒæÁæƒâ? Ö‹U‹B9BrƒÄôR艃ąÀŒ˜‹U‹B1ÒŠ‹Eÿ@‰Ð%À=€…vÁæƒâ? Ö‹U‹B9BrƒÄôRè@ƒÄ…ÀŒO‹U‹B1ÒŠ‹Eÿ@‰Ð%À=€…-Áæƒâ? Öþÿÿ¥ƒÄøVƒ¼Ûÿÿét&‹U‹B9BrƒÄôRè؃ąÀŒç‹UÁæ‹B1ÒŠ‹E Öÿ@ƒþƒþ +tƒþ t ƒþ …ª†(ÿÿ=ÿ‡5‹U‹B9BrƒÄôRè{ƒÄ…ÀŒŠ‹U‹B¶8‹BÿB9Br ƒÄôRèS…À|i‹UÁç‹B1ÒŠ‹Eé·‹U‹B9BrƒÄôRè&ƒÄ…À|9‹U‹B1ÒŠ‹EÁâ Öÿ@ƒþ)ƒþ +t$ƒþ tƒþ tƒÄøVƒ|ÛÿÿPèŠ8¸ÿÿÿÿ鄆(ÿÿ=ÿwu‹U‹B9BrƒÄôR軃Ä…À|΋U‹B¶8‹BÿB9Br ƒÄôRè—…À|­‹U‹B1ÒŠ‹EÁâ ×ÿ@‡$ÿÿ=þw‹æÿÁæ +çÿ ÷·‰ðeè[^_‰ì]ÉöU‰åƒìVSè[Ãçe‹u ‹F9FrƒÄôV蜅À}¸ÿÿÿÿë ‹V‹EˆÿF1Àeè[^‰ì]ÃvU‰åƒì WVSè[Úe‹}…ÿu"ëK¶èwìÿÿ8 €t èjìÿÿ8 +€u+ƒÄüh w V‹PèìÿÿƒÄ…À|Ët‰wD ‰G1Àë¸ÿÿÿÿeè[^_‰ì]ÃU‰åƒì WVSè[Ã"e‹}…ÿu¸ÿÿÿÿëAG ‰Eü‹G;Eüt1‹uü9Æs$t&‹GƒÄü)ðPV‹PèJëÿÿƒÄ…À|ÇÆ;wrà‹Eü‰G1Àeè[^_‰ì]ÉöU‰åƒì WVSè[òd‹} ‹ƒ€8t‹EƒÄôPèyêÿÿë ‹EƒÄôPè{êÿÿƒÄ‰Æƒþÿ„ú‹ƒø„V …Àtéäƒø„÷éÖ‰ð„À|)ƒþǃþ +„¾ƒþ „µƒþ … é§þþuF‹ƒ€8t‹EƒÄôPèëéÿÿë ‹EƒÄôPèíéÿÿƒÄ‰Æþÿ…ØÇé1ÿÿÿt&þÿuH‹ƒ€8t‹EƒÄôPèéÿÿë ‹EƒÄôPèŸéÿÿƒÄ‰Æþþ…ŠÇéãþÿÿ´&‰ð%à=Àuh‹ƒ€8t‹EƒÄôPèGéÿÿë ‹EƒÄôPèIéÿÿƒÄƒøÿ„9‰ÂâÀú€…%ƒæÁæƒà? ƃþ¢ƒÄøVƒ¼Ûÿÿéü‰ð%ð=à…É‹ƒ€8t‹EƒÄôPèÍèÿÿë ‹EƒÄôPèÏèÿÿƒÄƒøÿ„¿‰ÂâÀú€…«ƒæÁæƒà? Æ‹ƒ€8t‹EƒÄôPè}èÿÿë ‹EƒÄôPèèÿÿƒÄƒøÿ„o‰ÂâÀú€…[Áæƒà? ÆþÿƒÄøVƒ¼Ûÿÿé6t&þÿþ…½é‹ýÿÿ‰ð%ø=ð…‹ƒ€8t‹EƒÄôPèòçÿÿët&‹EƒÄôPèðçÿÿƒÄƒøÿ„à‰ÂâÀú€…̃æÁæƒà? Æ‹ƒ€8t‹EƒÄôPèžçÿÿë ‹EƒÄôPè çÿÿƒÄƒøÿ„‰ÂâÀú€…|Áæƒà? Æ‹ƒ€8t‹EƒÄôPèQçÿÿëv‹EƒÄôPèPçÿÿƒÄƒøÿ„@‰ÂâÀú€…,Áæƒà? Æþÿÿ©ƒÄøVƒ¼Ûÿÿ鋃‰÷Áç€8t‹EƒÄôPèàæÿÿë‰ö‹EƒÄôPèàæÿÿƒÄ‰Æ þƒþƒþ +tƒþ t ƒþ …­†(ÿÿ=ÿ‡=‹ƒ€8t‹EƒÄôPè‰æÿÿë ‹EƒÄôPè‹æÿÿƒÄ‰ÇÁ狃€8t‹EƒÄôPè\æÿÿë ‹EƒÄôPè^æÿÿ‰Â龋ƒ€8t‹EƒÄôPè0æÿÿë‰ö‹EƒÄôPè0æÿÿƒÄÁà ƃþ)ƒþ +t$ƒþ tƒþ tƒÄøVƒ|ÛÿÿPè2¸ÿÿÿÿ鉆(ÿÿ=ÿwz‹ƒ€8t‹EƒÄôPèÆåÿÿë ‹EƒÄôPèÈåÿÿƒÄ‰Ç‹ƒ€8t‹EƒÄôPèœåÿÿë ‹EƒÄôPèžåÿÿ‰ÂÁâ ú‚$ÿÿ=þw†æÿÁæ +âÿ ò²‰ðeè[^_‰ì]ÃvU‰åƒìSè[Ã`_‹M‹ƒ‹U €8tƒÄøRQèÖäÿÿƒøÿtëvƒÄøRQè2æÿÿƒøÿu¸ÿÿÿÿë1À‹]è‰ì]ÃU‰åƒìLWVSè[Ã_}À‰}¼ëCvEÿ9E¼s ‹U¼‰ðˆB‰U¼ë+ƒÄøƒéÛÿÿƒ}t‹U‹BPƒüÛÿÿPè¹0ƒÄë6t&‹EƒÄøP‹U R‹Uÿ҉ƃăþÿtƒþ~‹ƒ„‹öpu“ƒþ#tŽ‹E¼Æƒþ;t%ƒÄüƒéÛÿÿƒ}t‹U‹BPEÀPƒ<Üÿÿé€}À#u.€}ÁxuƒÄüjjEÂPè^äÿÿ‰ÆëIƒÄüj +jEÁPèJäÿÿ‰Æë5ƒÄôWè‘ëÿÿ‰ÆƒÄ…ö}&ƒÄüƒéÛÿÿƒ}t‹U‹BPWƒ|ÜÿÿPèå/ƒÄƒþ=ƒþ +t8ƒþ t3ƒþ t.ƒÄüƒéÛÿÿƒ}t‹U‹BPVƒ¼ÜÿÿPè«/¸ÿÿÿÿët&‰ðe¨[^_‰ì]ÃU‰åƒìtƒ}Ð/…òþÿÿ‹Eð9Eü†æþÿÿ‹EüÆ‹Uð‰ÖƒdÞÿÿ‰Ç¹ü¨ó¦…èë EôPEðPEüP‹EÐPèŽìÿÿƒÄ…À…V‹UÔƒÄøR‹M Q‹}ÿ׉EЃÄƒøÿt$ƒø>uÀ‹Eð‹UüƒÀ9Âv³€zý-t­€zþ-u§€zÿ-u¡ƒ}Ð>…ž‹EüÆ‹EðƒÄøP‹EèPè#‰ÆƒÄ…öu*ƒÄøƒéÛÿÿƒ}èt‹Uè‹BPƒœÞÿÿPè5*ƒÄé΃}„‹MƒÄüQjV‹}ÿ׃ÄôVè'%ƒÄ …À…÷1öéê‰ÖƒhÞÿÿ‰Ç¹ ü¨ó¦…ðë EôPEðPEüP‹EÐPèŒëÿÿƒÄ…À…T‹UÔƒÄøR‹M Q‹}ÿ׉EЃÄƒøÿt$ƒø>uÀƒÄüjƒÇÞÿÿP‹EüƒÀþPèQÞÿÿƒÄ…Àu¡ƒ}Ð>…§‹EüÆ‹EðƒÄøP‹EèPè"‰ÆƒÄ…öu%ƒÄøƒéÛÿÿƒ}èt‹Uè‹BPƒüÞÿÿéÂt&ƒ}t!‹MƒÄüQjV‹}ÿ׃ÄôVè.$ƒÄ …Àu1ö…ö„òƒ}ì…è‰uìéàŠuÀ‹Eü;Eðv¸€xÿ?u²ƒ}Ð>…È‹EüÆ‹EðƒÄøP‹EèPè!‰ÆƒÄ…öu!ƒÄøƒéÛÿÿƒ}èt‹Uè‹BPƒ|ßÿÿéÖƒ}„ ‹MƒÄüQjV‹}ÿ׃ÄôVèB#ƒÄ …À…ê1öét&tjƒ}Ð&u$‹MQEøP‹} W‹EèPè×öÿÿ‰EЃÄƒøÿ„oEôPEðPEüP‹UÐRè‡éÿÿƒÄ…À…OƒÄøEøP‹M Q‹}ÿ׉EЃÄƒøÿu•éè‹EüÆ‹EðƒÄøP‹EèPè& ‰ÆƒÄ…öu!ƒÄøƒéÛÿÿƒ}èt‹Uè‹BPƒÜßÿÿéæƒ}t!‹MƒÄüQjV‹}ÿ׃ÄôVèV"ƒÄ …Àu1ö…ö„ƒ}ìu‰uìƒ}è…‰uèƒ}„úé®t&t*ƒ}Ðÿt$t&‹EÔƒÄøP‹U R‹MÿщEЃÄƒø>tƒøÿuà‹uè‹~ ‰}èƒ}t‹EƒÄüPjV‹UÿÒƒÄôVèu!ƒÄ ƒ}„=ƒ}è„3‹MèƒÄôQ‹}ÿ×éäƒÄøR‹EèPèljƃąöu!ƒÄøƒéÛÿÿƒ}èt‹Uè‹BPƒ\àÿÿ釋MЃÄôQè ãÿÿƒÄ…Àt&‹}W‹EÔP‹U RVè‰EЃÄƒøÿ„\ë/vƒ}Ð/u&‹MÔƒÄøQ‹} W‹UÿÒ‰EЃÄƒø>…ûÇEÐ/ƒ}t‹MƒÄüQjV‹}ÿ׃ă}ìu‰uìƒ}Ðÿ„ +ƒ}Ð/t#‰uèƒ}tK…ötGƒÄôV‹UÿÒ‰EàƒÄë6t&ƒ}t+‹MƒÄüQjV‹}ÿ׃ÄôVè> ƒÄ …Àu 9uìuÇEì‹Eð‰Eüéƒt&ƒ}Ð&u:‹EP‹UØR‹M Q‹}èWèÕóÿÿ‰EЃÄƒøÿ„mEôPEðPEüP‹EÐPë3t&ƒ}àtƒ}àt‹UЃÄôRèÈáÿÿƒÄ…Àu EôPEðPEüP‹MÐQèPæÿÿƒÄ…À…ƒÄø}ø‰}ØW‹E P‹UÿÒ‰EЃÄƒøÿ…aõÿÿ‹EðƒÄôPè¯ÙÿÿƒÄƒ}ètj‹uè‹F ë‰ö‹Mè‹I ‰Mè‹A ;Et…Àuë;uèt6‹V ƒÄüƒ àÿÿ…Òt‹BP‹FPƒÜàÿÿPè$‹}ìƒÄôWèÞé …öt ‰ðé–t&‹Eì鉃ÄôƒqÞÿÿë[ƒÄôƒÊÞÿÿëP‰öƒÄôƒ<ßÿÿëCt&ƒÄôƒ¼ßÿÿë3t&‹EðƒÄüP‹EÐPƒœàÿÿPè‰#ƒÄôVèhƒÄ ëƒÄôƒQÞÿÿPèl#ƒÄ‹UìƒÄôRèE‹EðƒÄôPè­Øÿÿ1Àe¸[^_‰ì]ÃU‰åƒìWVSè[Ã:QƒÄôj@è1×ÿÿ‰EøƒÄ…ÀuƒÄôƒáÿÿPè #逴&ÇEü@ƒÄôj@èûÖÿÿ‰EìƒÄ…Àu%‹EøƒÄôPè5ØÿÿƒÄôƒ\áÿÿPèÊ"é>t&ÇEð@é¬t&ƒÄôVèÇßÿÿƒÄ…À…”ƒþ/tƒþ?u2‹EƒÄøP‹U R‹Uÿ҉ǃăÿ>„ŠW‹U‹BPVƒœáÿÿ鸃þ<„Ÿƒþ>„d‹Eø‰òˆ‹Eø@‰Eôƒþ"t ƒþ'…·‰÷ëMƒþ&u#‹UR‹EP‹U R‹EPèñÿÿ‰ÆƒÄƒþÿ„gEüPEøPEôPVè¸ãÿÿƒÄ…À…J9þ„¨‹UƒÄøR‹E P‹Uÿ҉ƃăþÿu™é‰‰öƒþ&u#‹EP‹UR‹E P‹URè–ðÿÿ‰ÆƒÄƒþÿ„ùEüPEøPEôPVèJãÿÿƒÄ…À…Ü‹EƒÄøP‹U R‹Uÿ҉ƃăþÿt(ƒÄôVèxÞÿÿƒÄ…Àuƒþ=tƒþ/tƒþ>t ƒþ?…yÿÿÿ‹EôÆ‹EøƒÄøP‹EPèÙÿÿƒÄ…À…y붋UƒÄøR‹E P‹Uÿ҉ƃăþÿtƒÄôVè ÞÿÿƒÄ…ÀuÖƒþ=…m‹EƒÄøP‹U R‹Uÿ҉ƃăþÿ„ñƒÄôVèÖÝÿÿƒÄ…ÀuÒƒþÿ„؃þ'tƒþ"u|‹Eì‰÷‰EôëG‰öƒþ&u#‹EP‹UR‹E P‹URèfïÿÿ‰ÆƒÄƒþÿ„ÉEðPEìPEôPVèâÿÿƒÄ…À…¬‹EƒÄøP‹U R‹Uÿ҉ƃăþÿ„›9þu™é’t&‹Eì‰òˆ‹Eì@‰EôëEƒþ&u#‹UR‹EP‹U R‹EPèæîÿÿ‰ÆƒÄƒþÿ„IEðPEìPEôPVèšáÿÿƒÄ…À…,‹UƒÄøR‹E P‹Uÿ҉ƃăþÿtƒÄôVèÈÜÿÿƒÄ…Àuƒþ=t +ƒþ/tƒþ>u‚‹EôÆ‹EìƒÄüP‹EøP‹EPèÔ×ÿÿƒÄë#v‹UƒÄü‹BP‹EøPƒüáÿÿ鯴&ƒþ/tƒþ?u9‹EƒÄøP‹U R‹Uÿ҉ǃăÿ>tBW‹U‹BPVƒœáÿÿPè¾ÿÿÿÿƒÄë#ƒþ>t‹EƒÄøP‹U R‹Uÿ҉ƃăþÿ…:üÿÿ‹EøƒÄôPè:Ôÿÿ‹EìƒÄôPè.Ôÿÿ‰ðëL‹UƒÄü‹BP‹EøPƒüáÿÿë‹UƒÄø‹BPƒÒáÿÿP袃ċEøƒÄôPèïÓÿÿ‹EìƒÄôPèãÓÿÿ¸ÿÿÿÿeØ[^_‰ì]ÃU‰åƒì WVSè[ÃnL‹}‹¾2‰ñáÿu ‹E ƒ8…:B‰‹E ‹‰Eüƒø„ …Àtét&ƒ}ü„‰é„É|<ƒùGƒù +„>ƒù „5ƒù „,ƒÄøQƒ|ÛÿÿPèØéÈvùþu€zÿ…³‹E ÇÿéNÿÿÿùÿu€zþ…‘‹E Çÿé,ÿÿÿ‰ð%à=ÀuC¾B%À=€…_‰ñƒáÁáŠB$?¾À ÁƒÂ‰ƒùŽƒÄøQƒ¼Ûÿÿé]ÿÿÿ‰ð%ð=àu}r¾B%À=€… ¾F%À=€…÷‹ƒáÁáŠ$?¾À ÁÁáŠB$?¾À ÁƒÂ‰ùÿƒÄøQƒ¼Ûÿÿéêþÿÿùÿþ„\þÿÿ‰Èé¯t&æøþð…“r¾B%À=€…|¾F%À=€…h¾F%À=€…T‹ƒáÁáŠ$?¾À ÁÁáŠB$?¾À ÁÁáŠB$?¾À ÁƒÂ‰ùÿÿgÿÿÿƒÄøQƒ¼Ûÿÿé6þÿÿt&Áá1ÀŠB ÁƒÂ‰ƒùƒù +tƒù t ƒù …þÿÿ(ÿÿ=ÿ‡ÿÿÿ‹7€>„Â1ÒŠÁâ1ÀŠF ƒÆ‰7‚$ÿÿ=þ‡žáÿÁá +âÿ ÊŠéÑþÿÿ1ÀŠBÁà Áu‰ërƒÂ‰ƒùƒù +tƒù t ƒù …xýÿÿ(ÿÿ=ÿ‡“þÿÿ‹7€~t<1ÒŠVÁâ1ÀŠ ƒÆ‰7‚$ÿÿ=þwáÿÁá +âÿ ÊŠéOþÿÿ¸ÿÿÿÿeè[^_‰ì]ÃU‰å‹U ‹ +;Js‹Eˆÿ1À‰ì]ÉöU‰åƒì WVSè[ÃÖH‹uŠ<"t<'…Á‹E ƒÄøP¾P‹Uÿ҃ąÀ|lŠFˆEÿéyƒÄô¾Pè4Õÿÿ‰ÇƒÄ…ÿtS‹U ƒÄøRj&‹Uÿ҃ąÀ|7€?t‹E ƒÄøP¾P‹Uÿ҃ąÀ|G€?uã‹E ƒÄøPj;‹Uÿ҃ąÀ}¸ÿÿÿÿë_‹E ƒÄøP¾PëàvFŠ„Àt :Eÿ…xÿÿÿ‹E ƒÄøP¾EÿP‹UÿÒ…À}(ë„Àt"t&‹E ƒÄøP¾P‹Uÿ҃ąÀ|¢F€>uã1Àeè[^_‰ì]ÃvU‰åìWVSè[÷G‹}ƒ}„°‹U‹ƒø‡†‰Ú+”ƒ|¸ÿÿÿâ¶lGaBÄA”AÑ@@‹EƒÄøPWj‹UR‹E P‹URè ‰Ç‹E ƒÄ ƒÄøPj<‹Uÿ҃ąÀŒ$‹U‹B€8?t;ƒÄüjƒdÞÿÿP‹BPèÛÍÿÿƒÄ…ÀtƒÄüjƒhÞÿÿP‹U‹BPè¼ÍÿÿƒÄ…Àu.‹E‹p€>tE‹U ƒÄøR¾P‹Uÿ҃ąÀŒ¸F€>ußë"‹EƒÄüP‹U R‹U‹BPèÄýÿÿƒÄ…ÀŒŽ‹U‹B‰Â‰Áƒátzƒùt8*t1B8*t,B8*t'B‹ +„Íu„Ét„ít÷ÁÿtƒÂ÷Áÿu߃êBB)‹E|:‹U‹@‰…üþÿÿ‹R ‰•øþÿÿ…ÀŽ®‹•øþÿÿ‹‰Æ‰Âƒâtzƒút86t1F86t,F86t'F‹„Öu„Òt„öt÷ÂÿtƒÆ÷Âÿu߃îFF)Æ‹…øþÿÿ‹H…ÉtK‰È‰Êƒâtzƒút80t1@80t,@80t'@‹„Öu„Òt„öt÷ÂÿtƒÀ÷Âÿu߃è@@)Èt0‹E‹˜…Ò~$>9Ð~‹U ƒÄøRj +‹Uÿ҃ąÀŒI1ÿë‹E ƒÄøPj ‹Uÿ҃ąÀŒ,G‹EƒÄüP‹U R‹•øþÿÿ‹Pè=üÿÿƒÄ…ÀŒ‹…øþÿÿƒxtp‹U ƒÄøRj=‹Uÿ҃ąÀŒâ‹E ƒÄøPj"‹Uÿ҃ąÀŒÉ‹EƒÄüP‹U R‹•øþÿÿ‹BPèڃąÀŒ¤‹E ƒÄøPj"‹Uÿ҃ąÀŒ‹÷ÿüþÿÿƒ…øþÿÿƒ½üþÿÿRþÿÿ‹Eƒx„m‹U ƒÄøRj>‹Uÿ҃ąÀŒI‹EGƒÄøPWj‹UR‹E P‹URè‰Ç‹EƒÄ ƒÄøP‹URW‹EP‹U R‹U‹BPèOüÿÿ‰ÇƒÄ …ÿŒû‹U‹BŠ‹Uÿ҃ąÀŒV‹UƒÄø‹B‰Â‰Áƒátzƒùt8*t1B8*t,B8*t'B‹ +„Íu„Ét„ít÷ÁÿtƒÂ÷Áÿu߃êBB)‹E|:PWj鉋U‹BŠ‹Uÿ҃ąÀŒÌ‹EGëR‹E ƒÄøPj ‹Uÿ҃ąÀŒ¬‹E ƒÄøPj/‹Uÿ҃ąÀŒ“‹E ƒÄøPj>‹Uÿ҃ąÀŒz‹EƒÇƒÄøPWj‹UR‹E P‹URè/‰ÇƒÄ é]‹EƒxtN‹U‹‚˜…À~'9Ç~#‹E ƒÄøPj +‹Uÿ҃ąÀŒ1ÿë ¶‹E ƒÄøPj ‹Uÿ҃ąÀŒüG‹UƒÄüµÿÿÿ‹BPƒ,âÿÿPVèÉÿÿ‹EƒÄüP‹U RVèøƒÄ …ÀŒÂ‰ð‹•ôþÿÿéÄ‹EƒÄüP‹U R‹U‹BPèɃąÀŒ“‹U‹BéEv‹EƒxtH‹U‹‚˜…À~!9Ç~‹E ƒÄøPj +‹Uÿ҃ąÀŒR1ÿë‹E ƒÄøPj ‹Uÿ҃ąÀŒ5G‹EƒìµÿÿÿÝ@Ý$ƒ/âÿÿPVèLÈÿÿ‹UƒÄüR‹E PVè/ƒÄ …ÀŒù‰ð‹•ðþÿÿ‹„Öu„Òt„öt÷ÂÿtƒÀ÷Âÿu߃è@@)ðÇéÍ‹EƒxtN…ÿ~J‹U‹‚˜…À~#9Ç~‹E ƒÄøPj +‹Uÿ҃ąÀŒ‹1ÿë‰ö‹E ƒÄøPj ‹Uÿ҃ąÀŒlG‹EƒÄüP‹U R‹U‹BPèƒÄ…ÀŒI‹U‹B‰Â‰Áƒátzƒùt8*t1B8*t,B8*t'B‹ +„Íu„Ét„ít÷ÁÿtƒÂ÷Áÿu߃êBB)Â×é‹U‹‚ …À„ä‹UƒÄôRÿЉƃÄ…ö„΋EƒÄüP‹U RVèèƒÄ…ÀŒ²ƒÄøj +VèîÅÿÿƒÄ…ÀuK‰ð‰òƒâtzƒút80t1@80t,@80t'@‹„Öu„Òt„öt÷ÂÿtƒÀ÷Âÿu߃è@@)ðÇëG‰Ç‰Âƒâtzƒút87t1G87t,G87t'G‹„Öu„Òt„öt÷ÂÿtƒÇ÷Âÿu߃ïGG)ǃÄôVèlÆÿÿƒÄë ¸ÿÿÿÿët&‹E‹@‰E…À…P÷ÿÿ‰ø¥Øþÿÿ[^_‰ì]ÃU‰åƒì WVSè[ÃÖ>‹}€?tvƒÄô¾Pè\Ëÿÿ‰ÆƒÄ…ötC‹E ƒÄøPj&‹Uÿ҃ąÀ|Eët&‹E ƒÄøP¾P‹Uÿ҃ąÀ|(F€>uã‹E ƒÄøPj;ë ‹E ƒÄøP¾P‹Uÿ҃ąÀ}¸ÿÿÿÿëG€?u„1Àeè[^_‰ì]ÃU‰åƒì WVSè[Ã.>‹U‹u…Òte‹EƒÄøP‹EPÿ҉ǃÄ…ÿtO€?tJ‹E ƒÄøP¾P‹Uÿ҃ąÀ}¸ÿÿÿÿë.Š< +u +1öë¶< uƒÆ‰ðyF‰ÆƒæøëFG€?u¶‰ðeè[^_‰ì]ÃU‰åƒìVSè[×=‹u…öt0‹…Àt ƒÄôPèÒÄÿÿƒÄƒ~t‹FƒÄôPè½ÄÿÿƒÄƒÄôVè±Äÿÿeè[^‰ì]ÃU‰å‹U…Òt‹J ;J| +1À붋B‹ˆÿB ‰ì]ÃvU‰åƒìWVSè[Ã=‹}…ÿ„Fƒ?u +ƒ}…7ƒ} uƒ}uƒÄôWèÿÿÿé´&‹G…À„ ‹W …Ò…ºÇEüH‰Eøƒø~x‹UüUø‰ÐÁè4‹GÑþ‹°P‹EP‹E PWèåƒÄ…Àu.ëN…öŽ£‹G‹D°üP‹EP‹E PW轃ąÀtÚé…À} ‰uøë +´&‰uü‹Eø+Eüƒøˆ‹uü;uøj‹G‹°P‹EP‹E PWèuƒÄ…Àt>F;uø~ÞëF¶9Â}<‹G‹P‹EP‹E PWèG…Àu#‹W ‹G‹ÿG ët&F‰G ‹G‹°ë +‰ö‹G‰G 1ÀeØ[^_‰ì]ÉöU‰åƒì WVSè[â;ƒ}u1ÀéFƒÄøjjèÊÁÿÿ‰ÆƒÄ…öu)ƒÄüƒÄôèfÂÿÿ‹PèÁÿÿPjƒ<âÿÿPèS 1Àéƒ}t‹EƒÄôPè&Âÿÿ‰ƒÄƒ} uOƒ}uI‹}éƒÄüƒÄôèÂÿÿ‹PèÉÀÿÿP‹FƒÀ@ÁàPƒ|âÿÿPèö ƒÄ ƒÄôVèJýÿÿ1ÀéŸvƒÄøjj‹EP‹E P‹EPPëa‹F9F|9…ÀuƒÄôhè½ÀÿÿëƒÄø…P‹FPèwÁÿÿƒÄ…À„pÿÿÿ‰FƒF@‹V‹F‰<ÿFƒÄøjj‹EP‹E P‹EPWèD‰ÇƒÄ …ÿu‘‹Fƒø~ ƒÄüHPjVè +‰ðeè[^_‰ì]ÉöU‰å‹E…Àt Ç@ ƒxu1Àë‹@‹‰ì]ÃU‰åƒì WVSè[à +:‹}‹uƒÄø‹FP‹U ‹BPèÁÿÿƒÄ…Àu2‹…Àt*ƒÄøƒÄøPVèÀÃÿÿP‹ƒÄøP‹E Pè°ÃÿÿƒÄPèÏÀÿÿ…Àu1Àeè[^_‰ì]ÃvU‰åƒì WVSè[Ö9‹U ‹}‹u…Òt‹FƒÄøPRèÀÿÿƒÄ…Àu#…ÿt‹EƒÄøƒÄø‹PVèHÃÿÿPWèiÀÿÿ…Àu1Àeè[^_‰ì]ÃU‰åƒì WVSè[Ã29´&‹U‹M ‹u‹B‰Ï‹ˆ‰Eü9ñ}pë¶G;}}!‹EüƒÄüP‹U‹B‹¸PRèÏþÿÿƒÄ…À~ÜëN;u ~‹MüƒÄüQ‹U‹B‹°PRè©þÿÿƒÄ…ÀÜ9÷}‹M‹A‹ ¸‹°‰¸‹U‹B‰ °ë™‹M‹AƒÄü‹°P‹EüPQèmþÿÿƒÄ…À~‹U‹B‹M ‹°‰ˆ‹U‹Mü‹B‰ °Fÿ9E }ƒÄüP‹E P‹URè +ÿÿÿƒÄF‰u 9uÿÿÿeè[^_‰ì]ÃU‰åƒì WVSè[Ã8‹}‹u…ÿ„Ù…ö„у~ t ƒÄôVèR‰~ ƒ} t ƒ} tZ鮉öƒ}t ‹E;Gt9x t‹G‰F‹G…Àt‰pë‰w‰wëv‹U‰V‹B‰F‹B…Àt‰pë‰w‹E‰pëYƒ}t ‹U;Wt9z t"‰~ ‹G‰F‹G…Àt +‰pët&‰w‰wë$‹E‹U‰F‹B‰F‹B…Àt‰pë‰w‹E‰peè[^_‰ì]ÉöU‰åƒì WVSè[Ã7‹u…ö„ýƒÄôVè[ë ‹FƒÄôPèÉÿÿÿƒÄƒ~u닃ø‡É‰Ú+”ƒ<Éÿÿÿâ‰ö¬66C66166‹F…Àt ƒÄôPèô½ÿÿƒÄ‹F…À„†1ÿ9Ç}7t&‹F ‹ø…Àt ƒÄôPèɽÿÿƒÄ‹F ‹Dø…Àt ƒÄôPè²½ÿÿƒÄG;~|Í‹F ƒÄôPè½ÿÿë8‹F…Àt4ƒÄôP苽ÿÿë&‹F…Àt"ƒÄôPèy½ÿÿë‹V…Òt‹F…Àt ƒÄôRÿЃÄƒÄôVèW½ÿÿeè[^_‰ì]ÃU‰åƒì WVSè[Ãæ5‹} …ÿu1Àë,ƒÄøj‹EPèB‰ÆƒÄ…ötƒÄøWƒ¼âÿÿPè9 ‰F‰ðeè[^_‰ì]ÉöU‰åƒìSè[Ã5‹EƒÄøjPè÷‰Â…Òt ‹E ‰B‹E‰B‰Ð‹]è‰ì]ÃU‰åƒì WVSè[ÃR5‹} …ÿu1Àë%ƒÄøj‹EP讉ƃąöt ƒÄôWè¼ÿÿ‰F‰ðeè[^_‰ì]ÃU‰åƒìSè[Ã5‹EƒÄøjPèk‰Â…Òt‹E ‰B‰Ð‹]è‰ì]ÉöU‰åƒì WVSè[ÃÊ4‹} …ÿu1Àë)t&ƒÄøj‹EPè"‰ÆƒÄ…öt ƒÄôWè|»ÿÿ‰F‰ðeè[^_‰ì]ÃU‰åƒìSè[Ãx4‹EƒÄøjPèß…ÀtÝE ÝX‹]è‰ì]ÉöU‰åƒì WVSè[ÃB4‹}…ÿu1Àë+ƒÄøj‹EP螉ƃąöt‹E ‰FƒÄôWèòºÿÿ‰F‰ðeè[^_‰ì]ÃvU‰åƒì WVSè[Ãê3‹}…ÿu1Àë3t&ƒÄøj‹EPèB‰ÆƒÄ…öt‹E U‰FƒÄøRWèb‰F‰ðeè[^_‰ì]ÃvU‰åV‹M…ÉtL‹q …ötE‹Q…Òt ‹A‰Bë v‹A‰F‹Q…Òt‹A‰Bë ‹Q ‹A‰BÇA ÇAÇA^‰ì]ÃU‰åìVSè[Ã,3‹E…ÀuƒÉâÿÿPƒÜâÿÿPhµüÿÿVè׸ÿÿƒÄøVjè”ýÿÿ¥èûÿÿ[^‰ì]ÃU‰åƒìSè[ÃÜ2‹U…Òt‹B$Hÿ‰J$‰È…ÀƒÄôRèšûÿÿ1Àë¸ÿÿÿÿ‹]è‰ì]ÉöU‰å‹U…Òu¸ÿÿÿÿë ‹B$H‰J$‰È‰ì]ÃU‰åƒì WVSè[Ãv2‹}ƒÄøj,j訸ÿÿ‰ÆƒÄ…öu1Àë‹E ‰ÇF$…ÿt VjjWèúÿÿ‰ðeè[^_‰ì]ÃU‰åƒì WVSè[Ã2‹u‹}…ö„¢ƒ} „˜ƒ}u…ÿ…Š‹EƒÄüP‹E PV舉ƃÄ…ötpƒ>uYƒ~tSƒ}t‹EƒÄøP‹FPèƸÿÿƒÄ…Àu6vƒ}t)‹EƒÄøPVè»ÿÿƒÄ…Àt…ÿtƒÄøPW蔸ÿÿƒÄ…Àu‰ðëƒ}uƒÄüjë‚‹vëŒ1Àeè[^_‰ì]ÃvU‰å‹E‹M …ÀtD‹P…Òtƒ}u 9Èt3‹P…Òt‰Ðë*v‹@ …Àt9Ètƒxu‹@ 9Èt …Àt ëí‰ö‹@ë1À‰ì]ÃU‰å‹E‹M …Àt49Èt0‹P…Òt"‹B…Àtƒ}tƒxt‹@ƒxu÷ë ‰Ðë ‹@ 9Èu1À‰ì]ÃU‰åƒìVSè[×0‹u…ötƒ>t¸ÿÿÿÿë"‹V…Òt ‹F…ÀtƒÄôRÿЋE ‰F‹E‰F1Àeè[^‰ì]ÉöU‰åƒì WVSè[ÃB0‹u‹} …öt%ƒ>u …ÿtƒÄüjƒãÿÿP‹FPèÛ¶ÿÿƒÄ…Àt¸ÿÿÿÿë)‹F…Àt ƒÄôPèL·ÿÿƒÄƒÄøWƒ ãÿÿPèm‰F1Àeè[^_‰ì]ÉöU‰åƒì WVSè[ÃÂ/‹u‹} …öt ƒ>u…ÿu¸ÿÿÿÿë!‹F…Àt ƒÄôPèé¶ÿÿƒÄƒÄôWèm¶ÿÿ‰F1Àeè[^_‰ì]ÉöU‰å‹U…Òtƒ:t¸ÿÿÿÿë‹E ‰B1À‰ì]ÉöU‰åƒì WVSè[ÃB/‹u‹} …öt ƒ>u…ÿu¸ÿÿÿÿë!‹F…Àt ƒÄôPèi¶ÿÿƒÄƒÄôWèíµÿÿ‰F1Àeè[^_‰ì]ÉöU‰å‹E…Àtƒ8t¸ÿÿÿÿëÝE ÝX1À‰ì]ÉöU‰åƒì WVSè[ÃÂ.‹u‹}…öt ƒ>u…ÿu¸ÿÿÿÿë'‹F…Àt ƒÄôPèéµÿÿƒÄ‹E ‰FƒÄôWègµÿÿ‰F1Àeè[^_‰ì]ÃU‰åƒì WVSè[Ãb.‹u‹}…öt ƒ>u…ÿu¸ÿÿÿÿë+‹F…Àt ƒÄôP艵ÿÿƒÄ‹E U‰FƒÄøRW觉F1Àeè[^_‰ì]ÃU‰åì WVSè[Ãó-‹u舉DžötCE PVhµüÿÿVèà³ÿÿƒÄƒ?t ƒÄôV‹ÿÐë‰öƒÄüVƒãÿÿP‹ƒ”‹Pè´ÿÿ¥èûÿÿ[^_‰ì]ÉöU‰å¸ÿÿÿÿ‰ì]ÃU‰å¸‰ì]ÃU‰å¸‰ì]ÃU‰å¸‰ì]ÃU‰åƒìVSè[ÃO-ƒÄøƒ,ÓÿÿPƒÐP躳ÿÿ‹ƒÌƒÄôPè˲ÿÿ‰ÆƒÄ …öu;ƒÄøh¤jèS³ÿÿ‰ÆƒÄøV‹ƒÌPèA´ÿÿ‹ƒˆÇF‰Fdž˜H‰ðeè[^‰ì]ÃU‰åƒìSè[ÃÈ,ƒÄøƒ\ÓÿÿPƒÌPèS³ÿÿ‹]è‰ì]ÃU‰åƒìSè[Ø,‹EƒÄôPèݳÿÿ‹]è‰ì]ÃU‰åƒìSè[Ãh,‹UE ƒÄøPRè ‹]è‰ì]ÉöU‰åì WVSè[Ã7,‹E P‹EPhµÿÿÿVè/²ÿÿƒÄ=ÿw ƒÄôVèì²ÿÿë(ƒÄøxWjè<²ÿÿ‰ÆƒÄ…öt‹E P‹EPWVèô±ÿÿ‰ð¥èþÿÿ[^_‰ì]ÃU‰åƒìVSè[÷+³8ÿÿÿƒ»8ÿÿÿÿt ‹ÿЃÆüƒ>ÿuô[^‰ì]ÃvU‰åƒìSè[À+[‰ì]ÃU‰åÿuè1´ÿÿèвÿÿèk´ÿÿ‰ì]Ãinitialize_beforeinitialize_afterterminate_beforeterminate_afterUnable to allocate memory for attribute '%s' in element %s!Unable to add entity callback!ampltgtquotzwnjzwjzetayumlyenyacutexiweierpuumlupsilonupsihumlugraveucircuarruacuteuArrtradetimestildethornthinspthetasymthetathere4tauszligsupesup3sup2sup1supsumsubesubspadessimsigmafsigmashysectsdotscaronsbquorsquorsaquorlmrhorfloorregrealrdquorceilrarrraquorangradicrArrpsipropprodprimepoundplusmnpivpiphiperppermilpartparaoumlotimesotildeoslashordmordforoplusomicronomegaolineograveoeligocircoacutenuntildensubnotinnotninendashnbspnablamuminusmiddotmicromdashmacrlsquolsaquolrmlozlowastlfloorleldquolceillarrlaquolanglambdalArrkappaiumlisiniquestiotaintinfinimageigraveiexclicirciacutehibarhellipheartsharrhArrgegammafraslfrac34frac14frac12forallfnofexisteuroeumlethetaequivepsilonenspemspemptyegraveecirceacutedividediediamsdeltadegdarrdaggerdArrcurrencupcrarrcopycongclubscircchicentcedilccedilcapbullbrvbarbrkbarbetabdquoaumlatildeasymparingaposangandalphaalefsymagraveaeligacuteacircaacuteZetaYumlYacuteXiUumlUpsilonUgraveUcircUacuteThetaTauTHORNSigmaScaronRhoPsiPrimePiPhiOumlOtildeOslashOmicronOmegaOgraveOcircOacuteOEligNuNtildeMuLambdaKappaIumlIotaIgraveIcircIacuteGammaEumlEtaEpsilonEgraveEcircEacuteETHDstrokDeltaDaggerChiCcedilBetaAumlAtildeAringAlphaAgraveAcircAacuteAEligUnable to expand string buffer to %d bytes!Bad control character 0x%02x not allowed by XML standard!Invalid UTF-8 sequence for character 0x%04x!nullEntity name too long under parent <%s>!Character entity "%s" not terminated under parent <%s>!Entity name "%s;" not supported under parent <%s>!Bad control character 0x%02x under parent <%s> not allowed by XML standard!MXML_CUSTOMMXML_TEXTMXML_REALMXML_OPAQUEMXML_INTEGERMXML_ELEMENTUnable to allocate string buffer!Bad custom value '%s' in parent <%s>!integerrealBad %s value '%s' in parent <%s>!Unable to add value node of type %s to parent <%s>!Bare < in element!!--![CDATA[Early EOF in comment node!Unable to add comment node to parent <%s>!]]Early EOF in CDATA node!Unable to add CDATA node to parent <%s>!Early EOF in processing instruction node!Unable to add processing instruction node to parent <%s>!Early EOF in declaration node!Unable to add declaration node to parent <%s>!(null)Mismatched close tag <%s> under parent <%s>!Unable to add element node to parent <%s>!Expected > but got '%c' instead for element <%s/>!Missing close tag under parent <%s>!Unable to allocate memory for name!Unable to allocate memory for value!Expected '>' after '%c' for element %s, but got '%c'!Bare < in element %s!Missing value for attribute '%s' in element %s!%d%fUnable to allocate %d bytes for index - %sUnable to allocate %d bytes for index: %s![CDATA[%s]]1.0?xml version="%s" encoding="utf-8"?![CDATA[![CDATA[%s]]mxml: %s +| ˆ € “A…B D‡A†Aƒt. <!fA…B D‡A†Aƒ}. `|!nA…B D‡A†Aƒi. „ì!ŒA…B D‡A†Aƒm. ¨x"õA…B D‡A†Aƒi.| ˆ p#WA…B D†Aƒe.<È#×A…B Aƒ X $NA…B D‡A†Aƒg.$|ð$wA…B D‡ +A† Aƒ P.$¤h%ËA…B D‡ +A† Aƒ H.| ˆ@&%A…B  0h&`A…B G†‹AƒŒD. TÈ&<A…B D†Aƒf. x'9A…B Dƒf. $˜@'‡A…B G‡†A†‡Aƒˆ`.(ÀÈ'‘A…B G‡ŠA†‹AƒŒH. T.$ì\(A…B D‡A†Aƒj. b.$ì(‹A…B D‡ +A† Aƒ v. _.$<x)fA…B G‡ŠA†‹AƒŒH. dà)BA…B D‡A†Aƒj. ˆ$*@A…B D†Aƒj. ¬d*3A…B D‡A†AƒÐ˜*$A…B D†Aƒð¼*(A…B D†Aƒ$ä*%A…B D‡A†AƒP. 8 ,"A…B D‡A†Aƒ^. \01IA…B D†Aƒ[.$€|1xA…B D‡A†AƒD.$¨ô1nA…B D‡A†Aƒ@. Ðd2QA…B D‡A†Aƒa.ô¸7WA…B Dƒb.$8|A…B D‡A†AƒI. <Œ9O A…B D‡A†AƒY. `ÜEÌA…B D‡ +A† Aƒ Q.$„¨J|A…B D‡A†Aƒ’.¬$NA…B  Ä@NA…B D‡A†Aƒk.8è\OäA…B G‡JA†KAƒLf. V.ÿ. {.V. u. $@X¨A…B D‡A†Aƒ^. HèXA…B D‡A†Aƒa.| ˆ €YTA…B D†Aƒ].<ÔY)A…B  TZrA…B D‡ +A† Aƒ v.4xt[rA…B D‡A†Aƒ`.T.H.M.H.©. ^.°è\$A…B  È ]qA…B D‡A†Aƒ`. ì€]cA…B D‡A†Aƒa.$ä]A…B D‡A†AƒK.| ˆ _A…B D‡A†Aƒl. <`'A…B D‡A†Aƒ[. `0aVA…B D‡A†Aƒ`.„ˆa<A…B DƒU. ¤ÄaOA…B D‡A†Aƒ`.Èb6A…B DƒU. èLbSA…B D‡A†Aƒd.  b2A…B DƒU. ,ÔbUA…B D‡A†Aƒ`. P,c]A…B D‡A†Aƒd.tŒc\A…B A† ècTA…B G†‡Aƒˆm.´rÆ7rÁ1rÂ*rÀ$r‘rÅrÃrÄ r’rÇr§ûq! õq”îqÐêqÐãqÉÝqÊÖqÈÎq•Êq—ÅqË¿q“¸qͲqΫq̦q™¡qÏ›qš”q›‘qœŠqчqqRzqÓtqÔmqÒgq©_qŸXqØQqÕLqÖHq¦Eq ?q3 ;q¨7q¡0q`*q£$qÞ q¤q˜qÚ qÛqÙþp¥ùpÜöpžïpÝêpxåp–ÞpáØpâÒp´ÌpæÅpà½p5!·p±Ÿl&³p'"¯p "ªp'¤påžpH"—pã’päŒp ‡p²€p¦yp¦tp" pp)"ipçcp¸^p¢ZpÇUpÆOpc&JpE"Ep©?pµ!;p*"4p¤/pÓ!(p #p“!p°p´pf&p¨p÷péûoêôoèîo"éo äo ÜoµÖoa"Òo·ÎoðÉoëÄo¬ ¾o"¹o’²o"«o½¤o¼o¾—oD ‘o³Žoe"¦l>‰oÔ!„o”!}oe&vo& po¯ioícoî]o¡VoìPo!Jo"Fo+"Ao¹:o¿5o"0oï*oº%oÐ!o»o)#o«o!o#o ÿnd"øn +#ñn"ínÊ%én ân9 Ün £l<×n¯Ñn ËnµÄn·¾n"»n¼µn"°n ªn §n`"¤n " n¬šn "•n„"Žnñ‹n½„nó~nôxnSqnòkn> enÉ]n¿Wn•"Tn("OnªJnºCnøl™² +§mxml-entity.c/boot/home/Desktop/mxml-2.6GNU C 2.95.3-haiku-090629p#3&ΧmxmlEntityAddCallback-§p#Ç#Ucb,ÑPglobal.uQint¾§¾Ä Échar® +u_mxml_global_s¤ error_cb!‡# num_entity_cbs"§# entity_cbs## wrap$§#˜ custom_load_cb%j#œ custom_save_cb&†# × ‡¾{ ™™c®´§´¾ºjmxml_node_s,‰ typeŠŒ# next‹# prevŒ# parent# childŽ# last_child# value +# ref_count‘§#$ user_data’r#(Ÿ€€´Épmxml_type_eUMXML_IGNOREÿÿÿÿMXML_ELEMENTMXML_INTEGERMXML_OPAQUEMXML_REALMXML_TEXTMXML_CUSTOMºrmxml_value_u element€tinteger§opaque‚€realƒ¿text„Écustom…¿mxml_element_s l namem€# num_attrsn§# attrso‚#doublemxml_text_ss whitespacet§# stringu€#<mxml_custom_sy datazr# destroy{H# Hr<‚mxml_attr_sf nameg€# valueh€#NÀmxmlEntityGetNameJ¾È#Ÿ$UvalI§‘!mxmlEntityGetValueh§ $î$Unameg¾‘ii§Wchj§PglobalkuVvmxmlEntityRemoveCallback~ð$g%Ucb}Ñ‘i§Vglobal€uR'_mxml_entity_cbœ§h%3&Uname›¾‘diff§Pcurrentž§WfirstŸ§‘|last §‘x¥ name£¾# val¤§#entities¥9З 44 ê 'u_long Llong unsigned intu_intnunsigned intu_shortshort unsigned intu_char±unsigned charulongLushortuintnunchar±blkcnt_tlong long intblksize_t§fsblkcnt_tfsfilcnt_toff_t ino_t!cnt_t"§dev_t#long intpid_t$id_t%uid_t'ngid_t(nmode_t)numode_t*nnlink_t+§daddr_t-§caddr_t.€addr_t0Lkey_t1ptrdiff_tvsize_tªLssize_t¬wchar_tû§wint_tnclock_t time_t suseconds_tuseconds_tLètimespec tv_sec€# tv_nsec#% itimerspec it_interval³# it_value³#÷ tm,! tm_sec"§# tm_min#§# tm_hour$§# tm_mday%§# tm_mon&§# tm_year'§# tm_wday(§# tm_yday)§# tm_isdst*§# tm_gmtoff+§#$ tm_zone,€#(__gnuc_va_listG€va_list¾÷ fpos_t6Mm +_IO_marker i _next pm +# _sbuf q© # _pos r§#* +© _IO_FILE˜ q _flags v§# _IO_read_ptr {€# _IO_read_end |€# _IO_read_base }€# _IO_write_base ~€# _IO_write_ptr €# _IO_write_end €€# _IO_buf_base €# _IO_buf_end ‚€# _IO_save_base „€#$ _IO_backup_base …€#( _IO_save_end †€#, _markers ˆm +#0 _chain Š© #4 _fileno Œ§#8 _flags2 Ž§#< _old_offset M#@ _cur_column “#H _vtable_offset ”¯ #J _shortbuf •¾ #K _lock —Ê #L _offset ™M#P _codecvt œÚ #X _wide_data ð #\ _mode ¢§#` _unused2 ¤ö #ds +signed char Ê É_IO_codecvtÌ _IO_wide_dataà  É3_IO_lock_t l_IO_FILE ¥s +FILE + s +R  quot §# rem +§#div_t , …   quot # rem #ldiv_t _ ¹   quot # rem #lldiv_t “ %__convert_long_double O__convert_long_double_i P%__convert_long_double_d Q1 1nlong double Ïrandom_data  fptr Ï# rptr Ï# state Ï# rand_type §# rand_deg §# rand_sep §# end_ptr Ï#§.drand48_data " x #.# a $.# c %# old_x &.# init '§# :_compare_function ‰SYn§nnt _ISblank_IScntrl_ISpunct_ISalnum_ISupper_ISlower_ISalpha_ISdigit_ISxdigit_ISspace _ISprint@_ISgraph€Ÿmxml_sax_event_eKMXML_SAX_CDATAMXML_SAX_COMMENTMXML_SAX_DATAMXML_SAX_DIRECTIVEMXML_SAX_ELEMENT_CLOSEMXML_SAX_ELEMENT_OPENmxml_sax_event_tR mxml_type_t]Œmxml_custom_destroy_cb_t_ê<mxml_error_cb_tb‡mxml_attr_tiNmxml_element_tptmxml_text_tvÉmxml_custom_t|mxml_value_t† +mxml_node_t“ºñmxml_index_s– attr—€# num_nodes˜§# alloc_nodes™§# cur_nodeš§# nodes›ñ#´mxml_index_tœmxml_custom_load_cb_tž(Ÿmxml_custom_save_cb_t¡Kpmxml_entity_cb_t¤™mxml_load_cb_t§…•·´mxml_save_cb_tª«±Æ¾´§mxml_sax_cb_t­Ûá ÷´Ÿr_mxml_global_t'×]!mxml-file.c/boot/home/Desktop/mxml-2.6GNU C 2.95.3-haiku-090629@&xYñ‹mxml_isspacep‹@&e&Ucho‹RintBmxml_node_s,‰typeŠB#next‹º#prevŒº#parentº# childŽº#last_childº#valueÀ#ref_count‘‹#$user_data’(#(ºmxml_type_eUMXML_IGNOREÿÿÿÿ MXML_ELEMENT MXML_INTEGER MXML_OPAQUE MXML_REAL MXML_TEXT MXML_CUSTOM +’ (mxml_value_u  element€ integer‹ opaque‚c realƒq text„{ custom…¶ ‚mxmlLoadFd‚h&È&Utopš‚Vfd›‹Pcbœ˜Qbufžž‘ô¿ +’˜B‚ +ˆô_mxml_fdbuf_s XfdY‹#currentZô#end[ô#buffer\ # +úunsigned charúÿcmxml_element_s lnamemc#num_attrsn‹#attrso4# +ichardouble¶mxml_text_sswhitespacet‹#stringuc#îmxml_custom_sydataz(#destroy{ú#ú( +î4mxml_attr_sfnamegc#valuehc# +„mxmlLoadFileÄ‚È&'UtopÁ‚VfpºQcbØRº_IO_FILE˜q_flagsv‹#_IO_read_ptr{c#_IO_read_end|c#_IO_read_base}c# _IO_write_base~c#_IO_write_ptrc#_IO_write_end€c#_IO_buf_basec#_IO_buf_end‚c# _IO_save_base„c#$_IO_backup_base…c#(_IO_save_end†c#,_markersˆ#0_chainŠ #4_filenoŒ‹#8_flags2Ž‹#<_old_offset#@_cur_column“#H_vtable_offset”.#J_shortbuf•=#K_lock—I#L_offset™#P_codecvtœY#X_wide_datao#\_mode¢‹#`_unused2¤u#d +„_IO_marker i_nextp#_sbufq #_posr‹# +À +„off_tshort unsigned intsigned charIi _IO_codecvt +K_IO_wide_data +_i3ÍmxmlLoadStringà‚'='UtopÝ‚QsÞÍ‘ cbߘR +ÓiLmxmlSaveAllocStringþc@'Ç'Unodeü‚‘cbýa‘ bytesÿ‹Pbufferg‘€@scaÍ‚‹ +LtiÿòmxmlSaveFd7‹È'Y(Unode4‚‘fd5‹Vcb6aWcol8‹Pbuf9ž‘ô¿global: P _mxml_global_s¤ error_cb!¢ #num_entity_cbs"‹#entity_cbs#¨ #wrap$‹#˜custom_load_cb%ß #œcustom_save_cb&õ #  +ò¢ Í +– ´ Ä cÄ ‹Í +´ ß ‹‚Í +Ê õ c‚ +å j +mxmlSaveFileg‹\(ì(Unoded‚Wfpeº‘ cbfaVcolh‹Pglobali P mxmlSaveString“‹ì(w)Unode‚‘bufferc‘ bufsize‘‹‘cb’aVcol”‹Pptr• ‘xglobal– P c“ mxmlSAXLoadFdÔ‚x)Þ)UtopÏ‚‘fdЋPcbјWsax_cbÒ= Qsax_dataÓ(RbufÕž‘ô¿© ‚© (= mxml_sax_event_eK MXML_SAX_CDATA MXML_SAX_COMMENT MXML_SAX_DATA MXML_SAX_DIRECTIVE MXML_SAX_ELEMENT_CLOSE MXML_SAX_ELEMENT_OPEN +“ ¸ mxmlSAXLoadFile‚à)"*Utop‚WfpºVcb˜Qsax_cb= Rsax_data(P/ mxmlSAXLoadString+‚$*d*Utop&‚Vs'Í‘ cb(˜Qsax_cb)= Rsax_data*(P‰ mxmlSetCustomHandlersCd*—*UloadAß VsaveBõ WglobalD PÑ mxmlSetErrorCallbackS˜*¼*UcbRÑ VglobalT P +–  mxmlSetWrapMarginf¼*ä*Ucolumne‹Vglobalg Pmxml_add_charx‹ä* ,Ucht‹WbufptruVbufferv‘bufsizew£‘newbufferycR +c +‹Nmxml_fd_getcÆ‹ ,.1UpÄ(‘encodingÅ£WbufÇNchÈ‹VtempÉ‹R1í/=0lchž‹WM­0"1lch΋W +ž¡mxml_fd_putcõ‹01y1Uchó‹Ppô(‘ buföNVämxml_fd_read‹|1ô1UbufNWbytes‹P6mxml_fd_write>‹ô1b2Ubuf=NWbytes?‹Pptr@ôVÜmxml_file_getcj‹d2µ7Uph(‘encodingi£Wchk‹Vtempl‹Pfpmº¿l6À6lch ‹RÛ/7©7lch(‹Rmxml_file_putcA‹¸78Uch?‹Qp@(R¼mxml_get_entityP‹8Œ9UparentK‚‘pL(‘ encodingM£‘getc_cbNÑ‘chQ‹VentityRב@entptrSc‘¼Ñ‹(£ +¼ãi?Rmxml_load_data‚Œ9ÛEUtop‰‚‘pŠ(‘ cb‹˜‘getc_cbŒR‘sax_cb= ‘sax_dataŽ(‘ errorþ·Enode‚Vfirst‘‚‘lparent’‚‘hch“‹‘Pwhitespace”‹‘dbuffer•c‘pbufptr–c‘|bufsize—‹‘ttype˜B‘`encoding™‹‘xglobalš ‘\typesœiØŸ +¼ddÍX_mxml_parse_element‹ÜE¨JUnode ‚‘p (‘ encoding£‘getc_cbR‘ error Jch‹Vquote‹Wnamec‘xvaluec‘lptrc‘tnamesize‹‘|valsize‹‘p÷mxml_string_getc ‹¨J$NUp (Wencoding £‘ ch ‹Qs ÷ÚHMŽMlchà ‹RöÑMNlchó ‹R +ÍMmxml_string_putc +‹$N>NUch +‹Pp +(‘ pp +RÁmxml_write_name- +‹@NYOUs) +ÍVp* +(‘ putc_cb+ +Ö‘quote. +i‘name/ +ÍWÖ‹‹( +Áêmxml_write_nodez +‹\O@XUnodet +‚‘pu +(‘ cbv +a‘colw +‹Wputc_cbx +ê‘globaly + ‘i{ +‹‘ü}width| +‹Vattr} +4‘ø}s~ +ð‘€~º7PcPptr— +ÍVé1WXdata` cVnewlinea ÍP +Áüiþamxml_write_string‹ ‹@XèXUsˆ ÍWp‰ (‘ putc_cbŠ ê‘nameŒ ÍVêmxml_write_wsµ ‹èXxYUnode¯ ‚Pp° (‘ cb± aRws² ‹Pcol³ ‹Vputc_cb´ ê‘s¶ ÍW!u_long ølong unsigned int!u_intunsigned int!u_short!u_charú!ulongø!ushort!uint!uncharú!blkcnt_tŒlong long int!blksize_t‹!fsblkcnt_tŒ!fsfilcnt_tŒ!off_t Œ!ino_t!Œ!cnt_t"‹!dev_t#long int!pid_t$!id_t%!uid_t'!gid_t(!mode_t)!umode_t*!nlink_t+‹!daddr_t-‹!caddr_t.c!addr_t0ø!key_t1!ptrdiff_tv!size_tªø!ssize_t¬!wchar_tû‹"wint_t!clock_t !time_t !suseconds_t!useconds_tømtimespectv_sec#tv_nsec#ªitimerspecit_interval8#it_value8#|tm,!tm_sec"‹#tm_min#‹#tm_hour$‹#tm_mday%‹# tm_mon&‹#tm_year'‹#tm_wday(‹#tm_yday)‹#tm_isdst*‹# tm_gmtoff+‹#$tm_zone,c#(!__gnuc_va_listGc!va_list¾|!fpos_t 6Ò#_IO_lock_tl!_IO_FILE¥„!FILE + „$_single_threaded i% quot ‹#rem +‹#!div_t ó%L quot #rem #!ldiv_t &%€ quot Œ#rem Œ#!lldiv_t Z ì__convert_long_double O __convert_long_double_i Pì __convert_long_double_d Qøølong double –random_datafptr£#rptr£#state£#rand_type‹# rand_deg‹#rand_sep‹#end_ptr£#ïdrand48_data"x#ï#a$ï#c%# old_x&ï#init'‹#û!_compare_function‰ +/‹// +5&'Ì _ISblank _IScntrl _ISpunct _ISalnum(_ISupper(_ISlower(_ISalpha(_ISdigit(_ISxdigit(_ISspace (_ISprint@(_ISgraph€$__ctype_b,ß +å!mxml_sax_event_tR© !mxml_type_t]B!mxml_custom_destroy_cb_t_5 +î!mxml_error_cb_tb¢ !mxml_attr_ti!mxml_element_tp!mxml_text_tv{!mxml_custom_t|¶!mxml_value_t†À!mxml_node_t“’< mxml_index_s–attr—c#num_nodes˜‹#alloc_nodes™‹#cur_nodeš‹# nodes›< # +‚!mxml_index_tœÊ!mxml_custom_load_cb_tžs +Ê !mxml_custom_save_cb_t¡– +å !mxml_entity_cb_t¤Ä !mxml_load_cb_t§Ê +ˆ!mxml_save_cb_tªæ +L!mxml_sax_cb_t­! +“ !_mxml_global_t'ò!_mxml_getc_cb_tTÑ!_mxml_putc_cb_tUÖ!_mxml_fdbuf_t]žQ.mxml-index.c/boot/home/Desktop/mxml-2.6GNU C 2.95.3-haiku-090629€Yô^P(mxmlIndexDelete8€YÔYUind7ÿVÿmxml_index_s–attr—#num_nodes˜#alloc_nodes™#cur_nodeš# nodes›Ê# charintÊmxml_node_s,‰typeŠÖ#next‹N#prevŒN#parentN# childŽN#last_childN#valueT#ref_count‘#$user_data’¼#(ÐNmxml_type_eU MXML_IGNOREÿÿÿÿ +MXML_ELEMENT +MXML_INTEGER +MXML_OPAQUE +MXML_REAL +MXML_TEXT +MXML_CUSTOM ¼mxml_value_u  element€¾ integer opaque‚ realƒ  text„ custom…N  mxml_element_s lnamem#num_attrsn#attrsoÌ#doubleNmxml_text_sswhitespacet#stringu#†mxml_custom_sydataz¼#destroy{’#’¼†Ìmxml_attr_sfnameg#valueh#˜mxmlIndexEnumVÐÔYýYUindUÿR˜mxmlIndexFindvÐZr[UindsÿWelementt˜‘ valueu˜‘diffwPcurrentxVfirsty‘|lastz‘xž +mxmlIndexNew-ÿt[æ\Unode*Бelement+˜‘ attr,˜‘ind.ÿVcurrent/ÐWtemp0ÊPamxmlIndexResetÉÐè\ ]UindÈÿPÆindex_compareî ]}]UindëÿWfirstìБ secondíÐVdiffïP7index_find€]ã]UindÿPelement˜Rvalue˜WnodeÐVdiffPÆindex_sort@ä]ô^Uind=ÿ‘left>‘ right?‘pivotAБ|tempBÐQtemplCWtemprDVu_long Ôlong unsigned intu_intöunsigned intu_shortshort unsigned intu_char9unsigned charulongÔushortuintöunchar9blkcnt_tlong long intblksize_tfsblkcnt_tfsfilcnt_toff_t ino_t!cnt_t"dev_t# long intpid_t$ id_t% uid_t'ögid_t(ömode_t)öumode_t*önlink_t+daddr_t-caddr_t.addr_t0Ôkey_t1 ptrdiff_tv size_tªÔssize_t¬ wchar_tûwint_töclock_t time_t suseconds_t useconds_tÔp timespectv_sec #tv_nsec #­ itimerspecit_interval; #it_value; # +tm,!tm_sec"#tm_min##tm_hour$#tm_mday%# tm_mon&#tm_year'#tm_wday(#tm_yday)#tm_isdst*# tm_gmtoff+#$tm_zone,#(__gnuc_va_listGva_list¾ +fpos_t6Õõ +_IO_marker i_nextpõ +#_sbufq1 #_posr#² +1 _IO_FILE˜q_flagsv#_IO_read_ptr{#_IO_read_end|#_IO_read_base}# _IO_write_base~#_IO_write_ptr#_IO_write_end€#_IO_buf_base#_IO_buf_end‚# _IO_save_base„#$_IO_backup_base…#(_IO_save_end†#,_markersˆõ +#0_chainŠ1 #4_filenoŒ#8_flags2Ž#<_old_offsetÕ#@_cur_column“#H_vtable_offset”7 #J_shortbuf•F #K_lock—R #L_offset™Õ#P_codecvtœb #X_wide_datax #\_mode¢#`_unused2¤~ #dû +signed charR  _IO_codecvtT _IO_wide_datah Š 3_IO_lock_tl_IO_FILE¥û +FILE û +Ú  + quot + #rem + +#div_t + ´   +quot + #rem + #ldiv_t +ç A +quot +#rem +#lldiv_t + ­__convert_long_double O __convert_long_double_i P­ __convert_long_double_d Q¹¹ölong double Wrandom_data fptr W#rptr W#state W#rand_type # rand_deg #rand_sep #end_ptr W#¶drand48_data "x #¶#a $¶#c %# old_x &¶#init '#Â_compare_function ‰Ûáöööü !“  +_ISblank +_IScntrl +_ISpunct +_ISalnum"_ISupper"_ISlower"_ISalpha"_ISdigit"_ISxdigit"_ISspace "_ISprint@"_ISgraph€'mxml_sax_event_eK +MXML_SAX_CDATA +MXML_SAX_COMMENT +MXML_SAX_DATA +MXML_SAX_DIRECTIVE +MXML_SAX_ELEMENT_CLOSE +MXML_SAX_ELEMENT_OPENmxml_sax_event_tR“mxml_type_t]Ömxml_custom_destroy_cb_t_r†mxml_error_cb_tb•¡˜mxml_attr_ti˜mxml_element_tp¾mxml_text_tvmxml_custom_t|Nmxml_value_t†Tmxml_node_t“mxml_index_tœmxml_custom_load_cb_tžJPeИmxml_custom_save_cb_t¡‚ˆ˜Ðmxml_entity_cb_t¤°¶Æ˜mxml_load_cb_t§Üâò?Ðmxml_save_cb_tª#˜Ðmxml_sax_cb_t­8>TÐ'¼ñmxml-node.c/boot/home/Desktop/mxml-2.6GNU C 2.95.3-haiku-090629_ød¯.µmxmlAddD_`Uparent@eWwhereAk‘ childBe‘nodeCeVemxml_node_s,‰typeŠr#next‹ê#prevŒê#parentê# childŽê#last_childê#valueð#ref_count‘k#$user_data’X#(µintêmxml_type_eU MXML_IGNOREÿÿÿÿ +MXML_ELEMENT +MXML_INTEGER +MXML_OPAQUE +MXML_REAL +MXML_TEXT +MXML_CUSTOMµ Xmxml_value_u  element€Z integerk opaque‚¥ realƒ³ text„½ custom…ø ¥mxml_element_s lnamem¥#num_attrsnk#attrsov#«chardoubleømxml_text_sswhitespacetk#stringu¥#0mxml_custom_sydatazX#destroy{<#<X0vmxml_attr_sfnameg¥#valueh¥#B´mxmlDeleteÇ`/aUnodeÆeViÈkW mxmlNewCDATA'e0a†aUparent%ePdata& Wnode(eV«|mxmlNewCustomReˆaÄaUparentOePdataPXPdestroyQ<PnodeSeRÓmxmlNewElementteÄabUparentrePnames WnodeueV-mxmlNewIntegeršebJbUparent˜ePinteger™kPnode›eR…mxmlNewOpaque¹eLbŸbUparent·ePopaque¸ WnodeºeVÙmxmlNewRealße bÒbUparentÝePrealÞ³[nodeàePDmxmlNewTexteÔb)cUparentýePwhitespaceþkPstringÿ WnodeeV¼mxmlNewTextf-e,c‰cUparent)ePwhitespace*kPformat+ Wnode.eVap/¼«ñmxmlRemoveYŒcècUnodeXeQ<mxmlNewXMLžeècµmxml_error) i–iUformat'µVap*Ès+Α€xglobal,yW»À charÀ +ÛÀ ÿ y_mxml_global_s¤ error_cb!‹# num_entity_cbs"‘# entity_cbs#˜# wrap$‘#˜ custom_load_cb%…#œ custom_save_cb&¡# Û‹µ int +¤´c´‘µ¤Ï‘ϵՅmxml_node_s,‰ typeŠ§# next‹# prevŒ# parent# childŽ# last_child# value%# ref_count‘‘#$ user_data’#(º››ÏÀ‹mxml_type_eUMXML_IGNOREÿÿÿÿMXML_ELEMENTMXML_INTEGERMXML_OPAQUEMXML_REALMXML_TEXTMXML_CUSTOMÕmxml_value_u element€integer‘opaque‚›realƒÚtext„äcustom…Úmxml_element_s l namem›# num_attrsn‘# attrso# doublemxml_text_ss whitespacet‘# stringu›#Wmxml_custom_sy dataz# destroy{c#cWmxml_attr_sf nameg›# valueh›#iÙmxml_ignore_cbR§˜i¤iUnodeQÏ‘mxml_integer_cb_§¤i°iUnode^Ï‘Fmxml_opaque_cbl§°i¼iUnodekÏ‘zmxml_real_cby§¼iÈiUnodexÏ‘¯_mxml_globalyÈiPjUglobal‘yV_mxml_initªPj€jU÷_mxml_destructorµ€j¦jUg´Pu_long  long unsigned intu_int' unsigned intu_shortF short unsigned intu_charj unsigned charulongushortFuint'uncharjblkcnt_tÀ long long intblksize_t‘fsblkcnt_tÀfsfilcnt_tÀoff_t Àino_t!Àcnt_t"‘dev_t#: long intpid_t$:id_t%:uid_t''gid_t('mode_t)'umode_t*'nlink_t+‘daddr_t-‘caddr_t.›addr_t0key_t1:ptrdiff_tv:size_tªssize_t¬:wchar_tû‘wint_t'clock_t :time_t :suseconds_t:useconds_t¡timespec tv_sec9# tv_nsec:#Þitimerspec it_intervall# it_valuel#° tm,! tm_sec"‘# tm_min#‘# tm_hour$‘# tm_mday%‘# tm_mon&‘# tm_year'‘# tm_wday(‘# tm_yday)‘# tm_isdst*‘# tm_gmtoff+‘#$ tm_zone,›#(__gnuc_va_listG›va_list¾° fpos_t6& +_IO_marker i _next p& +# _sbuf qb # _pos r‘#ã b _IO_FILE˜ q _flags v‘# _IO_read_ptr {›# _IO_read_end |›# _IO_read_base }›# _IO_write_base ~›# _IO_write_ptr ›# _IO_write_end €›# _IO_buf_base ›# _IO_buf_end ‚›# _IO_save_base „›#$ _IO_backup_base …›#( _IO_save_end †›#, _markers ˆ& +#0 _chain Šb #4 _fileno Œ‘#8 _flags2 Ž‘#< _old_offset #@ _cur_column “F#H _vtable_offset ”h #J _shortbuf •w #K _lock —ƒ #L _offset ™#P _codecvt œ“ #X _wide_data © #\ _mode ¢‘#` _unused2 ¤¯ #d, + signed char +ƒ À_IO_codecvt… _IO_wide_data™ +» À3_IO_lock_t l_IO_FILE ¥, +FILE + , + stderr<õ Ù !!  quot ‘# rem +‘#div_t û !T   quot :# rem :#ldiv_t . !ˆ   quot À# rem À#lldiv_t b ô __convert_long_double O__convert_long_double_i Pô __convert_long_double_d Q +' long double žrandom_data  fptr ž# rptr ž# state ž# rand_type ‘# rand_deg ‘# rand_sep ‘# end_ptr ž#‘ýdrand48_data " x #ý# a $ý# c %F# old_x &ý# init '‘# + F_compare_function ‰"(=‘==C"#Ú_ISblank_IScntrl_ISpunct_ISalnum$_ISupper$_ISlower$_ISalpha$_ISdigit$_ISxdigit$_ISspace $_ISprint@$_ISgraph€nmxml_sax_event_eKMXML_SAX_CDATAMXML_SAX_COMMENTMXML_SAX_DATAMXML_SAX_DIRECTIVEMXML_SAX_ELEMENT_CLOSEMXML_SAX_ELEMENT_OPENmxml_sax_event_tRÚmxml_type_t]§mxml_custom_destroy_cb_t_¹Wmxml_error_cb_tb‹mxml_attr_tiimxml_element_tpmxml_text_tvämxml_custom_t|mxml_value_t†%mxml_node_t“ÕÀmxml_index_s– attr—›# num_nodes˜‘# alloc_nodes™‘# cur_nodeš‘# nodes›À#Ïmxml_index_tœNmxml_custom_load_cb_tž÷ºmxml_custom_save_cb_t¡‹mxml_entity_cb_t¤´mxml_load_cb_t§NTd†Ïmxml_save_cb_tªz€•µÏ‘mxml_sax_cb_t­ª°ÆÏn_mxml_global_t'Ûint8_t h uint8_t jint16_t short intuint16_tFint32_t‘uint32_t'int64_tÀuint64_tc long long unsigned intint_least8_tÜuint_least8_têint_least16_tùuint_least16_tint_least32_t%uint_least32_t 4int_least64_t"Duint_least64_t#Sint_fast8_t&%uint_fast8_t'4int_fast16_t)%uint_fast16_t*4int_fast32_t,%uint_fast32_t-4int_fast64_t/Duint_fast64_t0Sintptr_t3%uintptr_t44intmax_t7Àuintmax_t8cu_int8_t™êu_int16_tšu_int32_t›4u_int64_tœS_pthread_threadpthread_tqN_pthread_attrpthread_attr_tw_pthread_mutex flags4# count %# sem!%# owner"%# owner_count#%#pthread_mutex_t£_pthread_mutexattrpthread_mutexattr_tV&Ð_pthread_cond flags'4# sem(%# mutex)Ð# waiter_count*%# event_counter+%#pthread_cond_t\_pthread_condattrpthread_condattr_tìpthread_key_t‘\_pthread_once state/%#pthread_once_t5³_pthread_rwlock  flags34# owner4%#%³#&×@shared8×local?î!î8 sem7%#!_? lock_sem:%# lock_count;%# reader_count<%# writer_count=%# waiters>_# +kpthread_rwlock_tr_pthread_rwlockattrpthread_rwlockattr_tµƒ;pthread_mutex_typeCPTHREAD_MUTEX_DEFAULTPTHREAD_MUTEX_NORMALPTHREAD_MUTEX_ERRORCHECKPTHREAD_MUTEX_RECURSIVEŽpthread_process_sharedJPTHREAD_PROCESS_PRIVATEPTHREAD_PROCESS_SHAREDê__pthread_cleanup_handler m previousnê# functiono¹# argumentp#Ž_mxml_keyƒ ðŸ_mxml_key_once„\ôŸ J mxml-string.c/boot/home/Desktop/mxml-2.6GNU C 2.95.3-haiku-090629°jWk~B©_mxml_strdupfW©°jÚjUformatU·RapXÂsY©P¯char½ ¯¯ +B_mxml_vstrdupf¦©ÜjWkU format¤·‘ ap¥Â‘ bytes§BP buffer¨©V temp©I‘€~int U¯ÿu_long clong unsigned intu_int…unsigned intu_short¤short unsigned intu_charÈunsigned charulongcushort¤uint…uncharÈblkcnt_tlong long intblksize_tBfsblkcnt_tfsfilcnt_toff_t ino_t!cnt_t"Bdev_t#˜long intpid_t$˜id_t%˜uid_t'…gid_t(…mode_t)…umode_t*…nlink_t+Bdaddr_t-Bcaddr_t.©addr_t0ckey_t1˜ptrdiff_tv˜size_tªcssize_t¬˜wchar_tûBwint_t…clock_t ˜time_t ˜suseconds_t˜useconds_tcÿtimespectv_sec—#tv_nsec˜#<itimerspecit_intervalÊ#it_valueÊ#tm,!tm_sec"B#tm_min#B#tm_hour$B#tm_mday%B# tm_mon&B#tm_year'B#tm_wday(B#tm_yday)B#tm_isdst*B# tm_gmtoff+B#$tm_zone,©#(__gnuc_va_listG©va_list¾fpos_t6d„_IO_marker i_nextp„#_sbufqÀ#_posrB#AÀ_IO_FILE˜q_flagsvB#_IO_read_ptr{©#_IO_read_end|©#_IO_read_base}©# _IO_write_base~©#_IO_write_ptr©#_IO_write_end€©#_IO_buf_base©#_IO_buf_end‚©# _IO_save_base„©#$_IO_backup_base…©#(_IO_save_end†©#,_markersˆ„#0_chainŠÀ#4_filenoŒB#8_flags2ŽB#<_old_offsetd#@_cur_column“¤#H_vtable_offset”Æ#J_shortbuf•Õ#K_lock—á#L_offset™d#P_codecvtœñ#X_wide_data#\_mode¢B#`_unused2¤ #dŠsigned char á¯_IO_codecvtã_IO_wide_data÷ ¯3_IO_lock_tl_IO_FILE¥ŠFILE Ši quot B#rem +B#div_t Cœ quot ˜#rem ˜#ldiv_t vÐ quot #rem #lldiv_t ª< __convert_long_double +O__convert_long_double_i +P< __convert_long_double_d +QH H …long double æ random_data fptr æ #rptr æ #state æ #rand_type B# rand_deg B#rand_sep B#end_ptr æ #BE +drand48_data "x #E +#a $E +#c %¤# old_x &E +#init 'B# Q +¤_compare_function ‰j +p +… +B… +… +‹ +"  _ISblank_IScntrl_ISpunct_ISalnum_ISupper_ISlower_ISalpha_ISdigit_ISxdigit_ISspace _ISprint@_ISgraph€% .? : ; ' @ +: ; I +4: ; I + : ;  : ; I8 + I&I $ > + : ; ( (  : ;  : ; I ' I.? : ; ' I@ +4: ; I.: ;' I@ +: ;I +4: ;I +: ; I: ;II!/ < : ;  : ; ' I &! : ; "(% .? : ; ' I@ +: ; I +4: ; I +$ > ' II I &I + : ; : ; I8 + ' I!/  : ;  : ; ((  : ;  : ; I .? : ; ' @ + : ; !/: ; I: ;I< : ; & : ; (% .: ; ' I@ +: ; I +$ >  : ;  : ; I8 + : ; ( ( + I  : ; : ; I  .? : ; ' I@ +4: ; I +' II : ; I!/' !/ < &I4: ;I +4: ;I.? : ;' I@ +: ;I +.? : ;' @ +.: ;' I@ +  +: ;!: ; I": ;I#: ; $4: ; I? < % : ; &&' : ; ((% .? : ; ' @ +: ; I + : ;  : ; I8 + I$ >  : ; ( +(  : ; : ; I  ' I.? : ; ' I@ +4: ; I +&I.? : ;' I@ +: ;I +4: ;I +.: ;' I@ +.: ;' @ +: ; I: ;II!/ < : ;  : ; ' I &! : ; "(% .? : ; ' @ +: ; I + : ;  : ; I8 + I$ >  : ; ( +(  : ; : ; I  ' I4: ; I +.? : ;' I@ +: ;I +4: ;I +&I4: ;I.? : ;' @ +I!/.: ;' I@ +: ; I: ;I!/ < : ;  : ; !' I"&# : ; $(%  : ;  : ; I8 + : ; ((  I : ; : ; I +$ >  .? : ; ' I@ + : ; I +4: ; I +&I' I: ; I: ;II!/ < : ;  : ; ' I& : ; (% .? : ; ' I@ +: ; I +$ >  : ;  : ; I8 + I ' +I  : ; ( (  : ;  : ; I&I.? : ;' I@ +: ;I +4: ;I: ; I: ;II!/ < : ;  : ; ' I& : ; (% .? : ; ' @ +: ; I +4: ; I4: ; I + I&I $ > +I !/  : ; : ; I8 +' I!/ ' I : ;  : ; ((  : ;  : ; I .? : ; ' I@ +.: ; ' @ +.: ; ' @ +: ; I: ;I< : ; 4: ; I? < ! : ; "&# : ; $(% I8 +& : ; % .? : ; ' I@ +: ; I +4: ; I4: ; I + I$ > &I +.? : ;' I@ + : ;I + 4: ;I + I!/ : ; I: ;I : ;  : ; I8 + < : ;  : ;  : ;  : ; I' II& : ; ( (­öõ +mxml-attr.cmxml.h/boot/develop/headers/posix/sys/types.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stddef.h/boot/develop/headers/posix/time.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stdarg.h/boot/develop/headers/posix/stdio.h/boot/develop/headers/posix/libio.h/boot/develop/headers/posix/stdio_pre.h/boot/develop/headers/posix/div_t.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/float.h/boot/develop/headers/posix/stdlib.h/boot/develop/headers/posix/ctype.h€ U© ¯ ³ É Ô à á è ù ÿ !l! !,!!,!";!@!'E!sK!P!f!j!n!,z!|!$—!!¦!ª!À!Â!×!à!ì!'"#"")"0"P"e"n"x"(–" "¶"½"Æ"Ì"Ó"t×"Û"(å"ñ" ####"#4#7#:#=#@#D# ^#m#m#û “öõ +mxml-entity.cmxml-private.hmxml.h/boot/develop/headers/posix/sys/types.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stddef.h/boot/develop/headers/posix/time.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stdarg.h/boot/develop/headers/posix/stdio.h/boot/develop/headers/posix/libio.h/boot/develop/headers/posix/stdio_pre.h/boot/develop/headers/posix/div_t.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/float.h/boot/develop/headers/posix/stdlib.h/boot/develop/headers/posix/ctype.hp#A‹#“#¢#°# ¹#¼#Ç#È# t$€$ˆ$$˜$ $%¼$Ã$Ù$ß$î$ð$  %#%.%4%8%N%P%s]%#h%œ„%% %Å%Ç%Ð%Ó%Þ%þ%&"&o"&#3&3&û >½öõ +mxml-file.cmxml.h/boot/develop/headers/posix/libio.hmxml-private.h/boot/develop/headers/posix/sys/types.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stddef.h/boot/develop/headers/posix/time.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stdarg.h/boot/develop/headers/posix/stdio.h/boot/develop/headers/posix/stdio_pre.h/boot/develop/headers/posix/stdio_post.h/boot/develop/headers/posix/div_t.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/float.h/boot/develop/headers/posix/stdlib.h/boot/develop/headers/posix/ctype.h@&„E&H&h&@ˆ&Ž& &¦&È&È&*å&'+'@'7q'x'''¥'´'¸' Ç'È'%æ'ë'ñ'( (((*(<(C(Y(\(%w(|(›((Ò(à(ì(ì(*) )))7)@)D)O)W)d)g)w)x)3œ)¢)´)º)Þ)à)4*$*5D*d*'*„*Š*—*˜*¯*´*¼*¼*!Ó*Ø*ä*ä* ÿ*++#+.+K+Y+n+x+‡+Œ+‘+—+ +¨+±+³+»+Ä+Æ+Ó+â+ñ+ý+ , ,$,$,/,C,O,s,y,,¢,ª,µ,É,Õ,á,ç,ð,ø,--#-/-5-@-N-Y-m-}--š-£-­-²-Ä-Ï-ã-ó-.../.?.Q.Y.a.k.p.|..“.ž.².Â.Ô.ß.ê.þ./ /(/3/G/W/i/q/}/‡// ›/¯/²/µ/¿/Á/Ä/Ü/í/í/ø/ 0000 0-00030=0=0B0M0]0j0o0r0†0–0 0­0­0¸0È0Ñ0Ô0×0Ü0é0ö0û0þ0 1"1"1.101G1O1\1c1n1y1|1”1˜1 1Õ1×1Ú1á1å1tå1ô1ô1 222%2%202I2P2V2b2d2|2|2¦2¯2Ó2Ù2ý23 +343@3F3P3X3‚3Ž3”3 3®3ó3þ3444(4m4x4½4Å4Í4×4à4ì4ñ45L5W5œ5¤5ì5ô56 +66 C6[6l6À6À6Å6ô677"7/7…7’7©7©7µ7¸7Î7Ô7×78(+80888E8g8l8Š8 ¢8¢8¨8­8Í8Ò8Ø8Þ8ò8999>9R9u9€9Œ9Œ9.©9%½9Ì9Ñ9Ñ9Ô9×9Þ9á9è9ï9ö9:::":_:b:”:³:µ:Å:Ç:ë:ó: ;;;.;E;k;t;v;y;€;‚;Š;º;À;Ã;Æ;É;í;÷;<#<)<8<H<J<T<W<`<y<€<–<¯<¸<Ç<×<Ù<ã<æ<í<÷<ý<= ==6=V=X=x=Ò=ð=l>>)">?>A>a>|> > >ª>#°>É>ë>ó>ý> ? ?"?'?A?C?c?~?¢?¢?¬?#²?Ë?ç?ð?ö?@@@)@,@1@;@@@`@{@Ž@Ž@˜@"ž@·@Ó@Ø@â@ñ@AA$AAA$AHAhAƒAˆA"ŽA§AÃAÈAÎAÝAíAïA÷AýAB +B BB B(BHBhBpB€B B£B©B¯B¾BÇBÊBÞBêBðBC"C'C:C[C`CfC…CŒC’C¤CªC­C·C½CÀCÊCÙCàCæCõC +DDD D&DJDZD`DDŸDÁDÍDÖDÙDàDõDúDE*E0E4E@EHEö|QESEL\E`ELiEpE^yE€E—E E¥E¥}´E·E¾ÃEÏEÛEÜE/FF F'F;FGFVF`FgFpF„FŽF F¬F»FÀFÉFÒFÙFàFîFðFòF÷FG7G?GYG^G`GeGˆG¥G¿GuçGçG íGHH:HCHqHzH„H‡H‰HŒHH•H¸HÕHóH +÷H÷H IIIII8IUIoI +ŽIŽI”I¨I°IÄIÐIÚIìIôI JJJJJ6JBJNJRJfJhJµ~JJÇJ™J¨J¨JÀJÀJÛJàJKK8KHKPKXKbKkKmKrKzK„KKK”K¢K¶KÈKÍKÖKàKåKóKLN@N XNfN}NƒNˆNN²N·NÎNÏNÔNéNðNOOO%Oi%O%O%O)'O0OGOHOMOYO\O"wOO¸OÕOñO7P7PBP]PcPeP‡PÔP×PÛPðPøPGQTQŸQ³QÌQÎQÐQéQêQRR3RLRqRŠRŒR[™R¦R=³RÌRÌRÏRÐRêRS2SOSkS„S¦S¿SÂSÅSTTTT T0TITITLTMTPTiT‚T›T›TžT¡T»T¾TÃTÌTÝTöTøTUUU7USU[U`U‚UˆUU™UªUÃUÅUÇUàUáUVVNVSV`VqVŠVŒVV©VªVÌVW W1W1WGWcWuWÀWXXXX X)X1X@X@X XX`XuXŠXX§X¨X­X¶X¸XÏXÖX×XÜXèXèX"YY"Y9Y@YFYPYTYWYcYeYfYgYlYxYxYû >€öõ +mxml-index.cmxml.h/boot/develop/headers/posix/sys/types.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stddef.h/boot/develop/headers/posix/time.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stdarg.h/boot/develop/headers/posix/stdio.h/boot/develop/headers/posix/libio.h/boot/develop/headers/posix/stdio_pre.h/boot/develop/headers/posix/div_t.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/float.h/boot/develop/headers/posix/stdlib.h/boot/develop/headers/posix/ctype.h€YK—Y›Y¡Y­Y³YÂYËYÔYÚYÞYæYðYZ'Z$/Z#;ZPZ[Z"fZmZqZvZ„Z‡Z‰Z¢Z¤Z¥ZÊZ!ÐZÔZàZãZîZöZ[[. [=[P[dV[`[5f[r[t[4[–[«[Í[Ô[Ú[ë[÷[\'*\6\@\jT\V\^\b\q\ˆ\\"“\—\£\¾\Å\9Í\Ú\9æ\è\!î\ò\ù\ÿ\] ]"']A]G]q]}]€] ž]¢]¶]º]×]ã]ä],^^ ^ ^^^^ ^!^D^F^G^j^n^w^}^†^fˆ^7¦^µ^Á^É^Ý^ô^ô^û _öõ +mxml-node.cmxml.h/boot/develop/headers/posix/sys/types.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stddef.h/boot/develop/headers/posix/time.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stdarg.h/boot/develop/headers/posix/stdio.h/boot/develop/headers/posix/libio.h/boot/develop/headers/posix/stdio_pre.h/boot/develop/headers/posix/div_t.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/float.h/boot/develop/headers/posix/stdlib.h/boot/develop/headers/posix/ctype.h_W_+_&1_:_=_P_c_i_p_u_x_{_€_†_Œ_“_˜_›_¡_£_¶_¹_¿_Æ_Ð_Ó_Ö_Ø_Û_Þ_á_ç_î_ó_ö_ü_#`  ` (`1`3`H`x``‹`–` `ª`¶`Á`Í`Ó`ß`á`è`ñ`ó`ú`aaaa%a0a%Ha!LaPagaza†aˆa'ža!¯aµa»aÄaÄa"Üa!àaäaûabbb"*b ;bAbJbLb#db!hbpb‡b“bŸb b"¶b ÅbËbÒbÔb%ìb!ðbôb ccc)c,c&Dc"HcPcgcjcmcpc}c‰cŒc “cžc(¥c°c¶c½cÅcÎcÕcÜcãc"èc"d%dœœðI MO°k°kUàkàkd ]DŠDz g\–\†nd–d†ul–l†¸~$—$‡œƒÀ—À‡8‰øŸøŽø€—x‘ ¦˜’¶§—S¸ÂúO»Ðµ^‰E>¤ÜT©p _ ĵ ”è |Œ|œ°k àk +DŠ \– d– l–$—À—øŸñÿLÀ—Pd– ^Ä—j€DŠ “øžøŸ¨´L¿È—Í\– Û`kñ`– ´˜k¿øŸþh– X– ñÿdñÿtñÿ€x"õŽDŠ žñÿ¬ЗŽ ‹ ¸ñÿÄ@&%Ñ ,"ÞŒ9O íd2Qü¨J| 01I\Oä*ô1n8¸7WG$NXä*%f|1xs8|ƒØŸŒÜEÌŸ@N¯èX½@X¨ŽÔ‹ ÏñÿÜ€]cçä]ò ]qŽ< ñÿ  dXŽp‘ ñÿŽ|“ #ñÿŽä“ .ñÿ=ðŸGôŸVPj0a€j&Ž• rñÿŽ– €l–ñÿ‰$—ñÿŸG°Œc\»€d Æ_ÎUÜà)Bìì(‹ûk§°g"'/28b6G<U,c]bl°i {ÄaOŠ0 C–h›Üj{ªè\$¹²À¡Êx)fØdCåh%Ëõ $N|Ž˜i $\(1*9Î@È#×R,YJ_ì!Œs.{ˆº" ÔeW­d*3ÃÖLbSäÈ&<ñ°j*ÿJ; ˜*$!^)Ì—@h&`K,fGX€fRf`møŸñÿE ñÿJ€YTZ|!nm´hdz¨C†ð$wŸÈ'‘ª“"ÀÈ—Û0aVècüÙ/home/michaelvoliveira/develop/haiku/trunk/src/system/glue/arch/x86/crti.Sp.3__DTOR_LIST__completed.4__do_global_dtors_aux__EH_FRAME_BEGIN__fini_dummyobject.11frame_dummyinit_dummyforce_to_data__CTOR_LIST____do_global_ctors_aux__CTOR_END____DTOR_END____FRAME_END__/home/michaelvoliveira/develop/haiku/trunk/src/system/glue/arch/x86/crtn.Sinit_term_dyn.cmxml-attr.cmxml_set_attr__FRAME_BEGIN__mxml-entity.centities.15mxml-file.cmxml_isspacemxml_fd_getcmxml_load_datamxml_file_getcmxml_string_getcmxml_fd_putcmxml_write_nodemxml_fd_writemxml_file_putcmxml_string_putcmxml_add_charmxml_fd_readmxml_get_entitytypes.69mxml_parse_elementmxml_write_namemxml_write_wsmxml_write_stringmxml-index.cindex_findindex_sortindex_comparemxml-node.cmxml_newmxml-search.cmxml-set.cmxml-private.c_mxml_key_mxml_key_once_mxml_init_mxml_destructormxml-string.c_DYNAMIC_GLOBAL_OFFSET_TABLE_get_image_symbolmxmlRemovemxmlRetainmxmlAddputc_unlockedmxmlSAXLoadFilemxmlSaveStringpthread_getspecificstrerrormxmlSetIntegermemmovesnprintfmxmlNewIntegergetc_unlockedmxmlNewTextf__ctype_bmxml_opaque_cbmxmlNewElement_term_aftergetc_mxml_vstrdupfmxmlIndexResetmallocvsnprintfmxmlSAXLoadFd_init_before_mxml_entity_cbmxmlEntityGetValue_initstrtolmxml_ignore_cbmxmlSaveFilestrrchrcallocmxmlEntityGetNamestrtodwritemxmlElementSetAttrffprintfpthread_once__deregister_frame_infomxmlWalkNextmxmlSetCustomHandlerspthread_key_createmxmlNewOpaquemxmlLoadFile_mxml_strdupfreadstrncmpmxmlSetErrorCallbackrealloc_gSharedObjectHaikuABImxmlLoadFdmxmlWalkPrevmxmlSetCustomstrdupmxmlReleasemxmlDeletemxmlElementDeleteAttr__bss_startmxmlEntityAddCallback_mxml_globalmxmlSetCDATAmxmlSetOpaquemxml_real_cb_term_beforemxmlElementGetAttrmxmlNewRealmxmlFindElement_errnopmxmlSetElementmxmlNewCustomputcmxmlSaveAllocStringmxmlSAXLoadStringstrcmpmxml_errormxmlLoadString_finimxmlSetRealmxmlIndexEnumsprintfmxmlSetWrapMarginmxmlIndexNew_single_threadedstderrmxmlSetTextmxmlIndexFindmxmlNewXMLmxml_integer_cbmxmlNewText_edata_endmxmlIndexDeletemxmlElementSetAttrmxmlSetTextf_init_aftermxmlEntityRemoveCallbackmxmlSaveFd__register_frame_info_gSharedObjectHaikuVersionmxmlNewCDATApthread_setspecificfree \ No newline at end of file diff -Naur mxml-2.6/mxml-attr.c mxml-2.6-haiku/mxml-attr.c --- mxml-2.6/mxml-attr.c 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/mxml-attr.c 2007-09-15 20:04:56.000000000 +0000 @@ -0,0 +1,321 @@ +/* + * "$Id: mxml-attr.c 308 2007-09-15 20:04:56Z mike $" + * + * Attribute support code for Mini-XML, a small XML-like file parsing library. + * + * Copyright 2003-2007 by Michael Sweet. + * + * This program is free software; you can redistribute it and/or + * modify it under the terms of the GNU Library General Public + * License as published by the Free Software Foundation; either + * version 2, or (at your option) any later version. + * + * This program is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU General Public License for more details. + * + * Contents: + * + * mxmlElementDeleteAttr() - Delete an attribute. + * mxmlElementGetAttr() - Get an attribute. + * mxmlElementSetAttr() - Set an attribute. + * mxmlElementSetAttrf() - Set an attribute with a formatted value. + * mxml_set_attr() - Set or add an attribute name/value pair. + */ + +/* + * Include necessary headers... + */ + +#include "config.h" +#include "mxml.h" + + +/* + * Local functions... + */ + +static int mxml_set_attr(mxml_node_t *node, const char *name, + char *value); + + +/* + * 'mxmlElementDeleteAttr()' - Delete an attribute. + * + * @since Mini-XML 2.4@ + */ + +void +mxmlElementDeleteAttr(mxml_node_t *node,/* I - Element */ + const char *name)/* I - Attribute name */ +{ + int i; /* Looping var */ + mxml_attr_t *attr; /* Cirrent attribute */ + + +#ifdef DEBUG + fprintf(stderr, "mxmlElementDeleteAttr(node=%p, name=\"%s\")\n", + node, name ? name : "(null)"); +#endif /* DEBUG */ + + /* + * Range check input... + */ + + if (!node || node->type != MXML_ELEMENT || !name) + return; + + /* + * Look for the attribute... + */ + + for (i = node->value.element.num_attrs, attr = node->value.element.attrs; + i > 0; + i --, attr ++) + { +#ifdef DEBUG + printf(" %s=\"%s\"\n", attr->name, attr->value); +#endif /* DEBUG */ + + if (!strcmp(attr->name, name)) + { + /* + * Delete this attribute... + */ + + free(attr->name); + free(attr->value); + + i --; + if (i > 0) + memmove(attr, attr + 1, i * sizeof(mxml_attr_t)); + + node->value.element.num_attrs --; + return; + } + } +} + + +/* + * 'mxmlElementGetAttr()' - Get an attribute. + * + * This function returns NULL if the node is not an element or the + * named attribute does not exist. + */ + +const char * /* O - Attribute value or NULL */ +mxmlElementGetAttr(mxml_node_t *node, /* I - Element node */ + const char *name) /* I - Name of attribute */ +{ + int i; /* Looping var */ + mxml_attr_t *attr; /* Cirrent attribute */ + + +#ifdef DEBUG + fprintf(stderr, "mxmlElementGetAttr(node=%p, name=\"%s\")\n", + node, name ? name : "(null)"); +#endif /* DEBUG */ + + /* + * Range check input... + */ + + if (!node || node->type != MXML_ELEMENT || !name) + return (NULL); + + /* + * Look for the attribute... + */ + + for (i = node->value.element.num_attrs, attr = node->value.element.attrs; + i > 0; + i --, attr ++) + { +#ifdef DEBUG + printf(" %s=\"%s\"\n", attr->name, attr->value); +#endif /* DEBUG */ + + if (!strcmp(attr->name, name)) + { +#ifdef DEBUG + printf(" Returning \"%s\"!\n", attr->value); +#endif /* DEBUG */ + return (attr->value); + } + } + + /* + * Didn't find attribute, so return NULL... + */ + +#ifdef DEBUG + puts(" Returning NULL!\n"); +#endif /* DEBUG */ + + return (NULL); +} + + +/* + * 'mxmlElementSetAttr()' - Set an attribute. + * + * If the named attribute already exists, the value of the attribute + * is replaced by the new string value. The string value is copied + * into the element node. This function does nothing if the node is + * not an element. + */ + +void +mxmlElementSetAttr(mxml_node_t *node, /* I - Element node */ + const char *name, /* I - Name of attribute */ + const char *value) /* I - Attribute value */ +{ + char *valuec; /* Copy of value */ + + +#ifdef DEBUG + fprintf(stderr, "mxmlElementSetAttr(node=%p, name=\"%s\", value=\"%s\")\n", + node, name ? name : "(null)", value ? value : "(null)"); +#endif /* DEBUG */ + + /* + * Range check input... + */ + + if (!node || node->type != MXML_ELEMENT || !name) + return; + + if (value) + valuec = strdup(value); + else + valuec = NULL; + + if (mxml_set_attr(node, name, valuec)) + free(valuec); +} + + +/* + * 'mxmlElementSetAttrf()' - Set an attribute with a formatted value. + * + * If the named attribute already exists, the value of the attribute + * is replaced by the new formatted string. The formatted string value is + * copied into the element node. This function does nothing if the node + * is not an element. + * + * @since Mini-XML 2.3@ + */ + +void +mxmlElementSetAttrf(mxml_node_t *node, /* I - Element node */ + const char *name, /* I - Name of attribute */ + const char *format,/* I - Printf-style attribute value */ + ...) /* I - Additional arguments as needed */ +{ + va_list ap; /* Argument pointer */ + char *value; /* Value */ + + +#ifdef DEBUG + fprintf(stderr, + "mxmlElementSetAttrf(node=%p, name=\"%s\", format=\"%s\", ...)\n", + node, name ? name : "(null)", format ? format : "(null)"); +#endif /* DEBUG */ + + /* + * Range check input... + */ + + if (!node || node->type != MXML_ELEMENT || !name || !format) + return; + + /* + * Format the value... + */ + + va_start(ap, format); + value = _mxml_vstrdupf(format, ap); + va_end(ap); + + if (!value) + mxml_error("Unable to allocate memory for attribute '%s' in element %s!", + name, node->value.element.name); + else if (mxml_set_attr(node, name, value)) + free(value); +} + + +/* + * 'mxml_set_attr()' - Set or add an attribute name/value pair. + */ + +static int /* O - 0 on success, -1 on failure */ +mxml_set_attr(mxml_node_t *node, /* I - Element node */ + const char *name, /* I - Attribute name */ + char *value) /* I - Attribute value */ +{ + int i; /* Looping var */ + mxml_attr_t *attr; /* New attribute */ + + + /* + * Look for the attribute... + */ + + for (i = node->value.element.num_attrs, attr = node->value.element.attrs; + i > 0; + i --, attr ++) + if (!strcmp(attr->name, name)) + { + /* + * Free the old value as needed... + */ + + if (attr->value) + free(attr->value); + + attr->value = value; + + return (0); + } + + /* + * Add a new attribute... + */ + + if (node->value.element.num_attrs == 0) + attr = malloc(sizeof(mxml_attr_t)); + else + attr = realloc(node->value.element.attrs, + (node->value.element.num_attrs + 1) * sizeof(mxml_attr_t)); + + if (!attr) + { + mxml_error("Unable to allocate memory for attribute '%s' in element %s!", + name, node->value.element.name); + return (-1); + } + + node->value.element.attrs = attr; + attr += node->value.element.num_attrs; + + if ((attr->name = strdup(name)) == NULL) + { + mxml_error("Unable to allocate memory for attribute '%s' in element %s!", + name, node->value.element.name); + return (-1); + } + + attr->value = value; + + node->value.element.num_attrs ++; + + return (0); +} + + +/* + * End of "$Id: mxml-attr.c 308 2007-09-15 20:04:56Z mike $". + */ diff -Naur mxml-2.6/mxml-entity.c mxml-2.6-haiku/mxml-entity.c --- mxml-2.6/mxml-entity.c 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/mxml-entity.c 2009-03-19 05:38:52.000000000 +0000 @@ -0,0 +1,462 @@ +/* + * "$Id: mxml-entity.c 385 2009-03-19 05:38:52Z mike $" + * + * Character entity support code for Mini-XML, a small XML-like + * file parsing library. + * + * Copyright 2003-2009 by Michael Sweet. + * + * This program is free software; you can redistribute it and/or + * modify it under the terms of the GNU Library General Public + * License as published by the Free Software Foundation; either + * version 2, or (at your option) any later version. + * + * This program is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU General Public License for more details. + * + * Contents: + * + * mxmlEntityAddCallback() - Add a callback to convert entities to + * Unicode. + * mxmlEntityGetName() - Get the name that corresponds to the + * character value. + * mxmlEntityGetValue() - Get the character corresponding to a named + * entity. + * mxmlEntityRemoveCallback() - Remove a callback. + * _mxml_entity_cb() - Lookup standard (X)HTML entities. + */ + +/* + * Include necessary headers... + */ + +#include "mxml-private.h" + + +/* + * 'mxmlEntityAddCallback()' - Add a callback to convert entities to Unicode. + */ + +int /* O - 0 on success, -1 on failure */ +mxmlEntityAddCallback( + mxml_entity_cb_t cb) /* I - Callback function to add */ +{ + _mxml_global_t *global = _mxml_global(); + /* Global data */ + + + if (global->num_entity_cbs < (int)(sizeof(global->entity_cbs) / sizeof(global->entity_cbs[0]))) + { + global->entity_cbs[global->num_entity_cbs] = cb; + global->num_entity_cbs ++; + + return (0); + } + else + { + mxml_error("Unable to add entity callback!"); + + return (-1); + } +} + + +/* + * 'mxmlEntityGetName()' - Get the name that corresponds to the character value. + * + * If val does not need to be represented by a named entity, NULL is returned. + */ + +const char * /* O - Entity name or NULL */ +mxmlEntityGetName(int val) /* I - Character value */ +{ + switch (val) + { + case '&' : + return ("amp"); + + case '<' : + return ("lt"); + + case '>' : + return ("gt"); + + case '\"' : + return ("quot"); + + default : + return (NULL); + } +} + + +/* + * 'mxmlEntityGetValue()' - Get the character corresponding to a named entity. + * + * The entity name can also be a numeric constant. -1 is returned if the + * name is not known. + */ + +int /* O - Character value or -1 on error */ +mxmlEntityGetValue(const char *name) /* I - Entity name */ +{ + int i; /* Looping var */ + int ch; /* Character value */ + _mxml_global_t *global = _mxml_global(); + /* Global data */ + + + for (i = 0; i < global->num_entity_cbs; i ++) + if ((ch = (global->entity_cbs[i])(name)) >= 0) + return (ch); + + return (-1); +} + + +/* + * 'mxmlEntityRemoveCallback()' - Remove a callback. + */ + +void +mxmlEntityRemoveCallback( + mxml_entity_cb_t cb) /* I - Callback function to remove */ +{ + int i; /* Looping var */ + _mxml_global_t *global = _mxml_global(); + /* Global data */ + + + for (i = 0; i < global->num_entity_cbs; i ++) + if (cb == global->entity_cbs[i]) + { + /* + * Remove the callback... + */ + + global->num_entity_cbs --; + + if (i < global->num_entity_cbs) + memmove(global->entity_cbs + i, global->entity_cbs + i + 1, + (global->num_entity_cbs - i) * sizeof(global->entity_cbs[0])); + + return; + } +} + + +/* + * '_mxml_entity_cb()' - Lookup standard (X)HTML entities. + */ + +int /* O - Unicode value or -1 */ +_mxml_entity_cb(const char *name) /* I - Entity name */ +{ + int diff, /* Difference between names */ + current, /* Current entity in search */ + first, /* First entity in search */ + last; /* Last entity in search */ + static const struct + { + const char *name; /* Entity name */ + int val; /* Character value */ + } entities[] = + { + { "AElig", 198 }, + { "Aacute", 193 }, + { "Acirc", 194 }, + { "Agrave", 192 }, + { "Alpha", 913 }, + { "Aring", 197 }, + { "Atilde", 195 }, + { "Auml", 196 }, + { "Beta", 914 }, + { "Ccedil", 199 }, + { "Chi", 935 }, + { "Dagger", 8225 }, + { "Delta", 916 }, + { "Dstrok", 208 }, + { "ETH", 208 }, + { "Eacute", 201 }, + { "Ecirc", 202 }, + { "Egrave", 200 }, + { "Epsilon", 917 }, + { "Eta", 919 }, + { "Euml", 203 }, + { "Gamma", 915 }, + { "Iacute", 205 }, + { "Icirc", 206 }, + { "Igrave", 204 }, + { "Iota", 921 }, + { "Iuml", 207 }, + { "Kappa", 922 }, + { "Lambda", 923 }, + { "Mu", 924 }, + { "Ntilde", 209 }, + { "Nu", 925 }, + { "OElig", 338 }, + { "Oacute", 211 }, + { "Ocirc", 212 }, + { "Ograve", 210 }, + { "Omega", 937 }, + { "Omicron", 927 }, + { "Oslash", 216 }, + { "Otilde", 213 }, + { "Ouml", 214 }, + { "Phi", 934 }, + { "Pi", 928 }, + { "Prime", 8243 }, + { "Psi", 936 }, + { "Rho", 929 }, + { "Scaron", 352 }, + { "Sigma", 931 }, + { "THORN", 222 }, + { "Tau", 932 }, + { "Theta", 920 }, + { "Uacute", 218 }, + { "Ucirc", 219 }, + { "Ugrave", 217 }, + { "Upsilon", 933 }, + { "Uuml", 220 }, + { "Xi", 926 }, + { "Yacute", 221 }, + { "Yuml", 376 }, + { "Zeta", 918 }, + { "aacute", 225 }, + { "acirc", 226 }, + { "acute", 180 }, + { "aelig", 230 }, + { "agrave", 224 }, + { "alefsym", 8501 }, + { "alpha", 945 }, + { "amp", '&' }, + { "and", 8743 }, + { "ang", 8736 }, + { "apos", '\'' }, + { "aring", 229 }, + { "asymp", 8776 }, + { "atilde", 227 }, + { "auml", 228 }, + { "bdquo", 8222 }, + { "beta", 946 }, + { "brkbar", 166 }, + { "brvbar", 166 }, + { "bull", 8226 }, + { "cap", 8745 }, + { "ccedil", 231 }, + { "cedil", 184 }, + { "cent", 162 }, + { "chi", 967 }, + { "circ", 710 }, + { "clubs", 9827 }, + { "cong", 8773 }, + { "copy", 169 }, + { "crarr", 8629 }, + { "cup", 8746 }, + { "curren", 164 }, + { "dArr", 8659 }, + { "dagger", 8224 }, + { "darr", 8595 }, + { "deg", 176 }, + { "delta", 948 }, + { "diams", 9830 }, + { "die", 168 }, + { "divide", 247 }, + { "eacute", 233 }, + { "ecirc", 234 }, + { "egrave", 232 }, + { "empty", 8709 }, + { "emsp", 8195 }, + { "ensp", 8194 }, + { "epsilon", 949 }, + { "equiv", 8801 }, + { "eta", 951 }, + { "eth", 240 }, + { "euml", 235 }, + { "euro", 8364 }, + { "exist", 8707 }, + { "fnof", 402 }, + { "forall", 8704 }, + { "frac12", 189 }, + { "frac14", 188 }, + { "frac34", 190 }, + { "frasl", 8260 }, + { "gamma", 947 }, + { "ge", 8805 }, + { "gt", '>' }, + { "hArr", 8660 }, + { "harr", 8596 }, + { "hearts", 9829 }, + { "hellip", 8230 }, + { "hibar", 175 }, + { "iacute", 237 }, + { "icirc", 238 }, + { "iexcl", 161 }, + { "igrave", 236 }, + { "image", 8465 }, + { "infin", 8734 }, + { "int", 8747 }, + { "iota", 953 }, + { "iquest", 191 }, + { "isin", 8712 }, + { "iuml", 239 }, + { "kappa", 954 }, + { "lArr", 8656 }, + { "lambda", 955 }, + { "lang", 9001 }, + { "laquo", 171 }, + { "larr", 8592 }, + { "lceil", 8968 }, + { "ldquo", 8220 }, + { "le", 8804 }, + { "lfloor", 8970 }, + { "lowast", 8727 }, + { "loz", 9674 }, + { "lrm", 8206 }, + { "lsaquo", 8249 }, + { "lsquo", 8216 }, + { "lt", '<' }, + { "macr", 175 }, + { "mdash", 8212 }, + { "micro", 181 }, + { "middot", 183 }, + { "minus", 8722 }, + { "mu", 956 }, + { "nabla", 8711 }, + { "nbsp", 160 }, + { "ndash", 8211 }, + { "ne", 8800 }, + { "ni", 8715 }, + { "not", 172 }, + { "notin", 8713 }, + { "nsub", 8836 }, + { "ntilde", 241 }, + { "nu", 957 }, + { "oacute", 243 }, + { "ocirc", 244 }, + { "oelig", 339 }, + { "ograve", 242 }, + { "oline", 8254 }, + { "omega", 969 }, + { "omicron", 959 }, + { "oplus", 8853 }, + { "or", 8744 }, + { "ordf", 170 }, + { "ordm", 186 }, + { "oslash", 248 }, + { "otilde", 245 }, + { "otimes", 8855 }, + { "ouml", 246 }, + { "para", 182 }, + { "part", 8706 }, + { "permil", 8240 }, + { "perp", 8869 }, + { "phi", 966 }, + { "pi", 960 }, + { "piv", 982 }, + { "plusmn", 177 }, + { "pound", 163 }, + { "prime", 8242 }, + { "prod", 8719 }, + { "prop", 8733 }, + { "psi", 968 }, + { "quot", '\"' }, + { "rArr", 8658 }, + { "radic", 8730 }, + { "rang", 9002 }, + { "raquo", 187 }, + { "rarr", 8594 }, + { "rceil", 8969 }, + { "rdquo", 8221 }, + { "real", 8476 }, + { "reg", 174 }, + { "rfloor", 8971 }, + { "rho", 961 }, + { "rlm", 8207 }, + { "rsaquo", 8250 }, + { "rsquo", 8217 }, + { "sbquo", 8218 }, + { "scaron", 353 }, + { "sdot", 8901 }, + { "sect", 167 }, + { "shy", 173 }, + { "sigma", 963 }, + { "sigmaf", 962 }, + { "sim", 8764 }, + { "spades", 9824 }, + { "sub", 8834 }, + { "sube", 8838 }, + { "sum", 8721 }, + { "sup", 8835 }, + { "sup1", 185 }, + { "sup2", 178 }, + { "sup3", 179 }, + { "supe", 8839 }, + { "szlig", 223 }, + { "tau", 964 }, + { "there4", 8756 }, + { "theta", 952 }, + { "thetasym", 977 }, + { "thinsp", 8201 }, + { "thorn", 254 }, + { "tilde", 732 }, + { "times", 215 }, + { "trade", 8482 }, + { "uArr", 8657 }, + { "uacute", 250 }, + { "uarr", 8593 }, + { "ucirc", 251 }, + { "ugrave", 249 }, + { "uml", 168 }, + { "upsih", 978 }, + { "upsilon", 965 }, + { "uuml", 252 }, + { "weierp", 8472 }, + { "xi", 958 }, + { "yacute", 253 }, + { "yen", 165 }, + { "yuml", 255 }, + { "zeta", 950 }, + { "zwj", 8205 }, + { "zwnj", 8204 } + }; + + + /* + * Do a binary search for the named entity... + */ + + first = 0; + last = (int)(sizeof(entities) / sizeof(entities[0]) - 1); + + while ((last - first) > 1) + { + current = (first + last) / 2; + + if ((diff = strcmp(name, entities[current].name)) == 0) + return (entities[current].val); + else if (diff < 0) + last = current; + else + first = current; + } + + /* + * If we get here, there is a small chance that there is still + * a match; check first and last... + */ + + if (!strcmp(name, entities[first].name)) + return (entities[first].val); + else if (!strcmp(name, entities[last].name)) + return (entities[last].val); + else + return (-1); +} + + +/* + * End of "$Id: mxml-entity.c 385 2009-03-19 05:38:52Z mike $". + */ diff -Naur mxml-2.6/mxml-file.c mxml-2.6-haiku/mxml-file.c --- mxml-2.6/mxml-file.c 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/mxml-file.c 2009-05-17 05:20:52.000000000 +0000 @@ -0,0 +1,3027 @@ +/* + * "$Id: mxml-file.c 391 2009-05-17 05:20:52Z mike $" + * + * File loading code for Mini-XML, a small XML-like file parsing library. + * + * Copyright 2003-2009 by Michael Sweet. + * + * This program is free software; you can redistribute it and/or + * modify it under the terms of the GNU Library General Public + * License as published by the Free Software Foundation; either + * version 2, or (at your option) any later version. + * + * This program is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU General Public License for more details. + * + * Contents: + * + * mxmlLoadFd() - Load a file descriptor into an XML node tree. + * mxmlLoadFile() - Load a file into an XML node tree. + * mxmlLoadString() - Load a string into an XML node tree. + * mxmlSaveAllocString() - Save an XML node tree to an allocated string. + * mxmlSaveFd() - Save an XML tree to a file descriptor. + * mxmlSaveFile() - Save an XML tree to a file. + * mxmlSaveString() - Save an XML node tree to a string. + * mxmlSAXLoadFd() - Load a file descriptor into an XML node tree + * using a SAX callback. + * mxmlSAXLoadFile() - Load a file into an XML node tree + * using a SAX callback. + * mxmlSAXLoadString() - Load a string into an XML node tree + * using a SAX callback. + * mxmlSetCustomHandlers() - Set the handling functions for custom data. + * mxmlSetErrorCallback() - Set the error message callback. + * mxmlSetWrapMargin() - Set the the wrap margin when saving XML data. + * mxml_add_char() - Add a character to a buffer, expanding as needed. + * mxml_fd_getc() - Read a character from a file descriptor. + * mxml_fd_putc() - Write a character to a file descriptor. + * mxml_fd_read() - Read a buffer of data from a file descriptor. + * mxml_fd_write() - Write a buffer of data to a file descriptor. + * mxml_file_getc() - Get a character from a file. + * mxml_file_putc() - Write a character to a file. + * mxml_get_entity() - Get the character corresponding to an entity... + * mxml_load_data() - Load data into an XML node tree. + * mxml_parse_element() - Parse an element for any attributes... + * mxml_string_getc() - Get a character from a string. + * mxml_string_putc() - Write a character to a string. + * mxml_write_name() - Write a name string. + * mxml_write_node() - Save an XML node to a file. + * mxml_write_string() - Write a string, escaping & and < as needed. + * mxml_write_ws() - Do whitespace callback... + */ + +/* + * Include necessary headers... + */ + +#ifndef WIN32 +# include +#endif /* !WIN32 */ +#include "mxml-private.h" + + +/* + * Character encoding... + */ + +#define ENCODE_UTF8 0 /* UTF-8 */ +#define ENCODE_UTF16BE 1 /* UTF-16 Big-Endian */ +#define ENCODE_UTF16LE 2 /* UTF-16 Little-Endian */ + + +/* + * Macro to test for a bad XML character... + */ + +#define mxml_bad_char(ch) ((ch) < ' ' && (ch) != '\n' && (ch) != '\r' && (ch) != '\t') + + +/* + * Types and structures... + */ + +typedef int (*_mxml_getc_cb_t)(void *, int *); +typedef int (*_mxml_putc_cb_t)(int, void *); + +typedef struct _mxml_fdbuf_s /**** File descriptor buffer ****/ +{ + int fd; /* File descriptor */ + unsigned char *current, /* Current position in buffer */ + *end, /* End of buffer */ + buffer[8192]; /* Character buffer */ +} _mxml_fdbuf_t; + + +/* + * Local functions... + */ + +static int mxml_add_char(int ch, char **ptr, char **buffer, + int *bufsize); +static int mxml_fd_getc(void *p, int *encoding); +static int mxml_fd_putc(int ch, void *p); +static int mxml_fd_read(_mxml_fdbuf_t *buf); +static int mxml_fd_write(_mxml_fdbuf_t *buf); +static int mxml_file_getc(void *p, int *encoding); +static int mxml_file_putc(int ch, void *p); +static int mxml_get_entity(mxml_node_t *parent, void *p, + int *encoding, + _mxml_getc_cb_t getc_cb); +static inline int mxml_isspace(int ch) + { + return (ch == ' ' || ch == '\t' || ch == '\r' || + ch == '\n'); + } +static mxml_node_t *mxml_load_data(mxml_node_t *top, void *p, + mxml_load_cb_t cb, + _mxml_getc_cb_t getc_cb, + mxml_sax_cb_t sax_cb, void *sax_data); +static int mxml_parse_element(mxml_node_t *node, void *p, + int *encoding, + _mxml_getc_cb_t getc_cb); +static int mxml_string_getc(void *p, int *encoding); +static int mxml_string_putc(int ch, void *p); +static int mxml_write_name(const char *s, void *p, + _mxml_putc_cb_t putc_cb); +static int mxml_write_node(mxml_node_t *node, void *p, + mxml_save_cb_t cb, int col, + _mxml_putc_cb_t putc_cb, + _mxml_global_t *global); +static int mxml_write_string(const char *s, void *p, + _mxml_putc_cb_t putc_cb); +static int mxml_write_ws(mxml_node_t *node, void *p, + mxml_save_cb_t cb, int ws, + int col, _mxml_putc_cb_t putc_cb); + + +/* + * 'mxmlLoadFd()' - Load a file descriptor into an XML node tree. + * + * The nodes in the specified file are added to the specified top node. + * If no top node is provided, the XML file MUST be well-formed with a + * single parent node like for the entire file. The callback + * function returns the value type that should be used for child nodes. + * If MXML_NO_CALLBACK is specified then all child nodes will be either + * MXML_ELEMENT or MXML_TEXT nodes. + * + * The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK, + * MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading + * child nodes of the specified type. + */ + +mxml_node_t * /* O - First node or NULL if the file could not be read. */ +mxmlLoadFd(mxml_node_t *top, /* I - Top node */ + int fd, /* I - File descriptor to read from */ + mxml_load_cb_t cb) /* I - Callback function or MXML_NO_CALLBACK */ +{ + _mxml_fdbuf_t buf; /* File descriptor buffer */ + + + /* + * Initialize the file descriptor buffer... + */ + + buf.fd = fd; + buf.current = buf.buffer; + buf.end = buf.buffer; + + /* + * Read the XML data... + */ + + return (mxml_load_data(top, &buf, cb, mxml_fd_getc, MXML_NO_CALLBACK, NULL)); +} + + +/* + * 'mxmlLoadFile()' - Load a file into an XML node tree. + * + * The nodes in the specified file are added to the specified top node. + * If no top node is provided, the XML file MUST be well-formed with a + * single parent node like for the entire file. The callback + * function returns the value type that should be used for child nodes. + * If MXML_NO_CALLBACK is specified then all child nodes will be either + * MXML_ELEMENT or MXML_TEXT nodes. + * + * The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK, + * MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading + * child nodes of the specified type. + */ + +mxml_node_t * /* O - First node or NULL if the file could not be read. */ +mxmlLoadFile(mxml_node_t *top, /* I - Top node */ + FILE *fp, /* I - File to read from */ + mxml_load_cb_t cb) /* I - Callback function or MXML_NO_CALLBACK */ +{ + /* + * Read the XML data... + */ + + return (mxml_load_data(top, fp, cb, mxml_file_getc, MXML_NO_CALLBACK, NULL)); +} + + +/* + * 'mxmlLoadString()' - Load a string into an XML node tree. + * + * The nodes in the specified string are added to the specified top node. + * If no top node is provided, the XML string MUST be well-formed with a + * single parent node like for the entire string. The callback + * function returns the value type that should be used for child nodes. + * If MXML_NO_CALLBACK is specified then all child nodes will be either + * MXML_ELEMENT or MXML_TEXT nodes. + * + * The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK, + * MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading + * child nodes of the specified type. + */ + +mxml_node_t * /* O - First node or NULL if the string has errors. */ +mxmlLoadString(mxml_node_t *top, /* I - Top node */ + const char *s, /* I - String to load */ + mxml_load_cb_t cb) /* I - Callback function or MXML_NO_CALLBACK */ +{ + /* + * Read the XML data... + */ + + return (mxml_load_data(top, (void *)&s, cb, mxml_string_getc, MXML_NO_CALLBACK, + NULL)); +} + + +/* + * 'mxmlSaveAllocString()' - Save an XML node tree to an allocated string. + * + * This function returns a pointer to a string containing the textual + * representation of the XML node tree. The string should be freed + * using the free() function when you are done with it. NULL is returned + * if the node would produce an empty string or if the string cannot be + * allocated. + * + * The callback argument specifies a function that returns a whitespace + * string or NULL before and after each element. If MXML_NO_CALLBACK + * is specified, whitespace will only be added before MXML_TEXT nodes + * with leading whitespace and before attribute names inside opening + * element tags. + */ + +char * /* O - Allocated string or NULL */ +mxmlSaveAllocString( + mxml_node_t *node, /* I - Node to write */ + mxml_save_cb_t cb) /* I - Whitespace callback or MXML_NO_CALLBACK */ +{ + int bytes; /* Required bytes */ + char buffer[8192]; /* Temporary buffer */ + char *s; /* Allocated string */ + + + /* + * Write the node to the temporary buffer... + */ + + bytes = mxmlSaveString(node, buffer, sizeof(buffer), cb); + + if (bytes <= 0) + return (NULL); + + if (bytes < (int)(sizeof(buffer) - 1)) + { + /* + * Node fit inside the buffer, so just duplicate that string and + * return... + */ + + return (strdup(buffer)); + } + + /* + * Allocate a buffer of the required size and save the node to the + * new buffer... + */ + + if ((s = malloc(bytes + 1)) == NULL) + return (NULL); + + mxmlSaveString(node, s, bytes + 1, cb); + + /* + * Return the allocated string... + */ + + return (s); +} + + +/* + * 'mxmlSaveFd()' - Save an XML tree to a file descriptor. + * + * The callback argument specifies a function that returns a whitespace + * string or NULL before and after each element. If MXML_NO_CALLBACK + * is specified, whitespace will only be added before MXML_TEXT nodes + * with leading whitespace and before attribute names inside opening + * element tags. + */ + +int /* O - 0 on success, -1 on error. */ +mxmlSaveFd(mxml_node_t *node, /* I - Node to write */ + int fd, /* I - File descriptor to write to */ + mxml_save_cb_t cb) /* I - Whitespace callback or MXML_NO_CALLBACK */ +{ + int col; /* Final column */ + _mxml_fdbuf_t buf; /* File descriptor buffer */ + _mxml_global_t *global = _mxml_global(); + /* Global data */ + + + /* + * Initialize the file descriptor buffer... + */ + + buf.fd = fd; + buf.current = buf.buffer; + buf.end = buf.buffer + sizeof(buf.buffer); + + /* + * Write the node... + */ + + if ((col = mxml_write_node(node, &buf, cb, 0, mxml_fd_putc, global)) < 0) + return (-1); + + if (col > 0) + if (mxml_fd_putc('\n', &buf) < 0) + return (-1); + + /* + * Flush and return... + */ + + return (mxml_fd_write(&buf)); +} + + +/* + * 'mxmlSaveFile()' - Save an XML tree to a file. + * + * The callback argument specifies a function that returns a whitespace + * string or NULL before and after each element. If MXML_NO_CALLBACK + * is specified, whitespace will only be added before MXML_TEXT nodes + * with leading whitespace and before attribute names inside opening + * element tags. + */ + +int /* O - 0 on success, -1 on error. */ +mxmlSaveFile(mxml_node_t *node, /* I - Node to write */ + FILE *fp, /* I - File to write to */ + mxml_save_cb_t cb) /* I - Whitespace callback or MXML_NO_CALLBACK */ +{ + int col; /* Final column */ + _mxml_global_t *global = _mxml_global(); + /* Global data */ + + + /* + * Write the node... + */ + + if ((col = mxml_write_node(node, fp, cb, 0, mxml_file_putc, global)) < 0) + return (-1); + + if (col > 0) + if (putc('\n', fp) < 0) + return (-1); + + /* + * Return 0 (success)... + */ + + return (0); +} + + +/* + * 'mxmlSaveString()' - Save an XML node tree to a string. + * + * This function returns the total number of bytes that would be + * required for the string but only copies (bufsize - 1) characters + * into the specified buffer. + * + * The callback argument specifies a function that returns a whitespace + * string or NULL before and after each element. If MXML_NO_CALLBACK + * is specified, whitespace will only be added before MXML_TEXT nodes + * with leading whitespace and before attribute names inside opening + * element tags. + */ + +int /* O - Size of string */ +mxmlSaveString(mxml_node_t *node, /* I - Node to write */ + char *buffer, /* I - String buffer */ + int bufsize, /* I - Size of string buffer */ + mxml_save_cb_t cb) /* I - Whitespace callback or MXML_NO_CALLBACK */ +{ + int col; /* Final column */ + char *ptr[2]; /* Pointers for putc_cb */ + _mxml_global_t *global = _mxml_global(); + /* Global data */ + + + /* + * Write the node... + */ + + ptr[0] = buffer; + ptr[1] = buffer + bufsize; + + if ((col = mxml_write_node(node, ptr, cb, 0, mxml_string_putc, global)) < 0) + return (-1); + + if (col > 0) + mxml_string_putc('\n', ptr); + + /* + * Nul-terminate the buffer... + */ + + if (ptr[0] >= ptr[1]) + buffer[bufsize - 1] = '\0'; + else + ptr[0][0] = '\0'; + + /* + * Return the number of characters... + */ + + return (ptr[0] - buffer); +} + + +/* + * 'mxmlSAXLoadFd()' - Load a file descriptor into an XML node tree + * using a SAX callback. + * + * The nodes in the specified file are added to the specified top node. + * If no top node is provided, the XML file MUST be well-formed with a + * single parent node like for the entire file. The callback + * function returns the value type that should be used for child nodes. + * If MXML_NO_CALLBACK is specified then all child nodes will be either + * MXML_ELEMENT or MXML_TEXT nodes. + * + * The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK, + * MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading + * child nodes of the specified type. + * + * The SAX callback must call mxmlRetain() for any nodes that need to + * be kept for later use. Otherwise, nodes are deleted when the parent + * node is closed or after each data, comment, CDATA, or directive node. + * + * @since Mini-XML 2.3@ + */ + +mxml_node_t * /* O - First node or NULL if the file could not be read. */ +mxmlSAXLoadFd(mxml_node_t *top, /* I - Top node */ + int fd, /* I - File descriptor to read from */ + mxml_load_cb_t cb, /* I - Callback function or MXML_NO_CALLBACK */ + mxml_sax_cb_t sax_cb, /* I - SAX callback or MXML_NO_CALLBACK */ + void *sax_data) /* I - SAX user data */ +{ + _mxml_fdbuf_t buf; /* File descriptor buffer */ + + + /* + * Initialize the file descriptor buffer... + */ + + buf.fd = fd; + buf.current = buf.buffer; + buf.end = buf.buffer; + + /* + * Read the XML data... + */ + + return (mxml_load_data(top, &buf, cb, mxml_fd_getc, sax_cb, sax_data)); +} + + +/* + * 'mxmlSAXLoadFile()' - Load a file into an XML node tree + * using a SAX callback. + * + * The nodes in the specified file are added to the specified top node. + * If no top node is provided, the XML file MUST be well-formed with a + * single parent node like for the entire file. The callback + * function returns the value type that should be used for child nodes. + * If MXML_NO_CALLBACK is specified then all child nodes will be either + * MXML_ELEMENT or MXML_TEXT nodes. + * + * The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK, + * MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading + * child nodes of the specified type. + * + * The SAX callback must call mxmlRetain() for any nodes that need to + * be kept for later use. Otherwise, nodes are deleted when the parent + * node is closed or after each data, comment, CDATA, or directive node. + * + * @since Mini-XML 2.3@ + */ + +mxml_node_t * /* O - First node or NULL if the file could not be read. */ +mxmlSAXLoadFile( + mxml_node_t *top, /* I - Top node */ + FILE *fp, /* I - File to read from */ + mxml_load_cb_t cb, /* I - Callback function or MXML_NO_CALLBACK */ + mxml_sax_cb_t sax_cb, /* I - SAX callback or MXML_NO_CALLBACK */ + void *sax_data) /* I - SAX user data */ +{ + /* + * Read the XML data... + */ + + return (mxml_load_data(top, fp, cb, mxml_file_getc, sax_cb, sax_data)); +} + + +/* + * 'mxmlSAXLoadString()' - Load a string into an XML node tree + * using a SAX callback. + * + * The nodes in the specified string are added to the specified top node. + * If no top node is provided, the XML string MUST be well-formed with a + * single parent node like for the entire string. The callback + * function returns the value type that should be used for child nodes. + * If MXML_NO_CALLBACK is specified then all child nodes will be either + * MXML_ELEMENT or MXML_TEXT nodes. + * + * The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK, + * MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading + * child nodes of the specified type. + * + * The SAX callback must call mxmlRetain() for any nodes that need to + * be kept for later use. Otherwise, nodes are deleted when the parent + * node is closed or after each data, comment, CDATA, or directive node. + * + * @since Mini-XML 2.3@ + */ + +mxml_node_t * /* O - First node or NULL if the string has errors. */ +mxmlSAXLoadString( + mxml_node_t *top, /* I - Top node */ + const char *s, /* I - String to load */ + mxml_load_cb_t cb, /* I - Callback function or MXML_NO_CALLBACK */ + mxml_sax_cb_t sax_cb, /* I - SAX callback or MXML_NO_CALLBACK */ + void *sax_data) /* I - SAX user data */ +{ + /* + * Read the XML data... + */ + + return (mxml_load_data(top, (void *)&s, cb, mxml_string_getc, sax_cb, sax_data)); +} + + +/* + * 'mxmlSetCustomHandlers()' - Set the handling functions for custom data. + * + * The load function accepts a node pointer and a data string and must + * return 0 on success and non-zero on error. + * + * The save function accepts a node pointer and must return a malloc'd + * string on success and NULL on error. + * + */ + +void +mxmlSetCustomHandlers( + mxml_custom_load_cb_t load, /* I - Load function */ + mxml_custom_save_cb_t save) /* I - Save function */ +{ + _mxml_global_t *global = _mxml_global(); + /* Global data */ + + + global->custom_load_cb = load; + global->custom_save_cb = save; +} + + +/* + * 'mxmlSetErrorCallback()' - Set the error message callback. + */ + +void +mxmlSetErrorCallback(mxml_error_cb_t cb)/* I - Error callback function */ +{ + _mxml_global_t *global = _mxml_global(); + /* Global data */ + + + global->error_cb = cb; +} + + +/* + * 'mxmlSetWrapMargin()' - Set the the wrap margin when saving XML data. + * + * Wrapping is disabled when "column" is 0. + * + * @since Mini-XML 2.3@ + */ + +void +mxmlSetWrapMargin(int column) /* I - Column for wrapping, 0 to disable wrapping */ +{ + _mxml_global_t *global = _mxml_global(); + /* Global data */ + + + global->wrap = column; +} + + +/* + * 'mxml_add_char()' - Add a character to a buffer, expanding as needed. + */ + +static int /* O - 0 on success, -1 on error */ +mxml_add_char(int ch, /* I - Character to add */ + char **bufptr, /* IO - Current position in buffer */ + char **buffer, /* IO - Current buffer */ + int *bufsize) /* IO - Current buffer size */ +{ + char *newbuffer; /* New buffer value */ + + + if (*bufptr >= (*buffer + *bufsize - 4)) + { + /* + * Increase the size of the buffer... + */ + + if (*bufsize < 1024) + (*bufsize) *= 2; + else + (*bufsize) += 1024; + + if ((newbuffer = realloc(*buffer, *bufsize)) == NULL) + { + free(*buffer); + + mxml_error("Unable to expand string buffer to %d bytes!", *bufsize); + + return (-1); + } + + *bufptr = newbuffer + (*bufptr - *buffer); + *buffer = newbuffer; + } + + if (ch < 0x80) + { + /* + * Single byte ASCII... + */ + + *(*bufptr)++ = ch; + } + else if (ch < 0x800) + { + /* + * Two-byte UTF-8... + */ + + *(*bufptr)++ = 0xc0 | (ch >> 6); + *(*bufptr)++ = 0x80 | (ch & 0x3f); + } + else if (ch < 0x10000) + { + /* + * Three-byte UTF-8... + */ + + *(*bufptr)++ = 0xe0 | (ch >> 12); + *(*bufptr)++ = 0x80 | ((ch >> 6) & 0x3f); + *(*bufptr)++ = 0x80 | (ch & 0x3f); + } + else + { + /* + * Four-byte UTF-8... + */ + + *(*bufptr)++ = 0xf0 | (ch >> 18); + *(*bufptr)++ = 0x80 | ((ch >> 12) & 0x3f); + *(*bufptr)++ = 0x80 | ((ch >> 6) & 0x3f); + *(*bufptr)++ = 0x80 | (ch & 0x3f); + } + + return (0); +} + + +/* + * 'mxml_fd_getc()' - Read a character from a file descriptor. + */ + +static int /* O - Character or EOF */ +mxml_fd_getc(void *p, /* I - File descriptor buffer */ + int *encoding) /* IO - Encoding */ +{ + _mxml_fdbuf_t *buf; /* File descriptor buffer */ + int ch, /* Current character */ + temp; /* Temporary character */ + + + /* + * Grab the next character in the buffer... + */ + + buf = (_mxml_fdbuf_t *)p; + + if (buf->current >= buf->end) + if (mxml_fd_read(buf) < 0) + return (EOF); + + ch = *(buf->current)++; + + switch (*encoding) + { + case ENCODE_UTF8 : + /* + * Got a UTF-8 character; convert UTF-8 to Unicode and return... + */ + + if (!(ch & 0x80)) + { +#if DEBUG > 1 + printf("mxml_fd_getc: %c (0x%04x)\n", ch < ' ' ? '.' : ch, ch); +#endif /* DEBUG > 1 */ + + if (mxml_bad_char(ch)) + { + mxml_error("Bad control character 0x%02x not allowed by XML standard!", + ch); + return (EOF); + } + + return (ch); + } + else if (ch == 0xfe) + { + /* + * UTF-16 big-endian BOM? + */ + + if (buf->current >= buf->end) + if (mxml_fd_read(buf) < 0) + return (EOF); + + ch = *(buf->current)++; + + if (ch != 0xff) + return (EOF); + + *encoding = ENCODE_UTF16BE; + + return (mxml_fd_getc(p, encoding)); + } + else if (ch == 0xff) + { + /* + * UTF-16 little-endian BOM? + */ + + if (buf->current >= buf->end) + if (mxml_fd_read(buf) < 0) + return (EOF); + + ch = *(buf->current)++; + + if (ch != 0xfe) + return (EOF); + + *encoding = ENCODE_UTF16LE; + + return (mxml_fd_getc(p, encoding)); + } + else if ((ch & 0xe0) == 0xc0) + { + /* + * Two-byte value... + */ + + if (buf->current >= buf->end) + if (mxml_fd_read(buf) < 0) + return (EOF); + + temp = *(buf->current)++; + + if ((temp & 0xc0) != 0x80) + return (EOF); + + ch = ((ch & 0x1f) << 6) | (temp & 0x3f); + + if (ch < 0x80) + { + mxml_error("Invalid UTF-8 sequence for character 0x%04x!", ch); + return (EOF); + } + } + else if ((ch & 0xf0) == 0xe0) + { + /* + * Three-byte value... + */ + + if (buf->current >= buf->end) + if (mxml_fd_read(buf) < 0) + return (EOF); + + temp = *(buf->current)++; + + if ((temp & 0xc0) != 0x80) + return (EOF); + + ch = ((ch & 0x0f) << 6) | (temp & 0x3f); + + if (buf->current >= buf->end) + if (mxml_fd_read(buf) < 0) + return (EOF); + + temp = *(buf->current)++; + + if ((temp & 0xc0) != 0x80) + return (EOF); + + ch = (ch << 6) | (temp & 0x3f); + + if (ch < 0x800) + { + mxml_error("Invalid UTF-8 sequence for character 0x%04x!", ch); + return (EOF); + } + + /* + * Ignore (strip) Byte Order Mark (BOM)... + */ + + if (ch == 0xfeff) + return (mxml_fd_getc(p, encoding)); + } + else if ((ch & 0xf8) == 0xf0) + { + /* + * Four-byte value... + */ + + if (buf->current >= buf->end) + if (mxml_fd_read(buf) < 0) + return (EOF); + + temp = *(buf->current)++; + + if ((temp & 0xc0) != 0x80) + return (EOF); + + ch = ((ch & 0x07) << 6) | (temp & 0x3f); + + if (buf->current >= buf->end) + if (mxml_fd_read(buf) < 0) + return (EOF); + + temp = *(buf->current)++; + + if ((temp & 0xc0) != 0x80) + return (EOF); + + ch = (ch << 6) | (temp & 0x3f); + + if (buf->current >= buf->end) + if (mxml_fd_read(buf) < 0) + return (EOF); + + temp = *(buf->current)++; + + if ((temp & 0xc0) != 0x80) + return (EOF); + + ch = (ch << 6) | (temp & 0x3f); + + if (ch < 0x10000) + { + mxml_error("Invalid UTF-8 sequence for character 0x%04x!", ch); + return (EOF); + } + } + else + return (EOF); + break; + + case ENCODE_UTF16BE : + /* + * Read UTF-16 big-endian char... + */ + + if (buf->current >= buf->end) + if (mxml_fd_read(buf) < 0) + return (EOF); + + temp = *(buf->current)++; + + ch = (ch << 8) | temp; + + if (mxml_bad_char(ch)) + { + mxml_error("Bad control character 0x%02x not allowed by XML standard!", + ch); + return (EOF); + } + else if (ch >= 0xd800 && ch <= 0xdbff) + { + /* + * Multi-word UTF-16 char... + */ + + int lch; + + if (buf->current >= buf->end) + if (mxml_fd_read(buf) < 0) + return (EOF); + + lch = *(buf->current)++; + + if (buf->current >= buf->end) + if (mxml_fd_read(buf) < 0) + return (EOF); + + temp = *(buf->current)++; + + lch = (lch << 8) | temp; + + if (lch < 0xdc00 || lch >= 0xdfff) + return (EOF); + + ch = (((ch & 0x3ff) << 10) | (lch & 0x3ff)) + 0x10000; + } + break; + + case ENCODE_UTF16LE : + /* + * Read UTF-16 little-endian char... + */ + + if (buf->current >= buf->end) + if (mxml_fd_read(buf) < 0) + return (EOF); + + temp = *(buf->current)++; + + ch |= (temp << 8); + + if (mxml_bad_char(ch)) + { + mxml_error("Bad control character 0x%02x not allowed by XML standard!", + ch); + return (EOF); + } + else if (ch >= 0xd800 && ch <= 0xdbff) + { + /* + * Multi-word UTF-16 char... + */ + + int lch; + + if (buf->current >= buf->end) + if (mxml_fd_read(buf) < 0) + return (EOF); + + lch = *(buf->current)++; + + if (buf->current >= buf->end) + if (mxml_fd_read(buf) < 0) + return (EOF); + + temp = *(buf->current)++; + + lch |= (temp << 8); + + if (lch < 0xdc00 || lch >= 0xdfff) + return (EOF); + + ch = (((ch & 0x3ff) << 10) | (lch & 0x3ff)) + 0x10000; + } + break; + } + +#if DEBUG > 1 + printf("mxml_fd_getc: %c (0x%04x)\n", ch < ' ' ? '.' : ch, ch); +#endif /* DEBUG > 1 */ + + return (ch); +} + + +/* + * 'mxml_fd_putc()' - Write a character to a file descriptor. + */ + +static int /* O - 0 on success, -1 on error */ +mxml_fd_putc(int ch, /* I - Character */ + void *p) /* I - File descriptor buffer */ +{ + _mxml_fdbuf_t *buf; /* File descriptor buffer */ + + + /* + * Flush the write buffer as needed... + */ + + buf = (_mxml_fdbuf_t *)p; + + if (buf->current >= buf->end) + if (mxml_fd_write(buf) < 0) + return (-1); + + *(buf->current)++ = ch; + + /* + * Return successfully... + */ + + return (0); +} + + +/* + * 'mxml_fd_read()' - Read a buffer of data from a file descriptor. + */ + +static int /* O - 0 on success, -1 on error */ +mxml_fd_read(_mxml_fdbuf_t *buf) /* I - File descriptor buffer */ +{ + int bytes; /* Bytes read... */ + + + /* + * Range check input... + */ + + if (!buf) + return (-1); + + /* + * Read from the file descriptor... + */ + + while ((bytes = read(buf->fd, buf->buffer, sizeof(buf->buffer))) < 0) +#ifdef EINTR + if (errno != EAGAIN && errno != EINTR) +#else + if (errno != EAGAIN) +#endif /* EINTR */ + return (-1); + + if (bytes == 0) + return (-1); + + /* + * Update the pointers and return success... + */ + + buf->current = buf->buffer; + buf->end = buf->buffer + bytes; + + return (0); +} + + +/* + * 'mxml_fd_write()' - Write a buffer of data to a file descriptor. + */ + +static int /* O - 0 on success, -1 on error */ +mxml_fd_write(_mxml_fdbuf_t *buf) /* I - File descriptor buffer */ +{ + int bytes; /* Bytes written */ + unsigned char *ptr; /* Pointer into buffer */ + + + /* + * Range check... + */ + + if (!buf) + return (-1); + + /* + * Return 0 if there is nothing to write... + */ + + if (buf->current == buf->buffer) + return (0); + + /* + * Loop until we have written everything... + */ + + for (ptr = buf->buffer; ptr < buf->current; ptr += bytes) + if ((bytes = write(buf->fd, ptr, buf->current - ptr)) < 0) + return (-1); + + /* + * All done, reset pointers and return success... + */ + + buf->current = buf->buffer; + + return (0); +} + + +/* + * 'mxml_file_getc()' - Get a character from a file. + */ + +static int /* O - Character or EOF */ +mxml_file_getc(void *p, /* I - Pointer to file */ + int *encoding) /* IO - Encoding */ +{ + int ch, /* Character from file */ + temp; /* Temporary character */ + FILE *fp; /* Pointer to file */ + + + /* + * Read a character from the file and see if it is EOF or ASCII... + */ + + fp = (FILE *)p; + ch = getc(fp); + + if (ch == EOF) + return (EOF); + + switch (*encoding) + { + case ENCODE_UTF8 : + /* + * Got a UTF-8 character; convert UTF-8 to Unicode and return... + */ + + if (!(ch & 0x80)) + { + if (mxml_bad_char(ch)) + { + mxml_error("Bad control character 0x%02x not allowed by XML standard!", + ch); + return (EOF); + } + +#if DEBUG > 1 + printf("mxml_file_getc: %c (0x%04x)\n", ch < ' ' ? '.' : ch, ch); +#endif /* DEBUG > 1 */ + + return (ch); + } + else if (ch == 0xfe) + { + /* + * UTF-16 big-endian BOM? + */ + + ch = getc(fp); + if (ch != 0xff) + return (EOF); + + *encoding = ENCODE_UTF16BE; + + return (mxml_file_getc(p, encoding)); + } + else if (ch == 0xff) + { + /* + * UTF-16 little-endian BOM? + */ + + ch = getc(fp); + if (ch != 0xfe) + return (EOF); + + *encoding = ENCODE_UTF16LE; + + return (mxml_file_getc(p, encoding)); + } + else if ((ch & 0xe0) == 0xc0) + { + /* + * Two-byte value... + */ + + if ((temp = getc(fp)) == EOF || (temp & 0xc0) != 0x80) + return (EOF); + + ch = ((ch & 0x1f) << 6) | (temp & 0x3f); + + if (ch < 0x80) + { + mxml_error("Invalid UTF-8 sequence for character 0x%04x!", ch); + return (EOF); + } + } + else if ((ch & 0xf0) == 0xe0) + { + /* + * Three-byte value... + */ + + if ((temp = getc(fp)) == EOF || (temp & 0xc0) != 0x80) + return (EOF); + + ch = ((ch & 0x0f) << 6) | (temp & 0x3f); + + if ((temp = getc(fp)) == EOF || (temp & 0xc0) != 0x80) + return (EOF); + + ch = (ch << 6) | (temp & 0x3f); + + if (ch < 0x800) + { + mxml_error("Invalid UTF-8 sequence for character 0x%04x!", ch); + return (EOF); + } + + /* + * Ignore (strip) Byte Order Mark (BOM)... + */ + + if (ch == 0xfeff) + return (mxml_file_getc(p, encoding)); + } + else if ((ch & 0xf8) == 0xf0) + { + /* + * Four-byte value... + */ + + if ((temp = getc(fp)) == EOF || (temp & 0xc0) != 0x80) + return (EOF); + + ch = ((ch & 0x07) << 6) | (temp & 0x3f); + + if ((temp = getc(fp)) == EOF || (temp & 0xc0) != 0x80) + return (EOF); + + ch = (ch << 6) | (temp & 0x3f); + + if ((temp = getc(fp)) == EOF || (temp & 0xc0) != 0x80) + return (EOF); + + ch = (ch << 6) | (temp & 0x3f); + + if (ch < 0x10000) + { + mxml_error("Invalid UTF-8 sequence for character 0x%04x!", ch); + return (EOF); + } + } + else + return (EOF); + break; + + case ENCODE_UTF16BE : + /* + * Read UTF-16 big-endian char... + */ + + ch = (ch << 8) | getc(fp); + + if (mxml_bad_char(ch)) + { + mxml_error("Bad control character 0x%02x not allowed by XML standard!", + ch); + return (EOF); + } + else if (ch >= 0xd800 && ch <= 0xdbff) + { + /* + * Multi-word UTF-16 char... + */ + + int lch = (getc(fp) << 8) | getc(fp); + + if (lch < 0xdc00 || lch >= 0xdfff) + return (EOF); + + ch = (((ch & 0x3ff) << 10) | (lch & 0x3ff)) + 0x10000; + } + break; + + case ENCODE_UTF16LE : + /* + * Read UTF-16 little-endian char... + */ + + ch |= (getc(fp) << 8); + + if (mxml_bad_char(ch)) + { + mxml_error("Bad control character 0x%02x not allowed by XML standard!", + ch); + return (EOF); + } + else if (ch >= 0xd800 && ch <= 0xdbff) + { + /* + * Multi-word UTF-16 char... + */ + + int lch = getc(fp) | (getc(fp) << 8); + + if (lch < 0xdc00 || lch >= 0xdfff) + return (EOF); + + ch = (((ch & 0x3ff) << 10) | (lch & 0x3ff)) + 0x10000; + } + break; + } + +#if DEBUG > 1 + printf("mxml_file_getc: %c (0x%04x)\n", ch < ' ' ? '.' : ch, ch); +#endif /* DEBUG > 1 */ + + return (ch); +} + + +/* + * 'mxml_file_putc()' - Write a character to a file. + */ + +static int /* O - 0 on success, -1 on failure */ +mxml_file_putc(int ch, /* I - Character to write */ + void *p) /* I - Pointer to file */ +{ + return (putc(ch, (FILE *)p) == EOF ? -1 : 0); +} + + +/* + * 'mxml_get_entity()' - Get the character corresponding to an entity... + */ + +static int /* O - Character value or EOF on error */ +mxml_get_entity(mxml_node_t *parent, /* I - Parent node */ + void *p, /* I - Pointer to source */ + int *encoding, /* IO - Character encoding */ + int (*getc_cb)(void *, int *)) + /* I - Get character function */ +{ + int ch; /* Current character */ + char entity[64], /* Entity string */ + *entptr; /* Pointer into entity */ + + + entptr = entity; + + while ((ch = (*getc_cb)(p, encoding)) != EOF) + if (ch > 126 || (!isalnum(ch) && ch != '#')) + break; + else if (entptr < (entity + sizeof(entity) - 1)) + *entptr++ = ch; + else + { + mxml_error("Entity name too long under parent <%s>!", + parent ? parent->value.element.name : "null"); + break; + } + + *entptr = '\0'; + + if (ch != ';') + { + mxml_error("Character entity \"%s\" not terminated under parent <%s>!", + entity, parent ? parent->value.element.name : "null"); + return (EOF); + } + + if (entity[0] == '#') + { + if (entity[1] == 'x') + ch = strtol(entity + 2, NULL, 16); + else + ch = strtol(entity + 1, NULL, 10); + } + else if ((ch = mxmlEntityGetValue(entity)) < 0) + mxml_error("Entity name \"%s;\" not supported under parent <%s>!", + entity, parent ? parent->value.element.name : "null"); + + if (mxml_bad_char(ch)) + { + mxml_error("Bad control character 0x%02x under parent <%s> not allowed by XML standard!", + ch, parent ? parent->value.element.name : "null"); + return (EOF); + } + + return (ch); +} + + +/* + * 'mxml_load_data()' - Load data into an XML node tree. + */ + +static mxml_node_t * /* O - First node or NULL if the file could not be read. */ +mxml_load_data( + mxml_node_t *top, /* I - Top node */ + void *p, /* I - Pointer to data */ + mxml_load_cb_t cb, /* I - Callback function or MXML_NO_CALLBACK */ + _mxml_getc_cb_t getc_cb, /* I - Read function */ + mxml_sax_cb_t sax_cb, /* I - SAX callback or MXML_NO_CALLBACK */ + void *sax_data) /* I - SAX user data */ +{ + mxml_node_t *node, /* Current node */ + *first, /* First node added */ + *parent; /* Current parent node */ + int ch, /* Character from file */ + whitespace; /* Non-zero if whitespace seen */ + char *buffer, /* String buffer */ + *bufptr; /* Pointer into buffer */ + int bufsize; /* Size of buffer */ + mxml_type_t type; /* Current node type */ + int encoding; /* Character encoding */ + _mxml_global_t *global = _mxml_global(); + /* Global data */ + static const char * const types[] = /* Type strings... */ + { + "MXML_ELEMENT", /* XML element with attributes */ + "MXML_INTEGER", /* Integer value */ + "MXML_OPAQUE", /* Opaque string */ + "MXML_REAL", /* Real value */ + "MXML_TEXT", /* Text fragment */ + "MXML_CUSTOM" /* Custom data */ + }; + + + /* + * Read elements and other nodes from the file... + */ + + if ((buffer = malloc(64)) == NULL) + { + mxml_error("Unable to allocate string buffer!"); + return (NULL); + } + + bufsize = 64; + bufptr = buffer; + parent = top; + first = NULL; + whitespace = 0; + encoding = ENCODE_UTF8; + + if (cb && parent) + type = (*cb)(parent); + else + type = MXML_TEXT; + + while ((ch = (*getc_cb)(p, &encoding)) != EOF) + { + if ((ch == '<' || + (mxml_isspace(ch) && type != MXML_OPAQUE && type != MXML_CUSTOM)) && + bufptr > buffer) + { + /* + * Add a new value node... + */ + + *bufptr = '\0'; + + switch (type) + { + case MXML_INTEGER : + node = mxmlNewInteger(parent, strtol(buffer, &bufptr, 0)); + break; + + case MXML_OPAQUE : + node = mxmlNewOpaque(parent, buffer); + break; + + case MXML_REAL : + node = mxmlNewReal(parent, strtod(buffer, &bufptr)); + break; + + case MXML_TEXT : + node = mxmlNewText(parent, whitespace, buffer); + break; + + case MXML_CUSTOM : + if (global->custom_load_cb) + { + /* + * Use the callback to fill in the custom data... + */ + + node = mxmlNewCustom(parent, NULL, NULL); + + if ((*global->custom_load_cb)(node, buffer)) + { + mxml_error("Bad custom value '%s' in parent <%s>!", + buffer, parent ? parent->value.element.name : "null"); + mxmlDelete(node); + node = NULL; + } + break; + } + + default : /* Ignore... */ + node = NULL; + break; + } + + if (*bufptr) + { + /* + * Bad integer/real number value... + */ + + mxml_error("Bad %s value '%s' in parent <%s>!", + type == MXML_INTEGER ? "integer" : "real", buffer, + parent ? parent->value.element.name : "null"); + break; + } + + bufptr = buffer; + whitespace = mxml_isspace(ch) && type == MXML_TEXT; + + if (!node && type != MXML_IGNORE) + { + /* + * Print error and return... + */ + + mxml_error("Unable to add value node of type %s to parent <%s>!", + types[type], parent ? parent->value.element.name : "null"); + goto error; + } + + if (sax_cb) + { + (*sax_cb)(node, MXML_SAX_DATA, sax_data); + + if (!mxmlRelease(node)) + node = NULL; + } + + if (!first && node) + first = node; + } + else if (mxml_isspace(ch) && type == MXML_TEXT) + whitespace = 1; + + /* + * Add lone whitespace node if we have an element and existing + * whitespace... + */ + + if (ch == '<' && whitespace && type == MXML_TEXT) + { + node = mxmlNewText(parent, whitespace, ""); + + if (sax_cb) + { + (*sax_cb)(node, MXML_SAX_DATA, sax_data); + + if (!mxmlRelease(node)) + node = NULL; + } + + if (!first && node) + first = node; + + whitespace = 0; + } + + if (ch == '<') + { + /* + * Start of open/close tag... + */ + + bufptr = buffer; + + while ((ch = (*getc_cb)(p, &encoding)) != EOF) + if (mxml_isspace(ch) || ch == '>' || (ch == '/' && bufptr > buffer)) + break; + else if (ch == '<') + { + mxml_error("Bare < in element!"); + goto error; + } + else if (ch == '&') + { + if ((ch = mxml_get_entity(parent, p, &encoding, getc_cb)) == EOF) + goto error; + + if (mxml_add_char(ch, &bufptr, &buffer, &bufsize)) + goto error; + } + else if (mxml_add_char(ch, &bufptr, &buffer, &bufsize)) + goto error; + else if (((bufptr - buffer) == 1 && buffer[0] == '?') || + ((bufptr - buffer) == 3 && !strncmp(buffer, "!--", 3)) || + ((bufptr - buffer) == 8 && !strncmp(buffer, "![CDATA[", 8))) + break; + + *bufptr = '\0'; + + if (!strcmp(buffer, "!--")) + { + /* + * Gather rest of comment... + */ + + while ((ch = (*getc_cb)(p, &encoding)) != EOF) + { + if (ch == '>' && bufptr > (buffer + 4) && + bufptr[-3] != '-' && bufptr[-2] == '-' && bufptr[-1] == '-') + break; + else if (mxml_add_char(ch, &bufptr, &buffer, &bufsize)) + goto error; + } + + /* + * Error out if we didn't get the whole comment... + */ + + if (ch != '>') + { + /* + * Print error and return... + */ + + mxml_error("Early EOF in comment node!"); + goto error; + } + + + /* + * Otherwise add this as an element under the current parent... + */ + + *bufptr = '\0'; + + if ((node = mxmlNewElement(parent, buffer)) == NULL) + { + /* + * Just print error for now... + */ + + mxml_error("Unable to add comment node to parent <%s>!", + parent ? parent->value.element.name : "null"); + break; + } + + if (sax_cb) + { + (*sax_cb)(node, MXML_SAX_COMMENT, sax_data); + + if (!mxmlRelease(node)) + node = NULL; + } + + if (node && !first) + first = node; + } + else if (!strcmp(buffer, "![CDATA[")) + { + /* + * Gather CDATA section... + */ + + while ((ch = (*getc_cb)(p, &encoding)) != EOF) + { + if (ch == '>' && !strncmp(bufptr - 2, "]]", 2)) + break; + else if (mxml_add_char(ch, &bufptr, &buffer, &bufsize)) + goto error; + } + + /* + * Error out if we didn't get the whole comment... + */ + + if (ch != '>') + { + /* + * Print error and return... + */ + + mxml_error("Early EOF in CDATA node!"); + goto error; + } + + + /* + * Otherwise add this as an element under the current parent... + */ + + *bufptr = '\0'; + + if ((node = mxmlNewElement(parent, buffer)) == NULL) + { + /* + * Print error and return... + */ + + mxml_error("Unable to add CDATA node to parent <%s>!", + parent ? parent->value.element.name : "null"); + goto error; + } + + if (sax_cb) + { + (*sax_cb)(node, MXML_SAX_CDATA, sax_data); + + if (!mxmlRelease(node)) + node = NULL; + } + + if (node && !first) + first = node; + } + else if (buffer[0] == '?') + { + /* + * Gather rest of processing instruction... + */ + + while ((ch = (*getc_cb)(p, &encoding)) != EOF) + { + if (ch == '>' && bufptr > buffer && bufptr[-1] == '?') + break; + else if (mxml_add_char(ch, &bufptr, &buffer, &bufsize)) + goto error; + } + + /* + * Error out if we didn't get the whole processing instruction... + */ + + if (ch != '>') + { + /* + * Print error and return... + */ + + mxml_error("Early EOF in processing instruction node!"); + goto error; + } + + /* + * Otherwise add this as an element under the current parent... + */ + + *bufptr = '\0'; + + if ((node = mxmlNewElement(parent, buffer)) == NULL) + { + /* + * Print error and return... + */ + + mxml_error("Unable to add processing instruction node to parent <%s>!", + parent ? parent->value.element.name : "null"); + goto error; + } + + if (sax_cb) + { + (*sax_cb)(node, MXML_SAX_DIRECTIVE, sax_data); + + if (!mxmlRelease(node)) + node = NULL; + } + + if (node) + { + if (!first) + first = node; + + if (!parent) + { + parent = node; + + if (cb) + type = (*cb)(parent); + } + } + } + else if (buffer[0] == '!') + { + /* + * Gather rest of declaration... + */ + + do + { + if (ch == '>') + break; + else + { + if (ch == '&') + if ((ch = mxml_get_entity(parent, p, &encoding, getc_cb)) == EOF) + goto error; + + if (mxml_add_char(ch, &bufptr, &buffer, &bufsize)) + goto error; + } + } + while ((ch = (*getc_cb)(p, &encoding)) != EOF); + + /* + * Error out if we didn't get the whole declaration... + */ + + if (ch != '>') + { + /* + * Print error and return... + */ + + mxml_error("Early EOF in declaration node!"); + goto error; + } + + /* + * Otherwise add this as an element under the current parent... + */ + + *bufptr = '\0'; + + if ((node = mxmlNewElement(parent, buffer)) == NULL) + { + /* + * Print error and return... + */ + + mxml_error("Unable to add declaration node to parent <%s>!", + parent ? parent->value.element.name : "null"); + goto error; + } + + if (sax_cb) + { + (*sax_cb)(node, MXML_SAX_DIRECTIVE, sax_data); + + if (!mxmlRelease(node)) + node = NULL; + } + + if (node) + { + if (!first) + first = node; + + if (!parent) + { + parent = node; + + if (cb) + type = (*cb)(parent); + } + } + } + else if (buffer[0] == '/') + { + /* + * Handle close tag... + */ + + if (!parent || strcmp(buffer + 1, parent->value.element.name)) + { + /* + * Close tag doesn't match tree; print an error for now... + */ + + mxml_error("Mismatched close tag <%s> under parent <%s>!", + buffer, parent ? parent->value.element.name : "(null)"); + goto error; + } + + /* + * Keep reading until we see >... + */ + + while (ch != '>' && ch != EOF) + ch = (*getc_cb)(p, &encoding); + + node = parent; + parent = parent->parent; + + if (sax_cb) + { + (*sax_cb)(node, MXML_SAX_ELEMENT_CLOSE, sax_data); + + mxmlRelease(node); + } + + /* + * Ascend into the parent and set the value type as needed... + */ + + if (cb && parent) + type = (*cb)(parent); + } + else + { + /* + * Handle open tag... + */ + + if ((node = mxmlNewElement(parent, buffer)) == NULL) + { + /* + * Just print error for now... + */ + + mxml_error("Unable to add element node to parent <%s>!", + parent ? parent->value.element.name : "null"); + goto error; + } + + if (mxml_isspace(ch)) + { + if ((ch = mxml_parse_element(node, p, &encoding, getc_cb)) == EOF) + goto error; + } + else if (ch == '/') + { + if ((ch = (*getc_cb)(p, &encoding)) != '>') + { + mxml_error("Expected > but got '%c' instead for element <%s/>!", + ch, buffer); + mxmlDelete(node); + goto error; + } + + ch = '/'; + } + + if (sax_cb) + (*sax_cb)(node, MXML_SAX_ELEMENT_OPEN, sax_data); + + if (!first) + first = node; + + if (ch == EOF) + break; + + if (ch != '/') + { + /* + * Descend into this node, setting the value type as needed... + */ + + parent = node; + + if (cb && parent) + type = (*cb)(parent); + } + else if (sax_cb) + { + (*sax_cb)(node, MXML_SAX_ELEMENT_CLOSE, sax_data); + + if (!mxmlRelease(node) && first == node) + first = NULL; + } + } + + bufptr = buffer; + } + else if (ch == '&') + { + /* + * Add character entity to current buffer... + */ + + if ((ch = mxml_get_entity(parent, p, &encoding, getc_cb)) == EOF) + goto error; + + if (mxml_add_char(ch, &bufptr, &buffer, &bufsize)) + goto error; + } + else if (type == MXML_OPAQUE || type == MXML_CUSTOM || !mxml_isspace(ch)) + { + /* + * Add character to current buffer... + */ + + if (mxml_add_char(ch, &bufptr, &buffer, &bufsize)) + goto error; + } + } + + /* + * Free the string buffer - we don't need it anymore... + */ + + free(buffer); + + /* + * Find the top element and return it... + */ + + if (parent) + { + node = parent; + + while (parent->parent != top && parent->parent) + parent = parent->parent; + + if (node != parent) + { + mxml_error("Missing close tag under parent <%s>!", + node->value.element.name, + node->parent ? node->parent->value.element.name : "(null)"); + + mxmlDelete(first); + + return (NULL); + } + } + + if (parent) + return (parent); + else + return (first); + + /* + * Common error return... + */ + +error: + + mxmlDelete(first); + + free(buffer); + + return (NULL); +} + + +/* + * 'mxml_parse_element()' - Parse an element for any attributes... + */ + +static int /* O - Terminating character */ +mxml_parse_element( + mxml_node_t *node, /* I - Element node */ + void *p, /* I - Data to read from */ + int *encoding, /* IO - Encoding */ + _mxml_getc_cb_t getc_cb) /* I - Data callback */ +{ + int ch, /* Current character in file */ + quote; /* Quoting character */ + char *name, /* Attribute name */ + *value, /* Attribute value */ + *ptr; /* Pointer into name/value */ + int namesize, /* Size of name string */ + valsize; /* Size of value string */ + + + /* + * Initialize the name and value buffers... + */ + + if ((name = malloc(64)) == NULL) + { + mxml_error("Unable to allocate memory for name!"); + return (EOF); + } + + namesize = 64; + + if ((value = malloc(64)) == NULL) + { + free(name); + mxml_error("Unable to allocate memory for value!"); + return (EOF); + } + + valsize = 64; + + /* + * Loop until we hit a >, /, ?, or EOF... + */ + + while ((ch = (*getc_cb)(p, encoding)) != EOF) + { +#if DEBUG > 1 + fprintf(stderr, "parse_element: ch='%c'\n", ch); +#endif /* DEBUG > 1 */ + + /* + * Skip leading whitespace... + */ + + if (mxml_isspace(ch)) + continue; + + /* + * Stop at /, ?, or >... + */ + + if (ch == '/' || ch == '?') + { + /* + * Grab the > character and print an error if it isn't there... + */ + + quote = (*getc_cb)(p, encoding); + + if (quote != '>') + { + mxml_error("Expected '>' after '%c' for element %s, but got '%c'!", + ch, node->value.element.name, quote); + goto error; + } + + break; + } + else if (ch == '<') + { + mxml_error("Bare < in element %s!", node->value.element.name); + goto error; + } + else if (ch == '>') + break; + + /* + * Read the attribute name... + */ + + name[0] = ch; + ptr = name + 1; + + if (ch == '\"' || ch == '\'') + { + /* + * Name is in quotes, so get a quoted string... + */ + + quote = ch; + + while ((ch = (*getc_cb)(p, encoding)) != EOF) + { + if (ch == '&') + if ((ch = mxml_get_entity(node, p, encoding, getc_cb)) == EOF) + goto error; + + if (mxml_add_char(ch, &ptr, &name, &namesize)) + goto error; + + if (ch == quote) + break; + } + } + else + { + /* + * Grab an normal, non-quoted name... + */ + + while ((ch = (*getc_cb)(p, encoding)) != EOF) + if (mxml_isspace(ch) || ch == '=' || ch == '/' || ch == '>' || + ch == '?') + break; + else + { + if (ch == '&') + if ((ch = mxml_get_entity(node, p, encoding, getc_cb)) == EOF) + goto error; + + if (mxml_add_char(ch, &ptr, &name, &namesize)) + goto error; + } + } + + *ptr = '\0'; + + if (mxmlElementGetAttr(node, name)) + goto error; + + while (ch != EOF && mxml_isspace(ch)) + ch = (*getc_cb)(p, encoding); + + if (ch == '=') + { + /* + * Read the attribute value... + */ + + while ((ch = (*getc_cb)(p, encoding)) != EOF && mxml_isspace(ch)); + + if (ch == EOF) + { + mxml_error("Missing value for attribute '%s' in element %s!", + name, node->value.element.name); + goto error; + } + + if (ch == '\'' || ch == '\"') + { + /* + * Read quoted value... + */ + + quote = ch; + ptr = value; + + while ((ch = (*getc_cb)(p, encoding)) != EOF) + if (ch == quote) + break; + else + { + if (ch == '&') + if ((ch = mxml_get_entity(node, p, encoding, getc_cb)) == EOF) + goto error; + + if (mxml_add_char(ch, &ptr, &value, &valsize)) + goto error; + } + + *ptr = '\0'; + } + else + { + /* + * Read unquoted value... + */ + + value[0] = ch; + ptr = value + 1; + + while ((ch = (*getc_cb)(p, encoding)) != EOF) + if (mxml_isspace(ch) || ch == '=' || ch == '/' || ch == '>') + break; + else + { + if (ch == '&') + if ((ch = mxml_get_entity(node, p, encoding, getc_cb)) == EOF) + goto error; + + if (mxml_add_char(ch, &ptr, &value, &valsize)) + goto error; + } + + *ptr = '\0'; + } + + /* + * Set the attribute with the given string value... + */ + + mxmlElementSetAttr(node, name, value); + } + else + { + mxml_error("Missing value for attribute '%s' in element %s!", + name, node->value.element.name); + goto error; + } + + /* + * Check the end character... + */ + + if (ch == '/' || ch == '?') + { + /* + * Grab the > character and print an error if it isn't there... + */ + + quote = (*getc_cb)(p, encoding); + + if (quote != '>') + { + mxml_error("Expected '>' after '%c' for element %s, but got '%c'!", + ch, node->value.element.name, quote); + ch = EOF; + } + + break; + } + else if (ch == '>') + break; + } + + /* + * Free the name and value buffers and return... + */ + + free(name); + free(value); + + return (ch); + + /* + * Common error return point... + */ + +error: + + free(name); + free(value); + + return (EOF); +} + + +/* + * 'mxml_string_getc()' - Get a character from a string. + */ + +static int /* O - Character or EOF */ +mxml_string_getc(void *p, /* I - Pointer to file */ + int *encoding) /* IO - Encoding */ +{ + int ch; /* Character */ + const char **s; /* Pointer to string pointer */ + + + s = (const char **)p; + + if ((ch = (*s)[0] & 255) != 0 || *encoding == ENCODE_UTF16LE) + { + /* + * Got character; convert UTF-8 to integer and return... + */ + + (*s)++; + + switch (*encoding) + { + case ENCODE_UTF8 : + if (!(ch & 0x80)) + { +#if DEBUG > 1 + printf("mxml_string_getc: %c (0x%04x)\n", ch < ' ' ? '.' : ch, ch); +#endif /* DEBUG > 1 */ + + if (mxml_bad_char(ch)) + { + mxml_error("Bad control character 0x%02x not allowed by XML standard!", + ch); + return (EOF); + } + + return (ch); + } + else if (ch == 0xfe) + { + /* + * UTF-16 big-endian BOM? + */ + + if (((*s)[0] & 255) != 0xff) + return (EOF); + + *encoding = ENCODE_UTF16BE; + (*s)++; + + return (mxml_string_getc(p, encoding)); + } + else if (ch == 0xff) + { + /* + * UTF-16 little-endian BOM? + */ + + if (((*s)[0] & 255) != 0xfe) + return (EOF); + + *encoding = ENCODE_UTF16LE; + (*s)++; + + return (mxml_string_getc(p, encoding)); + } + else if ((ch & 0xe0) == 0xc0) + { + /* + * Two-byte value... + */ + + if (((*s)[0] & 0xc0) != 0x80) + return (EOF); + + ch = ((ch & 0x1f) << 6) | ((*s)[0] & 0x3f); + + (*s)++; + + if (ch < 0x80) + { + mxml_error("Invalid UTF-8 sequence for character 0x%04x!", ch); + return (EOF); + } + +#if DEBUG > 1 + printf("mxml_string_getc: %c (0x%04x)\n", ch < ' ' ? '.' : ch, ch); +#endif /* DEBUG > 1 */ + + return (ch); + } + else if ((ch & 0xf0) == 0xe0) + { + /* + * Three-byte value... + */ + + if (((*s)[0] & 0xc0) != 0x80 || + ((*s)[1] & 0xc0) != 0x80) + return (EOF); + + ch = ((((ch & 0x0f) << 6) | ((*s)[0] & 0x3f)) << 6) | ((*s)[1] & 0x3f); + + (*s) += 2; + + if (ch < 0x800) + { + mxml_error("Invalid UTF-8 sequence for character 0x%04x!", ch); + return (EOF); + } + + /* + * Ignore (strip) Byte Order Mark (BOM)... + */ + + if (ch == 0xfeff) + return (mxml_string_getc(p, encoding)); + +#if DEBUG > 1 + printf("mxml_string_getc: %c (0x%04x)\n", ch < ' ' ? '.' : ch, ch); +#endif /* DEBUG > 1 */ + + return (ch); + } + else if ((ch & 0xf8) == 0xf0) + { + /* + * Four-byte value... + */ + + if (((*s)[0] & 0xc0) != 0x80 || + ((*s)[1] & 0xc0) != 0x80 || + ((*s)[2] & 0xc0) != 0x80) + return (EOF); + + ch = ((((((ch & 0x07) << 6) | ((*s)[0] & 0x3f)) << 6) | + ((*s)[1] & 0x3f)) << 6) | ((*s)[2] & 0x3f); + + (*s) += 3; + + if (ch < 0x10000) + { + mxml_error("Invalid UTF-8 sequence for character 0x%04x!", ch); + return (EOF); + } + +#if DEBUG > 1 + printf("mxml_string_getc: %c (0x%04x)\n", ch < ' ' ? '.' : ch, ch); +#endif /* DEBUG > 1 */ + + return (ch); + } + else + return (EOF); + + case ENCODE_UTF16BE : + /* + * Read UTF-16 big-endian char... + */ + + ch = (ch << 8) | ((*s)[0] & 255); + (*s) ++; + + if (mxml_bad_char(ch)) + { + mxml_error("Bad control character 0x%02x not allowed by XML standard!", + ch); + return (EOF); + } + else if (ch >= 0xd800 && ch <= 0xdbff) + { + /* + * Multi-word UTF-16 char... + */ + + int lch; /* Lower word */ + + + if (!(*s)[0]) + return (EOF); + + lch = (((*s)[0] & 255) << 8) | ((*s)[1] & 255); + (*s) += 2; + + if (lch < 0xdc00 || lch >= 0xdfff) + return (EOF); + + ch = (((ch & 0x3ff) << 10) | (lch & 0x3ff)) + 0x10000; + } + +#if DEBUG > 1 + printf("mxml_string_getc: %c (0x%04x)\n", ch < ' ' ? '.' : ch, ch); +#endif /* DEBUG > 1 */ + + return (ch); + + case ENCODE_UTF16LE : + /* + * Read UTF-16 little-endian char... + */ + + ch = ch | (((*s)[0] & 255) << 8); + + if (!ch) + { + (*s) --; + return (EOF); + } + + (*s) ++; + + if (mxml_bad_char(ch)) + { + mxml_error("Bad control character 0x%02x not allowed by XML standard!", + ch); + return (EOF); + } + else if (ch >= 0xd800 && ch <= 0xdbff) + { + /* + * Multi-word UTF-16 char... + */ + + int lch; /* Lower word */ + + + if (!(*s)[1]) + return (EOF); + + lch = (((*s)[1] & 255) << 8) | ((*s)[0] & 255); + (*s) += 2; + + if (lch < 0xdc00 || lch >= 0xdfff) + return (EOF); + + ch = (((ch & 0x3ff) << 10) | (lch & 0x3ff)) + 0x10000; + } + +#if DEBUG > 1 + printf("mxml_string_getc: %c (0x%04x)\n", ch < ' ' ? '.' : ch, ch); +#endif /* DEBUG > 1 */ + + return (ch); + } + } + + return (EOF); +} + + +/* + * 'mxml_string_putc()' - Write a character to a string. + */ + +static int /* O - 0 on success, -1 on failure */ +mxml_string_putc(int ch, /* I - Character to write */ + void *p) /* I - Pointer to string pointers */ +{ + char **pp; /* Pointer to string pointers */ + + + pp = (char **)p; + + if (pp[0] < pp[1]) + pp[0][0] = ch; + + pp[0] ++; + + return (0); +} + + +/* + * 'mxml_write_name()' - Write a name string. + */ + +static int /* O - 0 on success, -1 on failure */ +mxml_write_name(const char *s, /* I - Name to write */ + void *p, /* I - Write pointer */ + int (*putc_cb)(int, void *)) + /* I - Write callback */ +{ + char quote; /* Quote character */ + const char *name; /* Entity name */ + + + if (*s == '\"' || *s == '\'') + { + /* + * Write a quoted name string... + */ + + if ((*putc_cb)(*s, p) < 0) + return (-1); + + quote = *s++; + + while (*s && *s != quote) + { + if ((name = mxmlEntityGetName(*s)) != NULL) + { + if ((*putc_cb)('&', p) < 0) + return (-1); + + while (*name) + { + if ((*putc_cb)(*name, p) < 0) + return (-1); + + name ++; + } + + if ((*putc_cb)(';', p) < 0) + return (-1); + } + else if ((*putc_cb)(*s, p) < 0) + return (-1); + + s ++; + } + + /* + * Write the end quote... + */ + + if ((*putc_cb)(quote, p) < 0) + return (-1); + } + else + { + /* + * Write a non-quoted name string... + */ + + while (*s) + { + if ((*putc_cb)(*s, p) < 0) + return (-1); + + s ++; + } + } + + return (0); +} + + +/* + * 'mxml_write_node()' - Save an XML node to a file. + */ + +static int /* O - Column or -1 on error */ +mxml_write_node(mxml_node_t *node, /* I - Node to write */ + void *p, /* I - File to write to */ + mxml_save_cb_t cb, /* I - Whitespace callback */ + int col, /* I - Current column */ + _mxml_putc_cb_t putc_cb,/* I - Output callback */ + _mxml_global_t *global)/* I - Global data */ +{ + int i, /* Looping var */ + width; /* Width of attr + value */ + mxml_attr_t *attr; /* Current attribute */ + char s[255]; /* Temporary string */ + + + while (node != NULL) + { + /* + * Print the node value... + */ + + switch (node->type) + { + case MXML_ELEMENT : + col = mxml_write_ws(node, p, cb, MXML_WS_BEFORE_OPEN, col, putc_cb); + + if ((*putc_cb)('<', p) < 0) + return (-1); + if (node->value.element.name[0] == '?' || + !strncmp(node->value.element.name, "!--", 3) || + !strncmp(node->value.element.name, "![CDATA[", 8)) + { + /* + * Comments, CDATA, and processing instructions do not + * use character entities. + */ + + const char *ptr; /* Pointer into name */ + + + for (ptr = node->value.element.name; *ptr; ptr ++) + if ((*putc_cb)(*ptr, p) < 0) + return (-1); + } + else if (mxml_write_name(node->value.element.name, p, putc_cb) < 0) + return (-1); + + col += strlen(node->value.element.name) + 1; + + for (i = node->value.element.num_attrs, attr = node->value.element.attrs; + i > 0; + i --, attr ++) + { + width = strlen(attr->name); + + if (attr->value) + width += strlen(attr->value) + 3; + + if (global->wrap > 0 && (col + width) > global->wrap) + { + if ((*putc_cb)('\n', p) < 0) + return (-1); + + col = 0; + } + else + { + if ((*putc_cb)(' ', p) < 0) + return (-1); + + col ++; + } + + if (mxml_write_name(attr->name, p, putc_cb) < 0) + return (-1); + + if (attr->value) + { + if ((*putc_cb)('=', p) < 0) + return (-1); + if ((*putc_cb)('\"', p) < 0) + return (-1); + if (mxml_write_string(attr->value, p, putc_cb) < 0) + return (-1); + if ((*putc_cb)('\"', p) < 0) + return (-1); + } + + col += width; + } + + if (node->child) + { + /* + * Write children... + */ + + if ((*putc_cb)('>', p) < 0) + return (-1); + else + col ++; + + col = mxml_write_ws(node, p, cb, MXML_WS_AFTER_OPEN, col, putc_cb); + + if ((col = mxml_write_node(node->child, p, cb, col, putc_cb, + global)) < 0) + return (-1); + + /* + * The ? and ! elements are special-cases and have no end tags... + */ + + if (node->value.element.name[0] != '!' && + node->value.element.name[0] != '?') + { + col = mxml_write_ws(node, p, cb, MXML_WS_BEFORE_CLOSE, col, putc_cb); + + if ((*putc_cb)('<', p) < 0) + return (-1); + if ((*putc_cb)('/', p) < 0) + return (-1); + if (mxml_write_string(node->value.element.name, p, putc_cb) < 0) + return (-1); + if ((*putc_cb)('>', p) < 0) + return (-1); + + col += strlen(node->value.element.name) + 3; + + col = mxml_write_ws(node, p, cb, MXML_WS_AFTER_CLOSE, col, putc_cb); + } + } + else if (node->value.element.name[0] == '!' || + node->value.element.name[0] == '?') + { + /* + * The ? and ! elements are special-cases... + */ + + if ((*putc_cb)('>', p) < 0) + return (-1); + else + col ++; + + col = mxml_write_ws(node, p, cb, MXML_WS_AFTER_OPEN, col, putc_cb); + } + else + { + if ((*putc_cb)(' ', p) < 0) + return (-1); + if ((*putc_cb)('/', p) < 0) + return (-1); + if ((*putc_cb)('>', p) < 0) + return (-1); + + col += 3; + + col = mxml_write_ws(node, p, cb, MXML_WS_AFTER_OPEN, col, putc_cb); + } + break; + + case MXML_INTEGER : + if (node->prev) + { + if (global->wrap > 0 && col > global->wrap) + { + if ((*putc_cb)('\n', p) < 0) + return (-1); + + col = 0; + } + else if ((*putc_cb)(' ', p) < 0) + return (-1); + else + col ++; + } + + sprintf(s, "%d", node->value.integer); + if (mxml_write_string(s, p, putc_cb) < 0) + return (-1); + + col += strlen(s); + break; + + case MXML_OPAQUE : + if (mxml_write_string(node->value.opaque, p, putc_cb) < 0) + return (-1); + + col += strlen(node->value.opaque); + break; + + case MXML_REAL : + if (node->prev) + { + if (global->wrap > 0 && col > global->wrap) + { + if ((*putc_cb)('\n', p) < 0) + return (-1); + + col = 0; + } + else if ((*putc_cb)(' ', p) < 0) + return (-1); + else + col ++; + } + + sprintf(s, "%f", node->value.real); + if (mxml_write_string(s, p, putc_cb) < 0) + return (-1); + + col += strlen(s); + break; + + case MXML_TEXT : + if (node->value.text.whitespace && col > 0) + { + if (global->wrap > 0 && col > global->wrap) + { + if ((*putc_cb)('\n', p) < 0) + return (-1); + + col = 0; + } + else if ((*putc_cb)(' ', p) < 0) + return (-1); + else + col ++; + } + + if (mxml_write_string(node->value.text.string, p, putc_cb) < 0) + return (-1); + + col += strlen(node->value.text.string); + break; + + case MXML_CUSTOM : + if (global->custom_save_cb) + { + char *data; /* Custom data string */ + const char *newline; /* Last newline in string */ + + + if ((data = (*global->custom_save_cb)(node)) == NULL) + return (-1); + + if (mxml_write_string(data, p, putc_cb) < 0) + return (-1); + + if ((newline = strrchr(data, '\n')) == NULL) + col += strlen(data); + else + col = strlen(newline); + + free(data); + break; + } + + default : /* Should never happen */ + return (-1); + } + + /* + * Next node... + */ + + node = node->next; + } + + return (col); +} + + +/* + * 'mxml_write_string()' - Write a string, escaping & and < as needed. + */ + +static int /* O - 0 on success, -1 on failure */ +mxml_write_string( + const char *s, /* I - String to write */ + void *p, /* I - Write pointer */ + _mxml_putc_cb_t putc_cb) /* I - Write callback */ +{ + const char *name; /* Entity name, if any */ + + + while (*s) + { + if ((name = mxmlEntityGetName(*s)) != NULL) + { + if ((*putc_cb)('&', p) < 0) + return (-1); + + while (*name) + { + if ((*putc_cb)(*name, p) < 0) + return (-1); + name ++; + } + + if ((*putc_cb)(';', p) < 0) + return (-1); + } + else if ((*putc_cb)(*s, p) < 0) + return (-1); + + s ++; + } + + return (0); +} + + +/* + * 'mxml_write_ws()' - Do whitespace callback... + */ + +static int /* O - New column */ +mxml_write_ws(mxml_node_t *node, /* I - Current node */ + void *p, /* I - Write pointer */ + mxml_save_cb_t cb, /* I - Callback function */ + int ws, /* I - Where value */ + int col, /* I - Current column */ + _mxml_putc_cb_t putc_cb) /* I - Write callback */ +{ + const char *s; /* Whitespace string */ + + + if (cb && (s = (*cb)(node, ws)) != NULL) + { + while (*s) + { + if ((*putc_cb)(*s, p) < 0) + return (-1); + else if (*s == '\n') + col = 0; + else if (*s == '\t') + { + col += MXML_TAB; + col = col - (col % MXML_TAB); + } + else + col ++; + + s ++; + } + } + + return (col); +} + + +/* + * End of "$Id: mxml-file.c 391 2009-05-17 05:20:52Z mike $". + */ diff -Naur mxml-2.6/mxml-index.c mxml-2.6-haiku/mxml-index.c --- mxml-2.6/mxml-index.c 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/mxml-index.c 2005-01-29 07:21:44.000000000 +0000 @@ -0,0 +1,649 @@ +/* + * "$Id: mxml-index.c 184 2005-01-29 07:21:44Z mike $" + * + * Index support code for Mini-XML, a small XML-like file parsing library. + * + * Copyright 2003-2005 by Michael Sweet. + * + * This program is free software; you can redistribute it and/or + * modify it under the terms of the GNU Library General Public + * License as published by the Free Software Foundation; either + * version 2, or (at your option) any later version. + * + * This program is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU General Public License for more details. + * + * Contents: + * + * mxmlIndexDelete() - Delete an index. + * mxmlIndexEnum() - Return the next node in the index. + * mxmlIndexFind() - Find the next matching node. + * mxmlIndexNew() - Create a new index. + * mxmlIndexReset() - Reset the enumeration/find pointer in the index and + * return the first node in the index. + * index_compare() - Compare two nodes. + * index_find() - Compare a node with index values. + * index_sort() - Sort the nodes in the index... + */ + +/* + * Include necessary headers... + */ + +#include "config.h" +#include "mxml.h" + + +/* + * Sort functions... + */ + +static int index_compare(mxml_index_t *ind, mxml_node_t *first, + mxml_node_t *second); +static int index_find(mxml_index_t *ind, const char *element, + const char *value, mxml_node_t *node); +static void index_sort(mxml_index_t *ind, int left, int right); + + +/* + * 'mxmlIndexDelete()' - Delete an index. + */ + +void +mxmlIndexDelete(mxml_index_t *ind) /* I - Index to delete */ +{ + /* + * Range check input.. + */ + + if (!ind) + return; + + /* + * Free memory... + */ + + if (ind->attr) + free(ind->attr); + + if (ind->alloc_nodes) + free(ind->nodes); + + free(ind); +} + + +/* + * 'mxmlIndexEnum()' - Return the next node in the index. + * + * Nodes are returned in the sorted order of the index. + */ + +mxml_node_t * /* O - Next node or NULL if there is none */ +mxmlIndexEnum(mxml_index_t *ind) /* I - Index to enumerate */ +{ + /* + * Range check input... + */ + + if (!ind) + return (NULL); + + /* + * Return the next node... + */ + + if (ind->cur_node < ind->num_nodes) + return (ind->nodes[ind->cur_node ++]); + else + return (NULL); +} + + +/* + * 'mxmlIndexFind()' - Find the next matching node. + * + * You should call mxmlIndexReset() prior to using this function for + * the first time with a particular set of "element" and "value" + * strings. Passing NULL for both "element" and "value" is equivalent + * to calling mxmlIndexEnum(). + */ + +mxml_node_t * /* O - Node or NULL if none found */ +mxmlIndexFind(mxml_index_t *ind, /* I - Index to search */ + const char *element, /* I - Element name to find, if any */ + const char *value) /* I - Attribute value, if any */ +{ + int diff, /* Difference between names */ + current, /* Current entity in search */ + first, /* First entity in search */ + last; /* Last entity in search */ + + +#ifdef DEBUG + printf("mxmlIndexFind(ind=%p, element=\"%s\", value=\"%s\")\n", + ind, element ? element : "(null)", value ? value : "(null)"); +#endif /* DEBUG */ + + /* + * Range check input... + */ + + if (!ind || (!ind->attr && value)) + { +#ifdef DEBUG + puts(" returning NULL..."); + printf(" ind->attr=\"%s\"\n", ind->attr ? ind->attr : "(null)"); +#endif /* DEBUG */ + + return (NULL); + } + + /* + * If both element and value are NULL, just enumerate the nodes in the + * index... + */ + + if (!element && !value) + return (mxmlIndexEnum(ind)); + + /* + * If there are no nodes in the index, return NULL... + */ + + if (!ind->num_nodes) + { +#ifdef DEBUG + puts(" returning NULL..."); + puts(" no nodes!"); +#endif /* DEBUG */ + + return (NULL); + } + + /* + * If cur_node == 0, then find the first matching node... + */ + + if (ind->cur_node == 0) + { + /* + * Find the first node using a modified binary search algorithm... + */ + + first = 0; + last = ind->num_nodes - 1; + +#ifdef DEBUG + printf(" find first time, num_nodes=%d...\n", ind->num_nodes); +#endif /* DEBUG */ + + while ((last - first) > 1) + { + current = (first + last) / 2; + +#ifdef DEBUG + printf(" first=%d, last=%d, current=%d\n", first, last, current); +#endif /* DEBUG */ + + if ((diff = index_find(ind, element, value, ind->nodes[current])) == 0) + { + /* + * Found a match, move back to find the first... + */ + +#ifdef DEBUG + puts(" match!"); +#endif /* DEBUG */ + + while (current > 0 && + !index_find(ind, element, value, ind->nodes[current - 1])) + current --; + +#ifdef DEBUG + printf(" returning first match=%d\n", current); +#endif /* DEBUG */ + + /* + * Return the first match and save the index to the next... + */ + + ind->cur_node = current + 1; + + return (ind->nodes[current]); + } + else if (diff < 0) + last = current; + else + first = current; + +#ifdef DEBUG + printf(" diff=%d\n", diff); +#endif /* DEBUG */ + } + + /* + * If we get this far, then we found exactly 0 or 1 matches... + */ + + for (current = first; current <= last; current ++) + if (!index_find(ind, element, value, ind->nodes[current])) + { + /* + * Found exactly one (or possibly two) match... + */ + +#ifdef DEBUG + printf(" returning only match %d...\n", current); +#endif /* DEBUG */ + + ind->cur_node = current + 1; + + return (ind->nodes[current]); + } + + /* + * No matches... + */ + + ind->cur_node = ind->num_nodes; + +#ifdef DEBUG + puts(" returning NULL..."); +#endif /* DEBUG */ + + return (NULL); + } + else if (ind->cur_node < ind->num_nodes && + !index_find(ind, element, value, ind->nodes[ind->cur_node])) + { + /* + * Return the next matching node... + */ + +#ifdef DEBUG + printf(" returning next match %d...\n", ind->cur_node); +#endif /* DEBUG */ + + return (ind->nodes[ind->cur_node ++]); + } + + /* + * If we get this far, then we have no matches... + */ + + ind->cur_node = ind->num_nodes; + +#ifdef DEBUG + puts(" returning NULL..."); +#endif /* DEBUG */ + + return (NULL); +} + + +/* + * 'mxmlIndexNew()' - Create a new index. + * + * The index will contain all nodes that contain the named element and/or + * attribute. If both "element" and "attr" are NULL, then the index will + * contain a sorted list of the elements in the node tree. Nodes are + * sorted by element name and optionally by attribute value if the "attr" + * argument is not NULL. + */ + +mxml_index_t * /* O - New index */ +mxmlIndexNew(mxml_node_t *node, /* I - XML node tree */ + const char *element, /* I - Element to index or NULL for all */ + const char *attr) /* I - Attribute to index or NULL for none */ +{ + mxml_index_t *ind; /* New index */ + mxml_node_t *current, /* Current node in index */ + **temp; /* Temporary node pointer array */ + + + /* + * Range check input... + */ + +#ifdef DEBUG + printf("mxmlIndexNew(node=%p, element=\"%s\", attr=\"%s\")\n", + node, element ? element : "(null)", attr ? attr : "(null)"); +#endif /* DEBUG */ + + if (!node) + return (NULL); + + /* + * Create a new index... + */ + + if ((ind = calloc(1, sizeof(mxml_index_t))) == NULL) + { + mxml_error("Unable to allocate %d bytes for index - %s", + sizeof(mxml_index_t), strerror(errno)); + return (NULL); + } + + if (attr) + ind->attr = strdup(attr); + + if (!element && !attr) + current = node; + else + current = mxmlFindElement(node, node, element, attr, NULL, MXML_DESCEND); + + while (current) + { + if (ind->num_nodes >= ind->alloc_nodes) + { + if (!ind->alloc_nodes) + temp = malloc(64 * sizeof(mxml_node_t *)); + else + temp = realloc(ind->nodes, (ind->alloc_nodes + 64) * sizeof(mxml_node_t *)); + + if (!temp) + { + /* + * Unable to allocate memory for the index, so abort... + */ + + mxml_error("Unable to allocate %d bytes for index: %s", + (ind->alloc_nodes + 64) * sizeof(mxml_node_t *), + strerror(errno)); + + mxmlIndexDelete(ind); + return (NULL); + } + + ind->nodes = temp; + ind->alloc_nodes += 64; + } + + ind->nodes[ind->num_nodes ++] = current; + + current = mxmlFindElement(current, node, element, attr, NULL, MXML_DESCEND); + } + + /* + * Sort nodes based upon the search criteria... + */ + +#ifdef DEBUG + { + int i; /* Looping var */ + + + printf("%d node(s) in index.\n\n", ind->num_nodes); + + if (attr) + { + printf("Node Address Element %s\n", attr); + puts("-------- -------- -------------- ------------------------------"); + + for (i = 0; i < ind->num_nodes; i ++) + printf("%8d %-8p %-14.14s %s\n", i, ind->nodes[i], + ind->nodes[i]->value.element.name, + mxmlElementGetAttr(ind->nodes[i], attr)); + } + else + { + puts("Node Address Element"); + puts("-------- -------- --------------"); + + for (i = 0; i < ind->num_nodes; i ++) + printf("%8d %-8p %s\n", i, ind->nodes[i], + ind->nodes[i]->value.element.name); + } + + putchar('\n'); + } +#endif /* DEBUG */ + + if (ind->num_nodes > 1) + index_sort(ind, 0, ind->num_nodes - 1); + +#ifdef DEBUG + { + int i; /* Looping var */ + + + puts("After sorting:\n"); + + if (attr) + { + printf("Node Address Element %s\n", attr); + puts("-------- -------- -------------- ------------------------------"); + + for (i = 0; i < ind->num_nodes; i ++) + printf("%8d %-8p %-14.14s %s\n", i, ind->nodes[i], + ind->nodes[i]->value.element.name, + mxmlElementGetAttr(ind->nodes[i], attr)); + } + else + { + puts("Node Address Element"); + puts("-------- -------- --------------"); + + for (i = 0; i < ind->num_nodes; i ++) + printf("%8d %-8p %s\n", i, ind->nodes[i], + ind->nodes[i]->value.element.name); + } + + putchar('\n'); + } +#endif /* DEBUG */ + + /* + * Return the new index... + */ + + return (ind); +} + + +/* + * 'mxmlIndexReset()' - Reset the enumeration/find pointer in the index and + * return the first node in the index. + * + * This function should be called prior to using mxmlIndexEnum() or + * mxmlIndexFind() for the first time. + */ + +mxml_node_t * /* O - First node or NULL if there is none */ +mxmlIndexReset(mxml_index_t *ind) /* I - Index to reset */ +{ +#ifdef DEBUG + printf("mxmlIndexReset(ind=%p)\n", ind); +#endif /* DEBUG */ + + /* + * Range check input... + */ + + if (!ind) + return (NULL); + + /* + * Set the index to the first element... + */ + + ind->cur_node = 0; + + /* + * Return the first node... + */ + + if (ind->num_nodes) + return (ind->nodes[0]); + else + return (NULL); +} + + +/* + * 'index_compare()' - Compare two nodes. + */ + +static int /* O - Result of comparison */ +index_compare(mxml_index_t *ind, /* I - Index */ + mxml_node_t *first, /* I - First node */ + mxml_node_t *second) /* I - Second node */ +{ + int diff; /* Difference */ + + + /* + * Check the element name... + */ + + if ((diff = strcmp(first->value.element.name, + second->value.element.name)) != 0) + return (diff); + + /* + * Check the attribute value... + */ + + if (ind->attr) + { + if ((diff = strcmp(mxmlElementGetAttr(first, ind->attr), + mxmlElementGetAttr(second, ind->attr))) != 0) + return (diff); + } + + /* + * No difference, return 0... + */ + + return (0); +} + + +/* + * 'index_find()' - Compare a node with index values. + */ + +static int /* O - Result of comparison */ +index_find(mxml_index_t *ind, /* I - Index */ + const char *element, /* I - Element name or NULL */ + const char *value, /* I - Attribute value or NULL */ + mxml_node_t *node) /* I - Node */ +{ + int diff; /* Difference */ + + + /* + * Check the element name... + */ + + if (element) + { + if ((diff = strcmp(element, node->value.element.name)) != 0) + return (diff); + } + + /* + * Check the attribute value... + */ + + if (value) + { + if ((diff = strcmp(value, mxmlElementGetAttr(node, ind->attr))) != 0) + return (diff); + } + + /* + * No difference, return 0... + */ + + return (0); +} + + +/* + * 'index_sort()' - Sort the nodes in the index... + * + * This function implements the classic quicksort algorithm... + */ + +static void +index_sort(mxml_index_t *ind, /* I - Index to sort */ + int left, /* I - Left node in partition */ + int right) /* I - Right node in partition */ +{ + mxml_node_t *pivot, /* Pivot node */ + *temp; /* Swap node */ + int templ, /* Temporary left node */ + tempr; /* Temporary right node */ + + + /* + * Loop until we have sorted all the way to the right... + */ + + do + { + /* + * Sort the pivot in the current partition... + */ + + pivot = ind->nodes[left]; + + for (templ = left, tempr = right; templ < tempr;) + { + /* + * Move left while left node <= pivot node... + */ + + while ((templ < right) && + index_compare(ind, ind->nodes[templ], pivot) <= 0) + templ ++; + + /* + * Move right while right node > pivot node... + */ + + while ((tempr > left) && + index_compare(ind, ind->nodes[tempr], pivot) > 0) + tempr --; + + /* + * Swap nodes if needed... + */ + + if (templ < tempr) + { + temp = ind->nodes[templ]; + ind->nodes[templ] = ind->nodes[tempr]; + ind->nodes[tempr] = temp; + } + } + + /* + * When we get here, the right (tempr) node is the new position for the + * pivot node... + */ + + if (index_compare(ind, pivot, ind->nodes[tempr]) > 0) + { + ind->nodes[left] = ind->nodes[tempr]; + ind->nodes[tempr] = pivot; + } + + /* + * Recursively sort the left partition as needed... + */ + + if (left < (tempr - 1)) + index_sort(ind, left, tempr - 1); + } + while (right > (left = tempr + 1)); +} + + +/* + * End of "$Id: mxml-index.c 184 2005-01-29 07:21:44Z mike $". + */ diff -Naur mxml-2.6/mxml-node.c mxml-2.6-haiku/mxml-node.c --- mxml-2.6/mxml-node.c 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/mxml-node.c 2008-10-26 18:28:05.000000000 +0000 @@ -0,0 +1,780 @@ +/* + * "$Id: mxml-node.c 363 2008-10-26 18:28:05Z mike $" + * + * Node support code for Mini-XML, a small XML-like file parsing library. + * + * Copyright 2003-2007 by Michael Sweet. + * + * This program is free software; you can redistribute it and/or + * modify it under the terms of the GNU Library General Public + * License as published by the Free Software Foundation; either + * version 2, or (at your option) any later version. + * + * This program is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU General Public License for more details. + * + * Contents: + * + * mxmlAdd() - Add a node to a tree. + * mxmlDelete() - Delete a node and all of its children. + * mxmlNewCDATA() - Create a new CDATA node. + * mxmlNewCustom() - Create a new custom data node. + * mxmlNewElement() - Create a new element node. + * mxmlNewInteger() - Create a new integer node. + * mxmlNewOpaque() - Create a new opaque string. + * mxmlNewReal() - Create a new real number node. + * mxmlNewText() - Create a new text fragment node. + * mxmlNewTextf() - Create a new formatted text fragment node. + * mxmlNewXML() - Create a new XML document tree. + * mxmlRelease() - Release a node. + * mxmlRemove() - Remove a node from its parent. + * mxmlRetain() - Retain a node. + * mxml_new() - Create a new node. + */ + +/* + * Include necessary headers... + */ + +#include "config.h" +#include "mxml.h" + + +/* + * Local functions... + */ + +static mxml_node_t *mxml_new(mxml_node_t *parent, mxml_type_t type); + + +/* + * 'mxmlAdd()' - Add a node to a tree. + * + * Adds the specified node to the parent. If the child argument is not + * NULL, puts the new node before or after the specified child depending + * on the value of the where argument. If the child argument is NULL, + * puts the new node at the beginning of the child list (MXML_ADD_BEFORE) + * or at the end of the child list (MXML_ADD_AFTER). The constant + * MXML_ADD_TO_PARENT can be used to specify a NULL child pointer. + */ + +void +mxmlAdd(mxml_node_t *parent, /* I - Parent node */ + int where, /* I - Where to add, MXML_ADD_BEFORE or MXML_ADD_AFTER */ + mxml_node_t *child, /* I - Child node for where or MXML_ADD_TO_PARENT */ + mxml_node_t *node) /* I - Node to add */ +{ +#ifdef DEBUG + fprintf(stderr, "mxmlAdd(parent=%p, where=%d, child=%p, node=%p)\n", parent, + where, child, node); +#endif /* DEBUG */ + + /* + * Range check input... + */ + + if (!parent || !node) + return; + +#if DEBUG > 1 + fprintf(stderr, " BEFORE: node->parent=%p\n", node->parent); + if (parent) + { + fprintf(stderr, " BEFORE: parent->child=%p\n", parent->child); + fprintf(stderr, " BEFORE: parent->last_child=%p\n", parent->last_child); + fprintf(stderr, " BEFORE: parent->prev=%p\n", parent->prev); + fprintf(stderr, " BEFORE: parent->next=%p\n", parent->next); + } +#endif /* DEBUG > 1 */ + + /* + * Remove the node from any existing parent... + */ + + if (node->parent) + mxmlRemove(node); + + /* + * Reset pointers... + */ + + node->parent = parent; + + switch (where) + { + case MXML_ADD_BEFORE : + if (!child || child == parent->child || child->parent != parent) + { + /* + * Insert as first node under parent... + */ + + node->next = parent->child; + + if (parent->child) + parent->child->prev = node; + else + parent->last_child = node; + + parent->child = node; + } + else + { + /* + * Insert node before this child... + */ + + node->next = child; + node->prev = child->prev; + + if (child->prev) + child->prev->next = node; + else + parent->child = node; + + child->prev = node; + } + break; + + case MXML_ADD_AFTER : + if (!child || child == parent->last_child || child->parent != parent) + { + /* + * Insert as last node under parent... + */ + + node->parent = parent; + node->prev = parent->last_child; + + if (parent->last_child) + parent->last_child->next = node; + else + parent->child = node; + + parent->last_child = node; + } + else + { + /* + * Insert node after this child... + */ + + node->prev = child; + node->next = child->next; + + if (child->next) + child->next->prev = node; + else + parent->last_child = node; + + child->next = node; + } + break; + } + +#if DEBUG > 1 + fprintf(stderr, " AFTER: node->parent=%p\n", node->parent); + if (parent) + { + fprintf(stderr, " AFTER: parent->child=%p\n", parent->child); + fprintf(stderr, " AFTER: parent->last_child=%p\n", parent->last_child); + fprintf(stderr, " AFTER: parent->prev=%p\n", parent->prev); + fprintf(stderr, " AFTER: parent->next=%p\n", parent->next); + } +#endif /* DEBUG > 1 */ +} + + +/* + * 'mxmlDelete()' - Delete a node and all of its children. + * + * If the specified node has a parent, this function first removes the + * node from its parent using the mxmlRemove() function. + */ + +void +mxmlDelete(mxml_node_t *node) /* I - Node to delete */ +{ + int i; /* Looping var */ + + +#ifdef DEBUG + fprintf(stderr, "mxmlDelete(node=%p)\n", node); +#endif /* DEBUG */ + + /* + * Range check input... + */ + + if (!node) + return; + + /* + * Remove the node from its parent, if any... + */ + + mxmlRemove(node); + + /* + * Delete children... + */ + + while (node->child) + mxmlDelete(node->child); + + /* + * Now delete any node data... + */ + + switch (node->type) + { + case MXML_ELEMENT : + if (node->value.element.name) + free(node->value.element.name); + + if (node->value.element.num_attrs) + { + for (i = 0; i < node->value.element.num_attrs; i ++) + { + if (node->value.element.attrs[i].name) + free(node->value.element.attrs[i].name); + if (node->value.element.attrs[i].value) + free(node->value.element.attrs[i].value); + } + + free(node->value.element.attrs); + } + break; + case MXML_INTEGER : + /* Nothing to do */ + break; + case MXML_OPAQUE : + if (node->value.opaque) + free(node->value.opaque); + break; + case MXML_REAL : + /* Nothing to do */ + break; + case MXML_TEXT : + if (node->value.text.string) + free(node->value.text.string); + break; + case MXML_CUSTOM : + if (node->value.custom.data && + node->value.custom.destroy) + (*(node->value.custom.destroy))(node->value.custom.data); + break; + default : + break; + } + + /* + * Free this node... + */ + + free(node); +} + + +/* + * 'mxmlNewCDATA()' - Create a new CDATA node. + * + * The new CDATA node is added to the end of the specified parent's child + * list. The constant MXML_NO_PARENT can be used to specify that the new + * CDATA node has no parent. The data string must be nul-terminated and + * is copied into the new node. CDATA nodes use the MXML_ELEMENT type. + * + * @since Mini-XML 2.3@ + */ + +mxml_node_t * /* O - New node */ +mxmlNewCDATA(mxml_node_t *parent, /* I - Parent node or MXML_NO_PARENT */ + const char *data) /* I - Data string */ +{ + mxml_node_t *node; /* New node */ + + +#ifdef DEBUG + fprintf(stderr, "mxmlNewCDATA(parent=%p, data=\"%s\")\n", + parent, data ? data : "(null)"); +#endif /* DEBUG */ + + /* + * Range check input... + */ + + if (!data) + return (NULL); + + /* + * Create the node and set the name value... + */ + + if ((node = mxml_new(parent, MXML_ELEMENT)) != NULL) + node->value.element.name = _mxml_strdupf("![CDATA[%s]]", data); + + return (node); +} + + +/* + * 'mxmlNewCustom()' - Create a new custom data node. + * + * The new custom node is added to the end of the specified parent's child + * list. The constant MXML_NO_PARENT can be used to specify that the new + * element node has no parent. NULL can be passed when the data in the + * node is not dynamically allocated or is separately managed. + * + * @since Mini-XML 2.1@ + */ + +mxml_node_t * /* O - New node */ +mxmlNewCustom( + mxml_node_t *parent, /* I - Parent node or MXML_NO_PARENT */ + void *data, /* I - Pointer to data */ + mxml_custom_destroy_cb_t destroy) /* I - Function to destroy data */ +{ + mxml_node_t *node; /* New node */ + + +#ifdef DEBUG + fprintf(stderr, "mxmlNewCustom(parent=%p, data=%p, destroy=%p)\n", parent, + data, destroy); +#endif /* DEBUG */ + + /* + * Create the node and set the value... + */ + + if ((node = mxml_new(parent, MXML_CUSTOM)) != NULL) + { + node->value.custom.data = data; + node->value.custom.destroy = destroy; + } + + return (node); +} + + +/* + * 'mxmlNewElement()' - Create a new element node. + * + * The new element node is added to the end of the specified parent's child + * list. The constant MXML_NO_PARENT can be used to specify that the new + * element node has no parent. + */ + +mxml_node_t * /* O - New node */ +mxmlNewElement(mxml_node_t *parent, /* I - Parent node or MXML_NO_PARENT */ + const char *name) /* I - Name of element */ +{ + mxml_node_t *node; /* New node */ + + +#ifdef DEBUG + fprintf(stderr, "mxmlNewElement(parent=%p, name=\"%s\")\n", parent, + name ? name : "(null)"); +#endif /* DEBUG */ + + /* + * Range check input... + */ + + if (!name) + return (NULL); + + /* + * Create the node and set the element name... + */ + + if ((node = mxml_new(parent, MXML_ELEMENT)) != NULL) + node->value.element.name = strdup(name); + + return (node); +} + + +/* + * 'mxmlNewInteger()' - Create a new integer node. + * + * The new integer node is added to the end of the specified parent's child + * list. The constant MXML_NO_PARENT can be used to specify that the new + * integer node has no parent. + */ + +mxml_node_t * /* O - New node */ +mxmlNewInteger(mxml_node_t *parent, /* I - Parent node or MXML_NO_PARENT */ + int integer) /* I - Integer value */ +{ + mxml_node_t *node; /* New node */ + + +#ifdef DEBUG + fprintf(stderr, "mxmlNewInteger(parent=%p, integer=%d)\n", parent, integer); +#endif /* DEBUG */ + + /* + * Create the node and set the element name... + */ + + if ((node = mxml_new(parent, MXML_INTEGER)) != NULL) + node->value.integer = integer; + + return (node); +} + + +/* + * 'mxmlNewOpaque()' - Create a new opaque string. + * + * The new opaque node is added to the end of the specified parent's child + * list. The constant MXML_NO_PARENT can be used to specify that the new + * opaque node has no parent. The opaque string must be nul-terminated and + * is copied into the new node. + */ + +mxml_node_t * /* O - New node */ +mxmlNewOpaque(mxml_node_t *parent, /* I - Parent node or MXML_NO_PARENT */ + const char *opaque) /* I - Opaque string */ +{ + mxml_node_t *node; /* New node */ + + +#ifdef DEBUG + fprintf(stderr, "mxmlNewOpaque(parent=%p, opaque=\"%s\")\n", parent, + opaque ? opaque : "(null)"); +#endif /* DEBUG */ + + /* + * Range check input... + */ + + if (!opaque) + return (NULL); + + /* + * Create the node and set the element name... + */ + + if ((node = mxml_new(parent, MXML_OPAQUE)) != NULL) + node->value.opaque = strdup(opaque); + + return (node); +} + + +/* + * 'mxmlNewReal()' - Create a new real number node. + * + * The new real number node is added to the end of the specified parent's + * child list. The constant MXML_NO_PARENT can be used to specify that + * the new real number node has no parent. + */ + +mxml_node_t * /* O - New node */ +mxmlNewReal(mxml_node_t *parent, /* I - Parent node or MXML_NO_PARENT */ + double real) /* I - Real number value */ +{ + mxml_node_t *node; /* New node */ + + +#ifdef DEBUG + fprintf(stderr, "mxmlNewReal(parent=%p, real=%g)\n", parent, real); +#endif /* DEBUG */ + + /* + * Create the node and set the element name... + */ + + if ((node = mxml_new(parent, MXML_REAL)) != NULL) + node->value.real = real; + + return (node); +} + + +/* + * 'mxmlNewText()' - Create a new text fragment node. + * + * The new text node is added to the end of the specified parent's child + * list. The constant MXML_NO_PARENT can be used to specify that the new + * text node has no parent. The whitespace parameter is used to specify + * whether leading whitespace is present before the node. The text + * string must be nul-terminated and is copied into the new node. + */ + +mxml_node_t * /* O - New node */ +mxmlNewText(mxml_node_t *parent, /* I - Parent node or MXML_NO_PARENT */ + int whitespace, /* I - 1 = leading whitespace, 0 = no whitespace */ + const char *string) /* I - String */ +{ + mxml_node_t *node; /* New node */ + + +#ifdef DEBUG + fprintf(stderr, "mxmlNewText(parent=%p, whitespace=%d, string=\"%s\")\n", + parent, whitespace, string ? string : "(null)"); +#endif /* DEBUG */ + + /* + * Range check input... + */ + + if (!string) + return (NULL); + + /* + * Create the node and set the text value... + */ + + if ((node = mxml_new(parent, MXML_TEXT)) != NULL) + { + node->value.text.whitespace = whitespace; + node->value.text.string = strdup(string); + } + + return (node); +} + + +/* + * 'mxmlNewTextf()' - Create a new formatted text fragment node. + * + * The new text node is added to the end of the specified parent's child + * list. The constant MXML_NO_PARENT can be used to specify that the new + * text node has no parent. The whitespace parameter is used to specify + * whether leading whitespace is present before the node. The format + * string must be nul-terminated and is formatted into the new node. + */ + +mxml_node_t * /* O - New node */ +mxmlNewTextf(mxml_node_t *parent, /* I - Parent node or MXML_NO_PARENT */ + int whitespace, /* I - 1 = leading whitespace, 0 = no whitespace */ + const char *format, /* I - Printf-style frmat string */ + ...) /* I - Additional args as needed */ +{ + mxml_node_t *node; /* New node */ + va_list ap; /* Pointer to arguments */ + + +#ifdef DEBUG + fprintf(stderr, "mxmlNewTextf(parent=%p, whitespace=%d, format=\"%s\", ...)\n", + parent, whitespace, format ? format : "(null)"); +#endif /* DEBUG */ + + /* + * Range check input... + */ + + if (!format) + return (NULL); + + /* + * Create the node and set the text value... + */ + + if ((node = mxml_new(parent, MXML_TEXT)) != NULL) + { + va_start(ap, format); + + node->value.text.whitespace = whitespace; + node->value.text.string = _mxml_vstrdupf(format, ap); + + va_end(ap); + } + + return (node); +} + + +/* + * 'mxmlRemove()' - Remove a node from its parent. + * + * Does not free memory used by the node - use mxmlDelete() for that. + * This function does nothing if the node has no parent. + */ + +void +mxmlRemove(mxml_node_t *node) /* I - Node to remove */ +{ +#ifdef DEBUG + fprintf(stderr, "mxmlRemove(node=%p)\n", node); +#endif /* DEBUG */ + + /* + * Range check input... + */ + + if (!node || !node->parent) + return; + + /* + * Remove from parent... + */ + +#if DEBUG > 1 + fprintf(stderr, " BEFORE: node->parent=%p\n", node->parent); + if (node->parent) + { + fprintf(stderr, " BEFORE: node->parent->child=%p\n", node->parent->child); + fprintf(stderr, " BEFORE: node->parent->last_child=%p\n", node->parent->last_child); + } + fprintf(stderr, " BEFORE: node->child=%p\n", node->child); + fprintf(stderr, " BEFORE: node->last_child=%p\n", node->last_child); + fprintf(stderr, " BEFORE: node->prev=%p\n", node->prev); + fprintf(stderr, " BEFORE: node->next=%p\n", node->next); +#endif /* DEBUG > 1 */ + + if (node->prev) + node->prev->next = node->next; + else + node->parent->child = node->next; + + if (node->next) + node->next->prev = node->prev; + else + node->parent->last_child = node->prev; + + node->parent = NULL; + node->prev = NULL; + node->next = NULL; + +#if DEBUG > 1 + fprintf(stderr, " AFTER: node->parent=%p\n", node->parent); + if (node->parent) + { + fprintf(stderr, " AFTER: node->parent->child=%p\n", node->parent->child); + fprintf(stderr, " AFTER: node->parent->last_child=%p\n", node->parent->last_child); + } + fprintf(stderr, " AFTER: node->child=%p\n", node->child); + fprintf(stderr, " AFTER: node->last_child=%p\n", node->last_child); + fprintf(stderr, " AFTER: node->prev=%p\n", node->prev); + fprintf(stderr, " AFTER: node->next=%p\n", node->next); +#endif /* DEBUG > 1 */ +} + + +/* + * 'mxmlNewXML()' - Create a new XML document tree. + * + * The "version" argument specifies the version number to put in the + * ?xml element node. If NULL, version 1.0 is assumed. + * + * @since Mini-XML 2.3@ + */ + +mxml_node_t * /* O - New ?xml node */ +mxmlNewXML(const char *version) /* I - Version number to use */ +{ + char element[1024]; /* Element text */ + + + snprintf(element, sizeof(element), "?xml version=\"%s\" encoding=\"utf-8\"?", + version ? version : "1.0"); + + return (mxmlNewElement(NULL, element)); +} + + +/* + * 'mxmlRelease()' - Release a node. + * + * When the reference count reaches zero, the node (and any children) + * is deleted via mxmlDelete(). + * + * @since Mini-XML 2.3@ + */ + +int /* O - New reference count */ +mxmlRelease(mxml_node_t *node) /* I - Node */ +{ + if (node) + { + if ((-- node->ref_count) <= 0) + { + mxmlDelete(node); + return (0); + } + else + return (node->ref_count); + } + else + return (-1); +} + + +/* + * 'mxmlRetain()' - Retain a node. + * + * @since Mini-XML 2.3@ + */ + +int /* O - New reference count */ +mxmlRetain(mxml_node_t *node) /* I - Node */ +{ + if (node) + return (++ node->ref_count); + else + return (-1); +} + + +/* + * 'mxml_new()' - Create a new node. + */ + +static mxml_node_t * /* O - New node */ +mxml_new(mxml_node_t *parent, /* I - Parent node */ + mxml_type_t type) /* I - Node type */ +{ + mxml_node_t *node; /* New node */ + + +#if DEBUG > 1 + fprintf(stderr, "mxml_new(parent=%p, type=%d)\n", parent, type); +#endif /* DEBUG > 1 */ + + /* + * Allocate memory for the node... + */ + + if ((node = calloc(1, sizeof(mxml_node_t))) == NULL) + { +#if DEBUG > 1 + fputs(" returning NULL\n", stderr); +#endif /* DEBUG > 1 */ + + return (NULL); + } + +#if DEBUG > 1 + fprintf(stderr, " returning %p\n", node); +#endif /* DEBUG > 1 */ + + /* + * Set the node type... + */ + + node->type = type; + node->ref_count = 1; + + /* + * Add to the parent if present... + */ + + if (parent) + mxmlAdd(parent, MXML_ADD_AFTER, MXML_ADD_TO_PARENT, node); + + /* + * Return the new node... + */ + + return (node); +} + + +/* + * End of "$Id: mxml-node.c 363 2008-10-26 18:28:05Z mike $". + */ diff -Naur mxml-2.6/mxml-private.c mxml-2.6-haiku/mxml-private.c --- mxml-2.6/mxml-private.c 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/mxml-private.c 2007-11-22 18:01:52.000000000 +0000 @@ -0,0 +1,285 @@ +/* + * "$Id: mxml-private.c 315 2007-11-22 18:01:52Z mike $" + * + * Private functions for Mini-XML, a small XML-like file parsing library. + * + * Copyright 2003-2007 by Michael Sweet. + * + * This program is free software; you can redistribute it and/or + * modify it under the terms of the GNU Library General Public + * License as published by the Free Software Foundation; either + * version 2, or (at your option) any later version. + * + * This program is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU General Public License for more details. + * + * Contents: + * + * mxml_error() - Display an error message. + * mxml_integer_cb() - Default callback for integer values. + * mxml_opaque_cb() - Default callback for opaque values. + * mxml_real_cb() - Default callback for real number values. + * _mxml_global() - Get global data. + */ + +/* + * Include necessary headers... + */ + +#include "mxml-private.h" + + +/* + * 'mxml_error()' - Display an error message. + */ + +void +mxml_error(const char *format, /* I - Printf-style format string */ + ...) /* I - Additional arguments as needed */ +{ + va_list ap; /* Pointer to arguments */ + char s[1024]; /* Message string */ + _mxml_global_t *global = _mxml_global(); + /* Global data */ + + + /* + * Range check input... + */ + + if (!format) + return; + + /* + * Format the error message string... + */ + + va_start(ap, format); + + vsnprintf(s, sizeof(s), format, ap); + + va_end(ap); + + /* + * And then display the error message... + */ + + if (global->error_cb) + (*global->error_cb)(s); + else + fprintf(stderr, "mxml: %s\n", s); +} + + +/* + * 'mxml_ignore_cb()' - Default callback for ignored values. + */ + +mxml_type_t /* O - Node type */ +mxml_ignore_cb(mxml_node_t *node) /* I - Current node */ +{ + (void)node; + + return (MXML_IGNORE); +} + + +/* + * 'mxml_integer_cb()' - Default callback for integer values. + */ + +mxml_type_t /* O - Node type */ +mxml_integer_cb(mxml_node_t *node) /* I - Current node */ +{ + (void)node; + + return (MXML_INTEGER); +} + + +/* + * 'mxml_opaque_cb()' - Default callback for opaque values. + */ + +mxml_type_t /* O - Node type */ +mxml_opaque_cb(mxml_node_t *node) /* I - Current node */ +{ + (void)node; + + return (MXML_OPAQUE); +} + + +/* + * 'mxml_real_cb()' - Default callback for real number values. + */ + +mxml_type_t /* O - Node type */ +mxml_real_cb(mxml_node_t *node) /* I - Current node */ +{ + (void)node; + + return (MXML_REAL); +} + + +#ifdef HAVE_PTHREAD_H /**** POSIX threading ****/ +# include + +static pthread_key_t _mxml_key = -1; /* Thread local storage key */ +static pthread_once_t _mxml_key_once = PTHREAD_ONCE_INIT; + /* One-time initialization object */ +static void _mxml_init(void); +static void _mxml_destructor(void *g); + + +/* + * '_mxml_global()' - Get global data. + */ + +_mxml_global_t * /* O - Global data */ +_mxml_global(void) +{ + _mxml_global_t *global; /* Global data */ + + + pthread_once(&_mxml_key_once, _mxml_init); + + if ((global = (_mxml_global_t *)pthread_getspecific(_mxml_key)) == NULL) + { + global = (_mxml_global_t *)calloc(1, sizeof(_mxml_global_t)); + pthread_setspecific(_mxml_key, global); + + global->num_entity_cbs = 1; + global->entity_cbs[0] = _mxml_entity_cb; + global->wrap = 72; + } + + return (global); +} + + +/* + * '_mxml_init()' - Initialize global data... + */ + +static void +_mxml_init(void) +{ + pthread_key_create(&_mxml_key, _mxml_destructor); +} + + +/* + * '_mxml_destructor()' - Free memory used for globals... + */ + +static void +_mxml_destructor(void *g) /* I - Global data */ +{ + free(g); +} + + +#elif defined(WIN32) /**** WIN32 threading ****/ +# include + +static DWORD _mxml_tls_index; /* Index for global storage */ + + +/* + * 'DllMain()' - Main entry for library. + */ + +BOOL WINAPI /* O - Success/failure */ +DllMain(HINSTANCE hinst, /* I - DLL module handle */ + DWORD reason, /* I - Reason */ + LPVOID reserved) /* I - Unused */ +{ + _mxml_global_t *global; /* Global data */ + + + (void)hinst; + (void)reserved; + + switch (reason) + { + case DLL_PROCESS_ATTACH : /* Called on library initialization */ + if ((_mxml_tls_index = TlsAlloc()) == TLS_OUT_OF_INDEXES) + return (FALSE); + break; + + case DLL_THREAD_DETACH : /* Called when a thread terminates */ + if ((global = (_mxml_global_t *)TlsGetValue(_mxml_tls_index)) != NULL) + free(global); + break; + + case DLL_PROCESS_DETACH : /* Called when library is unloaded */ + if ((global = (_mxml_global_t *)TlsGetValue(_mxml_tls_index)) != NULL) + free(global); + + TlsFree(_mxml_tls_index); + break; + + default: + break; + } + + return (TRUE); +} + + +/* + * '_mxml_global()' - Get global data. + */ + +_mxml_global_t * /* O - Global data */ +_mxml_global(void) +{ + _mxml_global_t *global; /* Global data */ + + + if ((global = (_mxml_global_t *)TlsGetValue(_mxml_tls_index)) == NULL) + { + global = (_mxml_global_t *)calloc(1, sizeof(_mxml_global_t)); + + global->num_entity_cbs = 1; + global->entity_cbs[0] = _mxml_entity_cb; + global->wrap = 72; + + TlsSetValue(_mxml_tls_index, (LPVOID)global); + } + + return (global); +} + + +#else /**** No threading ****/ +/* + * '_mxml_global()' - Get global data. + */ + +_mxml_global_t * /* O - Global data */ +_mxml_global(void) +{ + static _mxml_global_t global = /* Global data */ + { + NULL, /* error_cb */ + 1, /* num_entity_cbs */ + { _mxml_entity_cb }, /* entity_cbs */ + 72, /* wrap */ + NULL, /* custom_load_cb */ + NULL /* custom_save_cb */ + }; + + + return (&global); +} +#endif /* HAVE_PTHREAD_H */ + + +/* + * End of "$Id: mxml-private.c 315 2007-11-22 18:01:52Z mike $". + */ diff -Naur mxml-2.6/mxml-private.h mxml-2.6-haiku/mxml-private.h --- mxml-2.6/mxml-private.h 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/mxml-private.h 2007-09-21 04:46:02.000000000 +0000 @@ -0,0 +1,52 @@ +/* + * "$Id: mxml-private.h 309 2007-09-21 04:46:02Z mike $" + * + * Private definitions for Mini-XML, a small XML-like file parsing library. + * + * Copyright 2007 by Michael Sweet. + * + * This program is free software; you can redistribute it and/or + * modify it under the terms of the GNU Library General Public + * License as published by the Free Software Foundation; either + * version 2, or (at your option) any later version. + * + * This program is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU General Public License for more details. + */ + +/* + * Include necessary headers... + */ + +#include "config.h" +#include "mxml.h" + + +/* + * Global, per-thread data... + */ + +typedef struct _mxml_global_s +{ + void (*error_cb)(const char *); + int num_entity_cbs; + int (*entity_cbs[100])(const char *name); + int wrap; + mxml_custom_load_cb_t custom_load_cb; + mxml_custom_save_cb_t custom_save_cb; +} _mxml_global_t; + + +/* + * Functions... + */ + +extern _mxml_global_t *_mxml_global(void); +extern int _mxml_entity_cb(const char *name); + + +/* + * End of "$Id: mxml-private.h 309 2007-09-21 04:46:02Z mike $". + */ diff -Naur mxml-2.6/mxml-search.c mxml-2.6-haiku/mxml-search.c --- mxml-2.6/mxml-search.c 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/mxml-search.c 2007-09-09 07:16:52.000000000 +0000 @@ -0,0 +1,201 @@ +/* + * "$Id: mxml-search.c 297 2007-09-09 07:16:52Z mike $" + * + * Search/navigation functions for Mini-XML, a small XML-like file + * parsing library. + * + * Copyright 2003-2007 by Michael Sweet. + * + * This program is free software; you can redistribute it and/or + * modify it under the terms of the GNU Library General Public + * License as published by the Free Software Foundation; either + * version 2, or (at your option) any later version. + * + * This program is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU General Public License for more details. + * + * Contents: + * + * mxmlFindElement() - Find the named element. + * mxmlWalkNext() - Walk to the next logical node in the tree. + * mxmlWalkPrev() - Walk to the previous logical node in the tree. + */ + +/* + * Include necessary headers... + */ + +#include "config.h" +#include "mxml.h" + + +/* + * 'mxmlFindElement()' - Find the named element. + * + * The search is constrained by the name, attribute name, and value; any + * NULL names or values are treated as wildcards, so different kinds of + * searches can be implemented by looking for all elements of a given name + * or all elements with a specific attribute. The descend argument determines + * whether the search descends into child nodes; normally you will use + * MXML_DESCEND_FIRST for the initial search and MXML_NO_DESCEND to find + * additional direct descendents of the node. The top node argument + * constrains the search to a particular node's children. + */ + +mxml_node_t * /* O - Element node or NULL */ +mxmlFindElement(mxml_node_t *node, /* I - Current node */ + mxml_node_t *top, /* I - Top node */ + const char *name, /* I - Element name or NULL for any */ + const char *attr, /* I - Attribute name, or NULL for none */ + const char *value, /* I - Attribute value, or NULL for any */ + int descend) /* I - Descend into tree - MXML_DESCEND, MXML_NO_DESCEND, or MXML_DESCEND_FIRST */ +{ + const char *temp; /* Current attribute value */ + + + /* + * Range check input... + */ + + if (!node || !top || (!attr && value)) + return (NULL); + + /* + * Start with the next node... + */ + + node = mxmlWalkNext(node, top, descend); + + /* + * Loop until we find a matching element... + */ + + while (node != NULL) + { + /* + * See if this node matches... + */ + + if (node->type == MXML_ELEMENT && + node->value.element.name && + (!name || !strcmp(node->value.element.name, name))) + { + /* + * See if we need to check for an attribute... + */ + + if (!attr) + return (node); /* No attribute search, return it... */ + + /* + * Check for the attribute... + */ + + if ((temp = mxmlElementGetAttr(node, attr)) != NULL) + { + /* + * OK, we have the attribute, does it match? + */ + + if (!value || !strcmp(value, temp)) + return (node); /* Yes, return it... */ + } + } + + /* + * No match, move on to the next node... + */ + + if (descend == MXML_DESCEND) + node = mxmlWalkNext(node, top, MXML_DESCEND); + else + node = node->next; + } + + return (NULL); +} + + +/* + * 'mxmlWalkNext()' - Walk to the next logical node in the tree. + * + * The descend argument controls whether the first child is considered + * to be the next node. The top node argument constrains the walk to + * the node's children. + */ + +mxml_node_t * /* O - Next node or NULL */ +mxmlWalkNext(mxml_node_t *node, /* I - Current node */ + mxml_node_t *top, /* I - Top node */ + int descend) /* I - Descend into tree - MXML_DESCEND, MXML_NO_DESCEND, or MXML_DESCEND_FIRST */ +{ + if (!node) + return (NULL); + else if (node->child && descend) + return (node->child); + else if (node == top) + return (NULL); + else if (node->next) + return (node->next); + else if (node->parent && node->parent != top) + { + node = node->parent; + + while (!node->next) + if (node->parent == top || !node->parent) + return (NULL); + else + node = node->parent; + + return (node->next); + } + else + return (NULL); +} + + +/* + * 'mxmlWalkPrev()' - Walk to the previous logical node in the tree. + * + * The descend argument controls whether the previous node's last child + * is considered to be the previous node. The top node argument constrains + * the walk to the node's children. + */ + +mxml_node_t * /* O - Previous node or NULL */ +mxmlWalkPrev(mxml_node_t *node, /* I - Current node */ + mxml_node_t *top, /* I - Top node */ + int descend) /* I - Descend into tree - MXML_DESCEND, MXML_NO_DESCEND, or MXML_DESCEND_FIRST */ +{ + if (!node || node == top) + return (NULL); + else if (node->prev) + { + if (node->prev->last_child && descend) + { + /* + * Find the last child under the previous node... + */ + + node = node->prev->last_child; + + while (node->last_child) + node = node->last_child; + + return (node); + } + else + return (node->prev); + } + else if (node->parent != top) + return (node->parent); + else + return (NULL); +} + + +/* + * End of "$Id: mxml-search.c 297 2007-09-09 07:16:52Z mike $". + */ diff -Naur mxml-2.6/mxml-set.c mxml-2.6-haiku/mxml-set.c --- mxml-2.6/mxml-set.c 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/mxml-set.c 2007-04-23 21:48:03.000000000 +0000 @@ -0,0 +1,294 @@ +/* + * "$Id: mxml-set.c 270 2007-04-23 21:48:03Z mike $" + * + * Node set functions for Mini-XML, a small XML-like file parsing library. + * + * Copyright 2003-2007 by Michael Sweet. + * + * This program is free software; you can redistribute it and/or + * modify it under the terms of the GNU Library General Public + * License as published by the Free Software Foundation; either + * version 2, or (at your option) any later version. + * + * This program is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU General Public License for more details. + * + * Contents: + * + * mxmlSetCustom() - Set the data and destructor of a custom data node. + * mxmlSetCDATA() - Set the element name of a CDATA node. + * mxmlSetElement() - Set the name of an element node. + * mxmlSetInteger() - Set the value of an integer node. + * mxmlSetOpaque() - Set the value of an opaque node. + * mxmlSetReal() - Set the value of a real number node. + * mxmlSetText() - Set the value of a text node. + * mxmlSetTextf() - Set the value of a text node to a formatted string. + */ + +/* + * Include necessary headers... + */ + +#include "config.h" +#include "mxml.h" + + +/* + * 'mxmlSetCustom()' - Set the data and destructor of a custom data node. + * + * The node is not changed if it is not a custom node. + * + * @since Mini-XML 2.1@ + */ + +int /* O - 0 on success, -1 on failure */ +mxmlSetCustom( + mxml_node_t *node, /* I - Node to set */ + void *data, /* I - New data pointer */ + mxml_custom_destroy_cb_t destroy) /* I - New destructor function */ +{ + /* + * Range check input... + */ + + if (!node || node->type != MXML_CUSTOM) + return (-1); + + /* + * Free any old element value and set the new value... + */ + + if (node->value.custom.data && node->value.custom.destroy) + (*(node->value.custom.destroy))(node->value.custom.data); + + node->value.custom.data = data; + node->value.custom.destroy = destroy; + + return (0); +} + + +/* + * 'mxmlSetCDATA()' - Set the element name of a CDATA node. + * + * The node is not changed if it is not a CDATA element node. + * + * @since Mini-XML 2.3@ + */ + +int /* O - 0 on success, -1 on failure */ +mxmlSetCDATA(mxml_node_t *node, /* I - Node to set */ + const char *data) /* I - New data string */ +{ + /* + * Range check input... + */ + + if (!node || node->type != MXML_ELEMENT || !data || + strncmp(node->value.element.name, "![CDATA[", 8)) + return (-1); + + /* + * Free any old element value and set the new value... + */ + + if (node->value.element.name) + free(node->value.element.name); + + node->value.element.name = _mxml_strdupf("![CDATA[%s]]", data); + + return (0); +} + + +/* + * 'mxmlSetElement()' - Set the name of an element node. + * + * The node is not changed if it is not an element node. + */ + +int /* O - 0 on success, -1 on failure */ +mxmlSetElement(mxml_node_t *node, /* I - Node to set */ + const char *name) /* I - New name string */ +{ + /* + * Range check input... + */ + + if (!node || node->type != MXML_ELEMENT || !name) + return (-1); + + /* + * Free any old element value and set the new value... + */ + + if (node->value.element.name) + free(node->value.element.name); + + node->value.element.name = strdup(name); + + return (0); +} + + +/* + * 'mxmlSetInteger()' - Set the value of an integer node. + * + * The node is not changed if it is not an integer node. + */ + +int /* O - 0 on success, -1 on failure */ +mxmlSetInteger(mxml_node_t *node, /* I - Node to set */ + int integer) /* I - Integer value */ +{ + /* + * Range check input... + */ + + if (!node || node->type != MXML_INTEGER) + return (-1); + + /* + * Set the new value and return... + */ + + node->value.integer = integer; + + return (0); +} + + +/* + * 'mxmlSetOpaque()' - Set the value of an opaque node. + * + * The node is not changed if it is not an opaque node. + */ + +int /* O - 0 on success, -1 on failure */ +mxmlSetOpaque(mxml_node_t *node, /* I - Node to set */ + const char *opaque) /* I - Opaque string */ +{ + /* + * Range check input... + */ + + if (!node || node->type != MXML_OPAQUE || !opaque) + return (-1); + + /* + * Free any old opaque value and set the new value... + */ + + if (node->value.opaque) + free(node->value.opaque); + + node->value.opaque = strdup(opaque); + + return (0); +} + + +/* + * 'mxmlSetReal()' - Set the value of a real number node. + * + * The node is not changed if it is not a real number node. + */ + +int /* O - 0 on success, -1 on failure */ +mxmlSetReal(mxml_node_t *node, /* I - Node to set */ + double real) /* I - Real number value */ +{ + /* + * Range check input... + */ + + if (!node || node->type != MXML_REAL) + return (-1); + + /* + * Set the new value and return... + */ + + node->value.real = real; + + return (0); +} + + +/* + * 'mxmlSetText()' - Set the value of a text node. + * + * The node is not changed if it is not a text node. + */ + +int /* O - 0 on success, -1 on failure */ +mxmlSetText(mxml_node_t *node, /* I - Node to set */ + int whitespace, /* I - 1 = leading whitespace, 0 = no whitespace */ + const char *string) /* I - String */ +{ + /* + * Range check input... + */ + + if (!node || node->type != MXML_TEXT || !string) + return (-1); + + /* + * Free any old string value and set the new value... + */ + + if (node->value.text.string) + free(node->value.text.string); + + node->value.text.whitespace = whitespace; + node->value.text.string = strdup(string); + + return (0); +} + + +/* + * 'mxmlSetTextf()' - Set the value of a text node to a formatted string. + * + * The node is not changed if it is not a text node. + */ + +int /* O - 0 on success, -1 on failure */ +mxmlSetTextf(mxml_node_t *node, /* I - Node to set */ + int whitespace, /* I - 1 = leading whitespace, 0 = no whitespace */ + const char *format, /* I - Printf-style format string */ + ...) /* I - Additional arguments as needed */ +{ + va_list ap; /* Pointer to arguments */ + + + /* + * Range check input... + */ + + if (!node || node->type != MXML_TEXT || !format) + return (-1); + + /* + * Free any old string value and set the new value... + */ + + if (node->value.text.string) + free(node->value.text.string); + + va_start(ap, format); + + node->value.text.whitespace = whitespace; + node->value.text.string = _mxml_strdupf(format, ap); + + va_end(ap); + + return (0); +} + + +/* + * End of "$Id: mxml-set.c 270 2007-04-23 21:48:03Z mike $". + */ diff -Naur mxml-2.6/mxml-string.c mxml-2.6-haiku/mxml-string.c --- mxml-2.6/mxml-string.c 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/mxml-string.c 2009-04-18 17:05:52.000000000 +0000 @@ -0,0 +1,462 @@ +/* + * "$Id: mxml-string.c 387 2009-04-18 17:05:52Z mike $" + * + * String functions for Mini-XML, a small XML-like file parsing library. + * + * Copyright 2003-2009 by Michael Sweet. + * + * This program is free software; you can redistribute it and/or + * modify it under the terms of the GNU Library General Public + * License as published by the Free Software Foundation; either + * version 2, or (at your option) any later version. + * + * This program is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU General Public License for more details. + * + * Contents: + * + * _mxml_snprintf() - Format a string. + * _mxml_strdup() - Duplicate a string. + * _mxml_strdupf() - Format and duplicate a string. + * _mxml_vsnprintf() - Format a string into a fixed size buffer. + * _mxml_vstrdupf() - Format and duplicate a string. + */ + +/* + * Include necessary headers... + */ + +#include "config.h" + + +#ifndef HAVE_SNPRINTF +/* + * '_mxml_snprintf()' - Format a string. + */ + +int /* O - Number of bytes formatted */ +_mxml_snprintf(char *buffer, /* I - Output buffer */ + size_t bufsize, /* I - Size of output buffer */ + const char *format, /* I - Printf-style format string */ + ...) /* I - Additional arguments as needed */ +{ + va_list ap; /* Argument list */ + int bytes; /* Number of bytes formatted */ + + + va_start(ap, format); + bytes = vsnprintf(buffer, bufsize, format, ap); + va_end(ap); + + return (bytes); +} +#endif /* !HAVE_SNPRINTF */ + + +/* + * '_mxml_strdup()' - Duplicate a string. + */ + +#ifndef HAVE_STRDUP +char * /* O - New string pointer */ +_mxml_strdup(const char *s) /* I - String to duplicate */ +{ + char *t; /* New string pointer */ + + + if (s == NULL) + return (NULL); + + if ((t = malloc(strlen(s) + 1)) == NULL) + return (NULL); + + return (strcpy(t, s)); +} +#endif /* !HAVE_STRDUP */ + + +/* + * '_mxml_strdupf()' - Format and duplicate a string. + */ + +char * /* O - New string pointer */ +_mxml_strdupf(const char *format, /* I - Printf-style format string */ + ...) /* I - Additional arguments as needed */ +{ + va_list ap; /* Pointer to additional arguments */ + char *s; /* Pointer to formatted string */ + + + /* + * Get a pointer to the additional arguments, format the string, + * and return it... + */ + + va_start(ap, format); + s = _mxml_vstrdupf(format, ap); + va_end(ap); + + return (s); +} + + +#ifndef HAVE_VSNPRINTF +/* + * '_mxml_vsnprintf()' - Format a string into a fixed size buffer. + */ + +int /* O - Number of bytes formatted */ +_mxml_vsnprintf(char *buffer, /* O - Output buffer */ + size_t bufsize, /* O - Size of output buffer */ + const char *format, /* I - Printf-style format string */ + va_list ap) /* I - Pointer to additional arguments */ +{ + char *bufptr, /* Pointer to position in buffer */ + *bufend, /* Pointer to end of buffer */ + sign, /* Sign of format width */ + size, /* Size character (h, l, L) */ + type; /* Format type character */ + int width, /* Width of field */ + prec; /* Number of characters of precision */ + char tformat[100], /* Temporary format string for sprintf() */ + *tptr, /* Pointer into temporary format */ + temp[1024]; /* Buffer for formatted numbers */ + char *s; /* Pointer to string */ + int slen; /* Length of string */ + int bytes; /* Total number of bytes needed */ + + + /* + * Loop through the format string, formatting as needed... + */ + + bufptr = buffer; + bufend = buffer + bufsize - 1; + bytes = 0; + + while (*format) + { + if (*format == '%') + { + tptr = tformat; + *tptr++ = *format++; + + if (*format == '%') + { + if (bufptr && bufptr < bufend) *bufptr++ = *format; + bytes ++; + format ++; + continue; + } + else if (strchr(" -+#\'", *format)) + { + *tptr++ = *format; + sign = *format++; + } + else + sign = 0; + + if (*format == '*') + { + /* + * Get width from argument... + */ + + format ++; + width = va_arg(ap, int); + + snprintf(tptr, sizeof(tformat) - (tptr - tformat), "%d", width); + tptr += strlen(tptr); + } + else + { + width = 0; + + while (isdigit(*format & 255)) + { + if (tptr < (tformat + sizeof(tformat) - 1)) + *tptr++ = *format; + + width = width * 10 + *format++ - '0'; + } + } + + if (*format == '.') + { + if (tptr < (tformat + sizeof(tformat) - 1)) + *tptr++ = *format; + + format ++; + + if (*format == '*') + { + /* + * Get precision from argument... + */ + + format ++; + prec = va_arg(ap, int); + + snprintf(tptr, sizeof(tformat) - (tptr - tformat), "%d", prec); + tptr += strlen(tptr); + } + else + { + prec = 0; + + while (isdigit(*format & 255)) + { + if (tptr < (tformat + sizeof(tformat) - 1)) + *tptr++ = *format; + + prec = prec * 10 + *format++ - '0'; + } + } + } + else + prec = -1; + + if (*format == 'l' && format[1] == 'l') + { + size = 'L'; + + if (tptr < (tformat + sizeof(tformat) - 2)) + { + *tptr++ = 'l'; + *tptr++ = 'l'; + } + + format += 2; + } + else if (*format == 'h' || *format == 'l' || *format == 'L') + { + if (tptr < (tformat + sizeof(tformat) - 1)) + *tptr++ = *format; + + size = *format++; + } + + if (!*format) + break; + + if (tptr < (tformat + sizeof(tformat) - 1)) + *tptr++ = *format; + + type = *format++; + *tptr = '\0'; + + switch (type) + { + case 'E' : /* Floating point formats */ + case 'G' : + case 'e' : + case 'f' : + case 'g' : + if ((width + 2) > sizeof(temp)) + break; + + sprintf(temp, tformat, va_arg(ap, double)); + + bytes += strlen(temp); + + if (bufptr) + { + if ((bufptr + strlen(temp)) > bufend) + { + strncpy(bufptr, temp, (size_t)(bufend - bufptr)); + bufptr = bufend; + } + else + { + strcpy(bufptr, temp); + bufptr += strlen(temp); + } + } + break; + + case 'B' : /* Integer formats */ + case 'X' : + case 'b' : + case 'd' : + case 'i' : + case 'o' : + case 'u' : + case 'x' : + if ((width + 2) > sizeof(temp)) + break; + +#ifdef HAVE_LONG_LONG + if (size == 'L') + sprintf(temp, tformat, va_arg(ap, long long)); + else +#endif /* HAVE_LONG_LONG */ + sprintf(temp, tformat, va_arg(ap, int)); + + bytes += strlen(temp); + + if (bufptr) + { + if ((bufptr + strlen(temp)) > bufend) + { + strncpy(bufptr, temp, (size_t)(bufend - bufptr)); + bufptr = bufend; + } + else + { + strcpy(bufptr, temp); + bufptr += strlen(temp); + } + } + break; + + case 'p' : /* Pointer value */ + if ((width + 2) > sizeof(temp)) + break; + + sprintf(temp, tformat, va_arg(ap, void *)); + + bytes += strlen(temp); + + if (bufptr) + { + if ((bufptr + strlen(temp)) > bufend) + { + strncpy(bufptr, temp, (size_t)(bufend - bufptr)); + bufptr = bufend; + } + else + { + strcpy(bufptr, temp); + bufptr += strlen(temp); + } + } + break; + + case 'c' : /* Character or character array */ + bytes += width; + + if (bufptr) + { + if (width <= 1) + *bufptr++ = va_arg(ap, int); + else + { + if ((bufptr + width) > bufend) + width = bufend - bufptr; + + memcpy(bufptr, va_arg(ap, char *), (size_t)width); + bufptr += width; + } + } + break; + + case 's' : /* String */ + if ((s = va_arg(ap, char *)) == NULL) + s = "(null)"; + + slen = strlen(s); + if (slen > width && prec != width) + width = slen; + + bytes += width; + + if (bufptr) + { + if ((bufptr + width) > bufend) + width = bufend - bufptr; + + if (slen > width) + slen = width; + + if (sign == '-') + { + strncpy(bufptr, s, (size_t)slen); + memset(bufptr + slen, ' ', (size_t)(width - slen)); + } + else + { + memset(bufptr, ' ', (size_t)(width - slen)); + strncpy(bufptr + width - slen, s, (size_t)slen); + } + + bufptr += width; + } + break; + + case 'n' : /* Output number of chars so far */ + *(va_arg(ap, int *)) = bytes; + break; + } + } + else + { + bytes ++; + + if (bufptr && bufptr < bufend) + *bufptr++ = *format; + + format ++; + } + } + + /* + * Nul-terminate the string and return the number of characters needed. + */ + + *bufptr = '\0'; + + return (bytes); +} +#endif /* !HAVE_VSNPRINTF */ + + +/* + * '_mxml_vstrdupf()' - Format and duplicate a string. + */ + +char * /* O - New string pointer */ +_mxml_vstrdupf(const char *format, /* I - Printf-style format string */ + va_list ap) /* I - Pointer to additional arguments */ +{ + int bytes; /* Number of bytes required */ + char *buffer, /* String buffer */ + temp[256]; /* Small buffer for first vsnprintf */ + + + /* + * First format with a tiny buffer; this will tell us how many bytes are + * needed... + */ + + bytes = vsnprintf(temp, sizeof(temp), format, ap); + + if (bytes < sizeof(temp)) + { + /* + * Hey, the formatted string fits in the tiny buffer, so just dup that... + */ + + return (strdup(temp)); + } + + /* + * Allocate memory for the whole thing and reformat to the new, larger + * buffer... + */ + + if ((buffer = calloc(1, bytes + 1)) != NULL) + vsnprintf(buffer, bytes + 1, format, ap); + + /* + * Return the new string... + */ + + return (buffer); +} + + +/* + * End of "$Id: mxml-string.c 387 2009-04-18 17:05:52Z mike $". + */ diff -Naur mxml-2.6/mxml.h mxml-2.6-haiku/mxml.h --- mxml-2.6/mxml.h 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/mxml.h 2009-03-19 05:38:52.000000000 +0000 @@ -0,0 +1,308 @@ +/* + * "$Id: mxml.h 385 2009-03-19 05:38:52Z mike $" + * + * Header file for Mini-XML, a small XML-like file parsing library. + * + * Copyright 2003-2009 by Michael Sweet. + * + * This program is free software; you can redistribute it and/or + * modify it under the terms of the GNU Library General Public + * License as published by the Free Software Foundation; either + * version 2, or (at your option) any later version. + * + * This program is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU General Public License for more details. + */ + +/* + * Prevent multiple inclusion... + */ + +#ifndef _mxml_h_ +# define _mxml_h_ + +/* + * Include necessary headers... + */ + +# include +# include +# include +# include +# include + + +/* + * Constants... + */ + +# define MXML_TAB 8 /* Tabs every N columns */ + +# define MXML_NO_CALLBACK 0 /* Don't use a type callback */ +# define MXML_INTEGER_CALLBACK mxml_integer_cb + /* Treat all data as integers */ +# define MXML_OPAQUE_CALLBACK mxml_opaque_cb + /* Treat all data as opaque */ +# define MXML_REAL_CALLBACK mxml_real_cb + /* Treat all data as real numbers */ +# define MXML_TEXT_CALLBACK 0 /* Treat all data as text */ +# define MXML_IGNORE_CALLBACK mxml_ignore_cb + /* Ignore all non-element content */ + +# define MXML_NO_PARENT 0 /* No parent for the node */ + +# define MXML_DESCEND 1 /* Descend when finding/walking */ +# define MXML_NO_DESCEND 0 /* Don't descend when finding/walking */ +# define MXML_DESCEND_FIRST -1 /* Descend for first find */ + +# define MXML_WS_BEFORE_OPEN 0 /* Callback for before open tag */ +# define MXML_WS_AFTER_OPEN 1 /* Callback for after open tag */ +# define MXML_WS_BEFORE_CLOSE 2 /* Callback for before close tag */ +# define MXML_WS_AFTER_CLOSE 3 /* Callback for after close tag */ + +# define MXML_ADD_BEFORE 0 /* Add node before specified node */ +# define MXML_ADD_AFTER 1 /* Add node after specified node */ +# define MXML_ADD_TO_PARENT NULL /* Add node relative to parent */ + + +/* + * Data types... + */ + +typedef enum mxml_sax_event_e /**** SAX event type. ****/ +{ + MXML_SAX_CDATA, /* CDATA node */ + MXML_SAX_COMMENT, /* Comment node */ + MXML_SAX_DATA, /* Data node */ + MXML_SAX_DIRECTIVE, /* Processing directive node */ + MXML_SAX_ELEMENT_CLOSE, /* Element closed */ + MXML_SAX_ELEMENT_OPEN /* Element opened */ +} mxml_sax_event_t; + +typedef enum mxml_type_e /**** The XML node type. ****/ +{ + MXML_IGNORE = -1, /* Ignore/throw away node @since Mini-XML 2.3@ */ + MXML_ELEMENT, /* XML element with attributes */ + MXML_INTEGER, /* Integer value */ + MXML_OPAQUE, /* Opaque string */ + MXML_REAL, /* Real value */ + MXML_TEXT, /* Text fragment */ + MXML_CUSTOM /* Custom data @since Mini-XML 2.1@ */ +} mxml_type_t; + +typedef void (*mxml_custom_destroy_cb_t)(void *); + /**** Custom data destructor ****/ + +typedef void (*mxml_error_cb_t)(const char *); + /**** Error callback function ****/ + +typedef struct mxml_attr_s /**** An XML element attribute value. ****/ +{ + char *name; /* Attribute name */ + char *value; /* Attribute value */ +} mxml_attr_t; + +typedef struct mxml_element_s /**** An XML element value. ****/ +{ + char *name; /* Name of element */ + int num_attrs; /* Number of attributes */ + mxml_attr_t *attrs; /* Attributes */ +} mxml_element_t; + +typedef struct mxml_text_s /**** An XML text value. ****/ +{ + int whitespace; /* Leading whitespace? */ + char *string; /* Fragment string */ +} mxml_text_t; + +typedef struct mxml_custom_s /**** An XML custom value. @since Mini-XML 2.1@ ****/ +{ + void *data; /* Pointer to (allocated) custom data */ + mxml_custom_destroy_cb_t destroy; /* Pointer to destructor function */ +} mxml_custom_t; + +typedef union mxml_value_u /**** An XML node value. ****/ +{ + mxml_element_t element; /* Element */ + int integer; /* Integer number */ + char *opaque; /* Opaque string */ + double real; /* Real number */ + mxml_text_t text; /* Text fragment */ + mxml_custom_t custom; /* Custom data @since Mini-XML 2.1@ */ +} mxml_value_t; + +typedef struct mxml_node_s /**** An XML node. ****/ +{ + mxml_type_t type; /* Node type */ + struct mxml_node_s *next; /* Next node under same parent */ + struct mxml_node_s *prev; /* Previous node under same parent */ + struct mxml_node_s *parent; /* Parent node */ + struct mxml_node_s *child; /* First child node */ + struct mxml_node_s *last_child; /* Last child node */ + mxml_value_t value; /* Node value */ + int ref_count; /* Use count */ + void *user_data; /* User data */ +} mxml_node_t; + +typedef struct mxml_index_s /**** An XML node index. ****/ +{ + char *attr; /* Attribute used for indexing or NULL */ + int num_nodes; /* Number of nodes in index */ + int alloc_nodes; /* Allocated nodes in index */ + int cur_node; /* Current node */ + mxml_node_t **nodes; /* Node array */ +} mxml_index_t; + +typedef int (*mxml_custom_load_cb_t)(mxml_node_t *, const char *); + /**** Custom data load callback function ****/ + +typedef char *(*mxml_custom_save_cb_t)(mxml_node_t *); + /**** Custom data save callback function ****/ + +typedef int (*mxml_entity_cb_t)(const char *); + /**** Entity callback function */ + +typedef mxml_type_t (*mxml_load_cb_t)(mxml_node_t *); + /**** Load callback function ****/ + +typedef const char *(*mxml_save_cb_t)(mxml_node_t *, int); + /**** Save callback function ****/ + +typedef void (*mxml_sax_cb_t)(mxml_node_t *, mxml_sax_event_t, void *); + /**** SAX callback function ****/ + + +/* + * C++ support... + */ + +# ifdef __cplusplus +extern "C" { +# endif /* __cplusplus */ + +/* + * Prototypes... + */ + +extern void mxmlAdd(mxml_node_t *parent, int where, + mxml_node_t *child, mxml_node_t *node); +extern void mxmlDelete(mxml_node_t *node); +extern void mxmlElementDeleteAttr(mxml_node_t *node, + const char *name); +extern const char *mxmlElementGetAttr(mxml_node_t *node, const char *name); +extern void mxmlElementSetAttr(mxml_node_t *node, const char *name, + const char *value); +extern void mxmlElementSetAttrf(mxml_node_t *node, const char *name, + const char *format, ...) +# ifdef __GNUC__ +__attribute__ ((__format__ (__printf__, 3, 4))) +# endif /* __GNUC__ */ +; +extern int mxmlEntityAddCallback(mxml_entity_cb_t cb); +extern const char *mxmlEntityGetName(int val); +extern int mxmlEntityGetValue(const char *name); +extern void mxmlEntityRemoveCallback(mxml_entity_cb_t cb); +extern mxml_node_t *mxmlFindElement(mxml_node_t *node, mxml_node_t *top, + const char *name, const char *attr, + const char *value, int descend); +extern void mxmlIndexDelete(mxml_index_t *ind); +extern mxml_node_t *mxmlIndexEnum(mxml_index_t *ind); +extern mxml_node_t *mxmlIndexFind(mxml_index_t *ind, + const char *element, + const char *value); +extern mxml_index_t *mxmlIndexNew(mxml_node_t *node, const char *element, + const char *attr); +extern mxml_node_t *mxmlIndexReset(mxml_index_t *ind); +extern mxml_node_t *mxmlLoadFd(mxml_node_t *top, int fd, + mxml_type_t (*cb)(mxml_node_t *)); +extern mxml_node_t *mxmlLoadFile(mxml_node_t *top, FILE *fp, + mxml_type_t (*cb)(mxml_node_t *)); +extern mxml_node_t *mxmlLoadString(mxml_node_t *top, const char *s, + mxml_type_t (*cb)(mxml_node_t *)); +extern mxml_node_t *mxmlNewCDATA(mxml_node_t *parent, const char *string); +extern mxml_node_t *mxmlNewCustom(mxml_node_t *parent, void *data, + mxml_custom_destroy_cb_t destroy); +extern mxml_node_t *mxmlNewElement(mxml_node_t *parent, const char *name); +extern mxml_node_t *mxmlNewInteger(mxml_node_t *parent, int integer); +extern mxml_node_t *mxmlNewOpaque(mxml_node_t *parent, const char *opaque); +extern mxml_node_t *mxmlNewReal(mxml_node_t *parent, double real); +extern mxml_node_t *mxmlNewText(mxml_node_t *parent, int whitespace, + const char *string); +extern mxml_node_t *mxmlNewTextf(mxml_node_t *parent, int whitespace, + const char *format, ...) +# ifdef __GNUC__ +__attribute__ ((__format__ (__printf__, 3, 4))) +# endif /* __GNUC__ */ +; +extern mxml_node_t *mxmlNewXML(const char *version); +extern int mxmlRelease(mxml_node_t *node); +extern void mxmlRemove(mxml_node_t *node); +extern int mxmlRetain(mxml_node_t *node); +extern char *mxmlSaveAllocString(mxml_node_t *node, + mxml_save_cb_t cb); +extern int mxmlSaveFd(mxml_node_t *node, int fd, + mxml_save_cb_t cb); +extern int mxmlSaveFile(mxml_node_t *node, FILE *fp, + mxml_save_cb_t cb); +extern int mxmlSaveString(mxml_node_t *node, char *buffer, + int bufsize, mxml_save_cb_t cb); +extern mxml_node_t *mxmlSAXLoadFd(mxml_node_t *top, int fd, + mxml_type_t (*cb)(mxml_node_t *), + mxml_sax_cb_t sax, void *sax_data); +extern mxml_node_t *mxmlSAXLoadFile(mxml_node_t *top, FILE *fp, + mxml_type_t (*cb)(mxml_node_t *), + mxml_sax_cb_t sax, void *sax_data); +extern mxml_node_t *mxmlSAXLoadString(mxml_node_t *top, const char *s, + mxml_type_t (*cb)(mxml_node_t *), + mxml_sax_cb_t sax, void *sax_data); +extern int mxmlSetCDATA(mxml_node_t *node, const char *data); +extern int mxmlSetCustom(mxml_node_t *node, void *data, + mxml_custom_destroy_cb_t destroy); +extern void mxmlSetCustomHandlers(mxml_custom_load_cb_t load, + mxml_custom_save_cb_t save); +extern int mxmlSetElement(mxml_node_t *node, const char *name); +extern void mxmlSetErrorCallback(mxml_error_cb_t cb); +extern int mxmlSetInteger(mxml_node_t *node, int integer); +extern int mxmlSetOpaque(mxml_node_t *node, const char *opaque); +extern int mxmlSetReal(mxml_node_t *node, double real); +extern int mxmlSetText(mxml_node_t *node, int whitespace, + const char *string); +extern int mxmlSetTextf(mxml_node_t *node, int whitespace, + const char *format, ...) +# ifdef __GNUC__ +__attribute__ ((__format__ (__printf__, 3, 4))) +# endif /* __GNUC__ */ +; +extern void mxmlSetWrapMargin(int column); +extern mxml_node_t *mxmlWalkNext(mxml_node_t *node, mxml_node_t *top, + int descend); +extern mxml_node_t *mxmlWalkPrev(mxml_node_t *node, mxml_node_t *top, + int descend); + + +/* + * Semi-private functions... + */ + +extern void mxml_error(const char *format, ...); +extern mxml_type_t mxml_ignore_cb(mxml_node_t *node); +extern mxml_type_t mxml_integer_cb(mxml_node_t *node); +extern mxml_type_t mxml_opaque_cb(mxml_node_t *node); +extern mxml_type_t mxml_real_cb(mxml_node_t *node); + + +/* + * C++ support... + */ + +# ifdef __cplusplus +} +# endif /* __cplusplus */ +#endif /* !_mxml_h_ */ + + +/* + * End of "$Id: mxml.h 385 2009-03-19 05:38:52Z mike $". + */ diff -Naur mxml-2.6/mxml.list mxml-2.6-haiku/mxml.list --- mxml-2.6/mxml.list 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/mxml.list 2009-10-26 02:28:22.000000000 +0000 @@ -0,0 +1,107 @@ +# +# "$Id: mxml.list.in 399 2009-05-17 17:20:51Z mike $" +# +# EPM software list file for Mini-XML, a small XML library. +# +# Copyright 2003-2009 by Michael Sweet. +# +# This program is free software; you can redistribute it and/or +# modify it under the terms of the GNU Library General Public +# License as published by the Free Software Foundation; either +# version 2, or (at your option) any later version. +# +# This program is distributed in the hope that it will be useful, +# but WITHOUT ANY WARRANTY; without even the implied warranty of +# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the +# GNU General Public License for more details. +# + +# Directories... +$prefix=/boot/common +$exec_prefix=/boot/common +$bindir=${exec_prefix}/bin +$datarootdir=${prefix}/share +$docdir=${datarootdir}/doc/mxml +$includedir=${prefix}/include +$libdir=${exec_prefix}/lib +$mandir=${datarootdir}/man +$srcdir=. + +$PICFLAG=0 + +# Product information +%product mxml +%copyright 2003-2009 by Michael Sweet +%vendor Michael Sweet +%license ${srcdir}/COPYING +%readme ${srcdir}/README +%version 2.6 + +%description < +Vendor: Michael Sweet + +# Use buildroot so as not to disturb the version already installed +BuildRoot: /var/tmp/%{name}-root + +%description +Mini-XML is a small XML parsing library that you can use to read +XML and XML-like data files in your application without +requiring large non-standard libraries. Mini-XML provides the +following functionality: + + - Reading of UTF-8 and UTF-16 and writing of UTF-8 encoded + XML files and strings. + - Data is stored in a linked-list tree structure, preserving + the XML data hierarchy. + - Supports arbitrary element names, attributes, and + attribute values with no preset limits, just available + memory. + - Supports integer, real, opaque ("cdata"), and text data + types in "leaf" nodes. + - Functions for creating and managing trees of data. + - "Find" and "walk" functions for easily locating and + navigating trees of data. + +Mini-XML doesn't do validation or other types of processing on +the data based upon schema files or other sources of definition +information, nor does it support character entities other than +those required by the XML specification. + +%prep +%setup + +%build +CFLAGS="$RPM_OPT_FLAGS" CXXFLAGS="$RPM_OPT_FLAGS" LDFLAGS="$RPM_OPT_FLAGS" ./configure --enable-shared --prefix=/usr + +# If we got this far, all prerequisite libraries must be here. +make + +%install +# Make sure the RPM_BUILD_ROOT directory exists. +rm -rf $RPM_BUILD_ROOT + +make BUILDROOT=$RPM_BUILD_ROOT install + +%clean +rm -rf $RPM_BUILD_ROOT + +%files +%defattr(-,root,root) + +%dir /usr/bin +/usr/bin/* +%dir /usr/include +/usr/include/mxml.h +%dir /usr/lib +/usr/lib/* +%dir /usr/lib/pkgconfig +/usr/lib/pkgconfig/mxml.pc +%dir /usr/share/doc/mxml +/usr/share/doc/mxml/* +%dir /usr/share/man/man1 +/usr/share/man/man1/* +%dir /usr/share/man/man3 +/usr/share/man/man3/* + +# +# End of "$Id: mxml.spec 399 2009-05-17 17:20:51Z mike $". +# diff -Naur mxml-2.6/mxmldoc.c mxml-2.6-haiku/mxmldoc.c --- mxml-2.6/mxmldoc.c 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/mxmldoc.c 2009-05-05 13:38:00.000000000 +0000 @@ -0,0 +1,5772 @@ +/*#define DEBUG 1*/ +/* + * "$Id: mxmldoc.c 390 2009-05-05 13:38:00Z mike $" + * + * Documentation generator using Mini-XML, a small XML-like file parsing + * library. + * + * Copyright 2003-2009 by Michael Sweet. + * + * This program is free software; you can redistribute it and/or + * modify it under the terms of the GNU Library General Public + * License as published by the Free Software Foundation; either + * version 2, or (at your option) any later version. + * + * This program is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU General Public License for more details. + * + * Contents: + * + * main() - Main entry for test program. + * add_variable() - Add a variable or argument. + * find_public() - Find a public function, type, etc. + * get_comment_info() - Get info from comment. + * get_text() - Get the text for a node. + * load_cb() - Set the type of child nodes. + * new_documentation() - Create a new documentation tree. + * remove_directory() - Remove a directory. + * safe_strcpy() - Copy a string allowing for overlapping strings. + * scan_file() - Scan a source file. + * sort_node() - Insert a node sorted into a tree. + * update_comment() - Update a comment node. + * usage() - Show program usage... + * write_description() - Write the description text. + * write_element() - Write an element's text nodes. + * write_file() - Copy a file to the output. + * write_function() - Write documentation for a function. + * write_html() - Write HTML documentation. + * write_html_head() - Write the standard HTML header. + * write_man() - Write manpage documentation. + * write_scu() - Write a structure, class, or union. + * write_string() - Write a string, quoting HTML special chars as needed. + * write_toc() - Write a table-of-contents. + * write_tokens() - Write nodes for all APIs. + * ws_cb() - Whitespace callback for saving. + */ + +/* + * Include necessary headers... + */ + +#include "config.h" +#include "mxml.h" +#include +#include +#ifndef WIN32 +# include +# include +# include +# include +extern char **environ; +#endif /* !WIN32 */ + + +/* + * This program scans source and header files and produces public API + * documentation for code that conforms to the CUPS Configuration + * Management Plan (CMP) coding standards. Please see the following web + * page for details: + * + * http://www.cups.org/cmp.html + * + * Using Mini-XML, this program creates and maintains an XML representation + * of the public API code documentation which can then be converted to HTML + * as desired. The following is a poor-man's schema: + * + * + * + * + * [optional...] + * + * descriptive text + * + * + * + * descriptive text + * ... + * + * + * + * descriptive text + * type string + * + * + * + * descriptive text + * + * descriptive text + * type string + * + * + * descriptive text + * type string + * + * function names separated by spaces + * + * + * + * descriptive text + * type string + * + * + * + * descriptive text + * ... + * ... + * + * + * + * descriptive text + * ... + * + * + * + * descriptive text + * ... + * ... + * ... + * ... + * ... + * + * + * + */ + + +/* + * Basic states for file parser... + */ + +#define STATE_NONE 0 /* No state - whitespace, etc. */ +#define STATE_PREPROCESSOR 1 /* Preprocessor directive */ +#define STATE_C_COMMENT 2 /* Inside a C comment */ +#define STATE_CXX_COMMENT 3 /* Inside a C++ comment */ +#define STATE_STRING 4 /* Inside a string constant */ +#define STATE_CHARACTER 5 /* Inside a character constant */ +#define STATE_IDENTIFIER 6 /* Inside a keyword/identifier */ + + +/* + * Output modes... + */ + +#define OUTPUT_NONE 0 /* No output */ +#define OUTPUT_HTML 1 /* Output HTML */ +#define OUTPUT_XML 2 /* Output XML */ +#define OUTPUT_MAN 3 /* Output nroff/man */ +#define OUTPUT_TOKENS 4 /* Output docset Tokens.xml file */ + + +/* + * Local functions... + */ + +static mxml_node_t *add_variable(mxml_node_t *parent, const char *name, + mxml_node_t *type); +static mxml_node_t *find_public(mxml_node_t *node, mxml_node_t *top, + const char *name); +static char *get_comment_info(mxml_node_t *description); +static char *get_text(mxml_node_t *node, char *buffer, int buflen); +static mxml_type_t load_cb(mxml_node_t *node); +static mxml_node_t *new_documentation(mxml_node_t **mxmldoc); +static int remove_directory(const char *path); +static void safe_strcpy(char *dst, const char *src); +static int scan_file(const char *filename, FILE *fp, + mxml_node_t *doc); +static void sort_node(mxml_node_t *tree, mxml_node_t *func); +static void update_comment(mxml_node_t *parent, + mxml_node_t *comment); +static void usage(const char *option); +static void write_description(FILE *out, mxml_node_t *description, + const char *element, int summary); +static void write_element(FILE *out, mxml_node_t *doc, + mxml_node_t *element, int mode); +static void write_file(FILE *out, const char *file); +static void write_function(FILE *out, mxml_node_t *doc, + mxml_node_t *function, int level); +static void write_html(const char *section, const char *title, + const char *footerfile, + const char *headerfile, + const char *introfile, const char *cssfile, + const char *framefile, + const char *docset, const char *docversion, + const char *feedname, const char *feedurl, + mxml_node_t *doc); +static void write_html_head(FILE *out, const char *section, + const char *title, const char *cssfile); +static void write_man(const char *man_name, const char *section, + const char *title, const char *headerfile, + const char *footerfile, const char *introfile, + mxml_node_t *doc); +static void write_scu(FILE *out, mxml_node_t *doc, + mxml_node_t *scut); +static void write_string(FILE *out, const char *s, int mode); +static void write_toc(FILE *out, mxml_node_t *doc, + const char *introfile, const char *target, + int xml); +static void write_tokens(FILE *out, mxml_node_t *doc, + const char *path); +static const char *ws_cb(mxml_node_t *node, int where); + + +/* + * 'main()' - Main entry for test program. + */ + +int /* O - Exit status */ +main(int argc, /* I - Number of command-line args */ + char *argv[]) /* I - Command-line args */ +{ + int i; /* Looping var */ + int len; /* Length of argument */ + FILE *fp; /* File to read */ + mxml_node_t *doc; /* XML documentation tree */ + mxml_node_t *mxmldoc; /* mxmldoc node */ + const char *cssfile, /* CSS stylesheet file */ + *docset, /* Documentation set directory */ + *docversion, /* Documentation set version */ + *feedname, /* Feed name for documentation set */ + *feedurl, /* Feed URL for documentation set */ + *footerfile, /* Footer file */ + *framefile, /* Framed HTML basename */ + *headerfile, /* Header file */ + *introfile, /* Introduction file */ + *name, /* Name of manpage */ + *path, /* Path to help file for tokens */ + *section, /* Section/keywords of documentation */ + *title, /* Title of documentation */ + *xmlfile; /* XML file */ + int mode, /* Output mode */ + update; /* Updated XML file */ + + + /* + * Check arguments... + */ + + cssfile = NULL; + doc = NULL; + docset = NULL; + docversion = NULL; + feedname = NULL; + feedurl = NULL; + footerfile = NULL; + framefile = NULL; + headerfile = NULL; + introfile = NULL; + mode = OUTPUT_HTML; + mxmldoc = NULL; + name = NULL; + path = NULL; + section = NULL; + title = NULL; + update = 0; + xmlfile = NULL; + + for (i = 1; i < argc; i ++) + if (!strcmp(argv[i], "--help")) + { + /* + * Show help... + */ + + usage(NULL); + } + else if (!strcmp(argv[i], "--css") && !cssfile) + { + /* + * Set CSS stylesheet file... + */ + + i ++; + if (i < argc) + cssfile = argv[i]; + else + usage(NULL); + } + else if (!strcmp(argv[i], "--docset") && !docset) + { + /* + * Set documentation set directory... + */ + + i ++; + if (i < argc) + docset = argv[i]; + else + usage(NULL); + } + else if (!strcmp(argv[i], "--docversion") && !docversion) + { + /* + * Set documentation set directory... + */ + + i ++; + if (i < argc) + docversion = argv[i]; + else + usage(NULL); + } + else if (!strcmp(argv[i], "--footer") && !footerfile) + { + /* + * Set footer file... + */ + + i ++; + if (i < argc) + footerfile = argv[i]; + else + usage(NULL); + } + else if (!strcmp(argv[i], "--feedname") && !feedname) + { + /* + * Set documentation set feed name... + */ + + i ++; + if (i < argc) + feedname = argv[i]; + else + usage(NULL); + } + else if (!strcmp(argv[i], "--feedurl") && !feedurl) + { + /* + * Set documentation set feed name... + */ + + i ++; + if (i < argc) + feedurl = argv[i]; + else + usage(NULL); + } + else if (!strcmp(argv[i], "--framed") && !framefile) + { + /* + * Set base filename for framed HTML output... + */ + + i ++; + if (i < argc) + framefile = argv[i]; + else + usage(NULL); + } + else if (!strcmp(argv[i], "--header") && !headerfile) + { + /* + * Set header file... + */ + + i ++; + if (i < argc) + headerfile = argv[i]; + else + usage(NULL); + } + else if (!strcmp(argv[i], "--intro") && !introfile) + { + /* + * Set intro file... + */ + + i ++; + if (i < argc) + introfile = argv[i]; + else + usage(NULL); + } + else if (!strcmp(argv[i], "--man") && !name) + { + /* + * Output manpage... + */ + + i ++; + if (i < argc) + { + mode = OUTPUT_MAN; + name = argv[i]; + } + else + usage(NULL); + } + else if (!strcmp(argv[i], "--no-output")) + mode = OUTPUT_NONE; + else if (!strcmp(argv[i], "--section") && !section) + { + /* + * Set section/keywords... + */ + + i ++; + if (i < argc) + section = argv[i]; + else + usage(NULL); + } + else if (!strcmp(argv[i], "--title") && !title) + { + /* + * Set title... + */ + + i ++; + if (i < argc) + title = argv[i]; + else + usage(NULL); + } + else if (!strcmp(argv[i], "--tokens")) + { + /* + * Output Tokens.xml file... + */ + + mode = OUTPUT_TOKENS; + + i ++; + if (i < argc) + path = argv[i]; + else + usage(NULL); + } + else if (argv[i][0] == '-') + { + /* + * Unknown/bad option... + */ + + usage(argv[i]); + } + else + { + /* + * Process XML or source file... + */ + + len = (int)strlen(argv[i]); + if (len > 4 && !strcmp(argv[i] + len - 4, ".xml")) + { + /* + * Set XML file... + */ + + if (xmlfile) + usage(NULL); + + xmlfile = argv[i]; + + if (!doc) + { + if ((fp = fopen(argv[i], "r")) != NULL) + { + /* + * Read the existing XML file... + */ + + doc = mxmlLoadFile(NULL, fp, load_cb); + + fclose(fp); + + if (!doc) + { + mxmldoc = NULL; + + fprintf(stderr, + "mxmldoc: Unable to read the XML documentation file " + "\"%s\"!\n", argv[i]); + } + else if ((mxmldoc = mxmlFindElement(doc, doc, "mxmldoc", NULL, + NULL, MXML_DESCEND)) == NULL) + { + fprintf(stderr, + "mxmldoc: XML documentation file \"%s\" is missing " + " node!!\n", argv[i]); + + mxmlDelete(doc); + doc = NULL; + } + } + else + { + doc = NULL; + mxmldoc = NULL; + } + + if (!doc) + doc = new_documentation(&mxmldoc); + } + } + else + { + /* + * Load source file... + */ + + update = 1; + + if (!doc) + doc = new_documentation(&mxmldoc); + + if ((fp = fopen(argv[i], "r")) == NULL) + { + fprintf(stderr, "mxmldoc: Unable to open source file \"%s\": %s\n", + argv[i], strerror(errno)); + mxmlDelete(doc); + return (1); + } + else if (scan_file(argv[i], fp, mxmldoc)) + { + fclose(fp); + mxmlDelete(doc); + return (1); + } + else + fclose(fp); + } + } + + if (update && xmlfile) + { + /* + * Save the updated XML documentation file... + */ + + if ((fp = fopen(xmlfile, "w")) != NULL) + { + /* + * Write over the existing XML file... + */ + + mxmlSetWrapMargin(0); + + if (mxmlSaveFile(doc, fp, ws_cb)) + { + fprintf(stderr, + "mxmldoc: Unable to write the XML documentation file \"%s\": " + "%s!\n", xmlfile, strerror(errno)); + fclose(fp); + mxmlDelete(doc); + return (1); + } + + fclose(fp); + } + else + { + fprintf(stderr, + "mxmldoc: Unable to create the XML documentation file \"%s\": " + "%s!\n", xmlfile, strerror(errno)); + mxmlDelete(doc); + return (1); + } + } + + switch (mode) + { + case OUTPUT_HTML : + /* + * Write HTML documentation... + */ + + write_html(section, title ? title : "Documentation", footerfile, + headerfile, introfile, cssfile, framefile, docset, + docversion, feedname, feedurl, mxmldoc); + break; + + case OUTPUT_MAN : + /* + * Write manpage documentation... + */ + + write_man(name, section, title, footerfile, headerfile, introfile, + mxmldoc); + break; + + case OUTPUT_TOKENS : + fputs("\n" + "\n", stdout); + + write_tokens(stdout, mxmldoc, path); + + fputs("\n", stdout); + break; + } + + /* + * Delete the tree and return... + */ + + mxmlDelete(doc); + + return (0); +} + + +/* + * 'add_variable()' - Add a variable or argument. + */ + +static mxml_node_t * /* O - New variable/argument */ +add_variable(mxml_node_t *parent, /* I - Parent node */ + const char *name, /* I - "argument" or "variable" */ + mxml_node_t *type) /* I - Type nodes */ +{ + mxml_node_t *variable, /* New variable */ + *node, /* Current node */ + *next; /* Next node */ + char buffer[16384], /* String buffer */ + *bufptr; /* Pointer into buffer */ + + +#ifdef DEBUG + fprintf(stderr, "add_variable(parent=%p, name=\"%s\", type=%p)\n", + parent, name, type); +#endif /* DEBUG */ + + /* + * Range check input... + */ + + if (!type || !type->child) + return (NULL); + + /* + * Create the variable/argument node... + */ + + variable = mxmlNewElement(parent, name); + + /* + * Check for a default value... + */ + + for (node = type->child; node; node = node->next) + if (!strcmp(node->value.text.string, "=")) + break; + + if (node) + { + /* + * Default value found, copy it and add as a "default" attribute... + */ + + for (bufptr = buffer; node; bufptr += strlen(bufptr)) + { + if (node->value.text.whitespace && bufptr > buffer) + *bufptr++ = ' '; + + strcpy(bufptr, node->value.text.string); + + next = node->next; + mxmlDelete(node); + node = next; + } + + mxmlElementSetAttr(variable, "default", buffer); + } + + /* + * Extract the argument/variable name... + */ + + if (type->last_child->value.text.string[0] == ')') + { + /* + * Handle "type (*name)(args)"... + */ + + for (node = type->child; node; node = node->next) + if (node->value.text.string[0] == '(') + break; + + for (bufptr = buffer; node; bufptr += strlen(bufptr)) + { + if (node->value.text.whitespace && bufptr > buffer) + *bufptr++ = ' '; + + strcpy(bufptr, node->value.text.string); + + next = node->next; + mxmlDelete(node); + node = next; + } + } + else + { + /* + * Handle "type name"... + */ + + strcpy(buffer, type->last_child->value.text.string); + mxmlDelete(type->last_child); + } + + /* + * Set the name... + */ + + mxmlElementSetAttr(variable, "name", buffer); + + /* + * Add the remaining type information to the variable node... + */ + + mxmlAdd(variable, MXML_ADD_AFTER, MXML_ADD_TO_PARENT, type); + + /* + * Add new new variable node... + */ + + return (variable); +} + + +/* + * 'find_public()' - Find a public function, type, etc. + */ + +static mxml_node_t * /* I - Found node or NULL */ +find_public(mxml_node_t *node, /* I - Current node */ + mxml_node_t *top, /* I - Top node */ + const char *name) /* I - Name of element */ +{ + mxml_node_t *description, /* Description node */ + *comment; /* Comment node */ + + + for (node = mxmlFindElement(node, top, name, NULL, NULL, + node == top ? MXML_DESCEND_FIRST : + MXML_NO_DESCEND); + node; + node = mxmlFindElement(node, top, name, NULL, NULL, MXML_NO_DESCEND)) + { + /* + * Get the description for this node... + */ + + description = mxmlFindElement(node, node, "description", NULL, NULL, + MXML_DESCEND_FIRST); + + /* + * A missing or empty description signals a private node... + */ + + if (!description) + continue; + + /* + * Look for @private@ in the comment text... + */ + + for (comment = description->child; comment; comment = comment->next) + if ((comment->type == MXML_TEXT && + strstr(comment->value.text.string, "@private@")) || + (comment->type == MXML_OPAQUE && + strstr(comment->value.opaque, "@private@"))) + break; + + if (!comment) + { + /* + * No @private@, so return this node... + */ + + return (node); + } + } + + /* + * If we get here, there are no (more) public nodes... + */ + + return (NULL); +} + + +/* + * 'get_comment_info()' - Get info from comment. + */ + +static char * /* O - Info from comment */ +get_comment_info( + mxml_node_t *description) /* I - Description node */ +{ + char text[10240], /* Description text */ + since[255], /* @since value */ + *ptr; /* Pointer into text */ + static char info[1024]; /* Info string */ + + + if (!description) + return (""); + + get_text(description, text, sizeof(text)); + + for (ptr = strchr(text, '@'); ptr; ptr = strchr(ptr + 1, '@')) + { + if (!strncmp(ptr, "@deprecated@", 12)) + return (" DEPRECATED "); + else if (!strncmp(ptr, "@since ", 7)) + { + strncpy(since, ptr + 7, sizeof(since) - 1); + since[sizeof(since) - 1] = '\0'; + + if ((ptr = strchr(since, '@')) != NULL) + *ptr = '\0'; + + snprintf(info, sizeof(info), " %s ", since); + return (info); + } + } + + return (""); +} + + +/* + * 'get_text()' - Get the text for a node. + */ + +static char * /* O - Text in node */ +get_text(mxml_node_t *node, /* I - Node to get */ + char *buffer, /* I - Buffer */ + int buflen) /* I - Size of buffer */ +{ + char *ptr, /* Pointer into buffer */ + *end; /* End of buffer */ + int len; /* Length of node */ + mxml_node_t *current; /* Current node */ + + + ptr = buffer; + end = buffer + buflen - 1; + + for (current = node->child; current && ptr < end; current = current->next) + { + if (current->type == MXML_TEXT) + { + if (current->value.text.whitespace) + *ptr++ = ' '; + + len = (int)strlen(current->value.text.string); + if (len > (int)(end - ptr)) + len = (int)(end - ptr); + + memcpy(ptr, current->value.text.string, len); + ptr += len; + } + else if (current->type == MXML_OPAQUE) + { + len = (int)strlen(current->value.opaque); + if (len > (int)(end - ptr)) + len = (int)(end - ptr); + + memcpy(ptr, current->value.opaque, len); + ptr += len; + } + } + + *ptr = '\0'; + + return (buffer); +} + + +/* + * 'load_cb()' - Set the type of child nodes. + */ + +static mxml_type_t /* O - Node type */ +load_cb(mxml_node_t *node) /* I - Node */ +{ + if (!strcmp(node->value.element.name, "description")) + return (MXML_OPAQUE); + else + return (MXML_TEXT); +} + + +/* + * 'new_documentation()' - Create a new documentation tree. + */ + +static mxml_node_t * /* O - New documentation */ +new_documentation(mxml_node_t **mxmldoc)/* O - mxmldoc node */ +{ + mxml_node_t *doc; /* New documentation */ + + + /* + * Create an empty XML documentation file... + */ + + doc = mxmlNewXML(NULL); + + *mxmldoc = mxmlNewElement(doc, "mxmldoc"); + + mxmlElementSetAttr(*mxmldoc, "xmlns", "http://www.easysw.com"); + mxmlElementSetAttr(*mxmldoc, "xmlns:xsi", + "http://www.w3.org/2001/XMLSchema-instance"); + mxmlElementSetAttr(*mxmldoc, "xsi:schemaLocation", + "http://www.minixml.org/mxmldoc.xsd"); + + return (doc); +} + + +/* + * 'remove_directory()' - Remove a directory. + */ + +static int /* O - 1 on success, 0 on failure */ +remove_directory(const char *path) /* I - Directory to remove */ +{ +#ifdef WIN32 + /* TODO: Add Windows directory removal code */ + +#else + DIR *dir; /* Directory */ + struct dirent *dent; /* Current directory entry */ + char filename[1024]; /* Current filename */ + struct stat fileinfo; /* File information */ + + + if ((dir = opendir(path)) == NULL) + { + fprintf(stderr, "mxmldoc: Unable to open directory \"%s\": %s\n", path, + strerror(errno)); + return (0); + } + + while ((dent = readdir(dir)) != NULL) + { + /* + * Skip "." and ".."... + */ + + if (!strcmp(dent->d_name, ".") || !strcmp(dent->d_name, "..")) + continue; + + /* + * See if we have a file or directory... + */ + + snprintf(filename, sizeof(filename), "%s/%s", path, dent->d_name); + + if (stat(filename, &fileinfo)) + { + fprintf(stderr, "mxmldoc: Unable to stat \"%s\": %s\n", filename, + strerror(errno)); + closedir(dir); + return (0); + } + + if (S_ISDIR(fileinfo.st_mode)) + { + if (!remove_directory(filename)) + { + closedir(dir); + return (0); + } + } + else if (unlink(filename)) + { + fprintf(stderr, "mxmldoc: Unable to remove \"%s\": %s\n", filename, + strerror(errno)); + closedir(dir); + return (0); + } + } + + closedir(dir); + + if (rmdir(path)) + { + fprintf(stderr, "mxmldoc: Unable to remove directory \"%s\": %s\n", path, + strerror(errno)); + return (0); + } +#endif /* WIN32 */ + + return (1); +} + + +/* + * 'safe_strcpy()' - Copy a string allowing for overlapping strings. + */ + +static void +safe_strcpy(char *dst, /* I - Destination string */ + const char *src) /* I - Source string */ +{ + while (*src) + *dst++ = *src++; + + *dst = '\0'; +} + + +/* + * 'scan_file()' - Scan a source file. + */ + +static int /* O - 0 on success, -1 on error */ +scan_file(const char *filename, /* I - Filename */ + FILE *fp, /* I - File to scan */ + mxml_node_t *tree) /* I - Function tree */ +{ + int state, /* Current parser state */ + braces, /* Number of braces active */ + parens; /* Number of active parenthesis */ + int ch; /* Current character */ + char buffer[65536], /* String buffer */ + *bufptr; /* Pointer into buffer */ + const char *scope; /* Current variable/function scope */ + mxml_node_t *comment, /* node */ + *constant, /* node */ + *enumeration, /* node */ + *function, /* node */ + *fstructclass, /* function struct/class node */ + *structclass, /* or node */ + *typedefnode, /* node */ + *variable, /* or node */ + *returnvalue, /* node */ + *type, /* node */ + *description, /* node */ + *node, /* Current node */ + *next; /* Next node */ +#if DEBUG > 1 + mxml_node_t *temp; /* Temporary node */ + int oldstate, /* Previous state */ + oldch; /* Old character */ + static const char *states[] = /* State strings */ + { + "STATE_NONE", + "STATE_PREPROCESSOR", + "STATE_C_COMMENT", + "STATE_CXX_COMMENT", + "STATE_STRING", + "STATE_CHARACTER", + "STATE_IDENTIFIER" + }; +#endif /* DEBUG > 1 */ + + +#ifdef DEBUG + fprintf(stderr, "scan_file(filename=\"%s\", fp=%p, tree=%p)\n", filename, + fp, tree); +#endif /* DEBUG */ + + /* + * Initialize the finite state machine... + */ + + state = STATE_NONE; + braces = 0; + parens = 0; + bufptr = buffer; + + comment = mxmlNewElement(MXML_NO_PARENT, "temp"); + constant = NULL; + enumeration = NULL; + function = NULL; + variable = NULL; + returnvalue = NULL; + type = NULL; + description = NULL; + typedefnode = NULL; + structclass = NULL; + fstructclass = NULL; + + if (!strcmp(tree->value.element.name, "class")) + scope = "private"; + else + scope = NULL; + + /* + * Read until end-of-file... + */ + + while ((ch = getc(fp)) != EOF) + { +#if DEBUG > 1 + oldstate = state; + oldch = ch; +#endif /* DEBUG > 1 */ + + switch (state) + { + case STATE_NONE : /* No state - whitespace, etc. */ + switch (ch) + { + case '/' : /* Possible C/C++ comment */ + ch = getc(fp); + bufptr = buffer; + + if (ch == '*') + state = STATE_C_COMMENT; + else if (ch == '/') + state = STATE_CXX_COMMENT; + else + { + ungetc(ch, fp); + + if (type) + { +#ifdef DEBUG + fputs("Identifier: <<<< / >>>\n", stderr); +#endif /* DEBUG */ + ch = type->last_child->value.text.string[0]; + mxmlNewText(type, isalnum(ch) || ch == '_', "/"); + } + } + break; + + case '#' : /* Preprocessor */ +#ifdef DEBUG + fputs(" #preprocessor...\n", stderr); +#endif /* DEBUG */ + state = STATE_PREPROCESSOR; + break; + + case '\'' : /* Character constant */ + state = STATE_CHARACTER; + bufptr = buffer; + *bufptr++ = ch; + break; + + case '\"' : /* String constant */ + state = STATE_STRING; + bufptr = buffer; + *bufptr++ = ch; + break; + + case '{' : +#ifdef DEBUG + fprintf(stderr, " open brace, function=%p, type=%p...\n", + function, type); + if (type) + fprintf(stderr, " type->child=\"%s\"...\n", + type->child->value.text.string); +#endif /* DEBUG */ + + if (function) + { + if (fstructclass) + { + sort_node(fstructclass, function); + fstructclass = NULL; + } + else + sort_node(tree, function); + + function = NULL; + } + else if (type && type->child && + ((!strcmp(type->child->value.text.string, "typedef") && + type->child->next && + (!strcmp(type->child->next->value.text.string, "struct") || + !strcmp(type->child->next->value.text.string, "union") || + !strcmp(type->child->next->value.text.string, "class"))) || + !strcmp(type->child->value.text.string, "union") || + !strcmp(type->child->value.text.string, "struct") || + !strcmp(type->child->value.text.string, "class"))) + { + /* + * Start of a class or structure... + */ + + if (!strcmp(type->child->value.text.string, "typedef")) + { +#ifdef DEBUG + fputs(" starting typedef...\n", stderr); +#endif /* DEBUG */ + + typedefnode = mxmlNewElement(MXML_NO_PARENT, "typedef"); + mxmlDelete(type->child); + } + else + typedefnode = NULL; + + structclass = mxmlNewElement(MXML_NO_PARENT, + type->child->value.text.string); + +#ifdef DEBUG + fprintf(stderr, "%c%s: <<<< %s >>>\n", + toupper(type->child->value.text.string[0]), + type->child->value.text.string + 1, + type->child->next ? + type->child->next->value.text.string : "(noname)"); + + fputs(" type =", stderr); + for (node = type->child; node; node = node->next) + fprintf(stderr, " \"%s\"", node->value.text.string); + putc('\n', stderr); + + fprintf(stderr, " scope = %s\n", scope ? scope : "(null)"); +#endif /* DEBUG */ + + if (type->child->next) + { + mxmlElementSetAttr(structclass, "name", + type->child->next->value.text.string); + sort_node(tree, structclass); + } + + if (typedefnode && type->child) + type->child->value.text.whitespace = 0; + else if (structclass && type->child && + type->child->next && type->child->next->next) + { + for (bufptr = buffer, node = type->child->next->next; + node; + bufptr += strlen(bufptr)) + { + if (node->value.text.whitespace && bufptr > buffer) + *bufptr++ = ' '; + + strcpy(bufptr, node->value.text.string); + + next = node->next; + mxmlDelete(node); + node = next; + } + + mxmlElementSetAttr(structclass, "parent", buffer); + + mxmlDelete(type); + type = NULL; + } + else + { + mxmlDelete(type); + type = NULL; + } + + if (typedefnode && comment->last_child) + { + /* + * Copy comment for typedef as well as class/struct/union... + */ + + mxmlNewText(comment, 0, + comment->last_child->value.text.string); + description = mxmlNewElement(typedefnode, "description"); +#ifdef DEBUG + fprintf(stderr, + " duplicating comment %p/%p for typedef...\n", + comment->last_child, comment->child); +#endif /* DEBUG */ + update_comment(typedefnode, comment->last_child); + mxmlAdd(description, MXML_ADD_AFTER, MXML_ADD_TO_PARENT, + comment->last_child); + } + + description = mxmlNewElement(structclass, "description"); +#ifdef DEBUG + fprintf(stderr, " adding comment %p/%p to %s...\n", + comment->last_child, comment->child, + structclass->value.element.name); +#endif /* DEBUG */ + update_comment(structclass, comment->last_child); + mxmlAdd(description, MXML_ADD_AFTER, MXML_ADD_TO_PARENT, + comment->last_child); + + if (scan_file(filename, fp, structclass)) + { + mxmlDelete(comment); + return (-1); + } + +#ifdef DEBUG + fputs(" ended typedef...\n", stderr); +#endif /* DEBUG */ + structclass = NULL; + break; + } + else if (type && type->child && type->child->next && + (!strcmp(type->child->value.text.string, "enum") || + (!strcmp(type->child->value.text.string, "typedef") && + !strcmp(type->child->next->value.text.string, "enum")))) + { + /* + * Enumeration type... + */ + + if (!strcmp(type->child->value.text.string, "typedef")) + { +#ifdef DEBUG + fputs(" starting typedef...\n", stderr); +#endif /* DEBUG */ + + typedefnode = mxmlNewElement(MXML_NO_PARENT, "typedef"); + mxmlDelete(type->child); + } + else + typedefnode = NULL; + + enumeration = mxmlNewElement(MXML_NO_PARENT, "enumeration"); + +#ifdef DEBUG + fprintf(stderr, "Enumeration: <<<< %s >>>\n", + type->child->next ? + type->child->next->value.text.string : "(noname)"); +#endif /* DEBUG */ + + if (type->child->next) + { + mxmlElementSetAttr(enumeration, "name", + type->child->next->value.text.string); + sort_node(tree, enumeration); + } + + if (typedefnode && type->child) + type->child->value.text.whitespace = 0; + else + { + mxmlDelete(type); + type = NULL; + } + + if (typedefnode && comment->last_child) + { + /* + * Copy comment for typedef as well as class/struct/union... + */ + + mxmlNewText(comment, 0, + comment->last_child->value.text.string); + description = mxmlNewElement(typedefnode, "description"); +#ifdef DEBUG + fprintf(stderr, + " duplicating comment %p/%p for typedef...\n", + comment->last_child, comment->child); +#endif /* DEBUG */ + update_comment(typedefnode, comment->last_child); + mxmlAdd(description, MXML_ADD_AFTER, MXML_ADD_TO_PARENT, + comment->last_child); + } + + description = mxmlNewElement(enumeration, "description"); +#ifdef DEBUG + fprintf(stderr, " adding comment %p/%p to enumeration...\n", + comment->last_child, comment->child); +#endif /* DEBUG */ + update_comment(enumeration, comment->last_child); + mxmlAdd(description, MXML_ADD_AFTER, MXML_ADD_TO_PARENT, + comment->last_child); + } + else if (type && type->child && + !strcmp(type->child->value.text.string, "extern")) + { + if (scan_file(filename, fp, tree)) + { + mxmlDelete(comment); + return (-1); + } + } + else if (type) + { + mxmlDelete(type); + type = NULL; + } + + braces ++; + function = NULL; + variable = NULL; + break; + + case '}' : +#ifdef DEBUG + fputs(" close brace...\n", stderr); +#endif /* DEBUG */ + + if (structclass) + scope = NULL; + + if (!typedefnode) + enumeration = NULL; + + constant = NULL; + structclass = NULL; + + if (braces > 0) + braces --; + else + { + mxmlDelete(comment); + return (0); + } + break; + + case '(' : + if (type) + { +#ifdef DEBUG + fputs("Identifier: <<<< ( >>>\n", stderr); +#endif /* DEBUG */ + mxmlNewText(type, 0, "("); + } + + parens ++; + break; + + case ')' : + if (type && parens) + { +#ifdef DEBUG + fputs("Identifier: <<<< ) >>>\n", stderr); +#endif /* DEBUG */ + mxmlNewText(type, 0, ")"); + } + + if (function && type && !parens) + { + /* + * Check for "void" argument... + */ + + if (type->child && type->child->next) + variable = add_variable(function, "argument", type); + else + mxmlDelete(type); + + type = NULL; + } + + if (parens > 0) + parens --; + break; + + case ';' : +#ifdef DEBUG + fputs("Identifier: <<<< ; >>>\n", stderr); + fprintf(stderr, " enumeration=%p, function=%p, type=%p, type->child=%p, typedefnode=%p\n", + enumeration, function, type, type ? type->child : NULL, typedefnode); +#endif /* DEBUG */ + + if (function) + { + if (!strcmp(tree->value.element.name, "class")) + { +#ifdef DEBUG + fputs(" ADDING FUNCTION TO CLASS\n", stderr); +#endif /* DEBUG */ + sort_node(tree, function); + } + else + mxmlDelete(function); + + function = NULL; + variable = NULL; + } + + if (type) + { + /* + * See if we have a typedef... + */ + + if (type->child && + !strcmp(type->child->value.text.string, "typedef")) + { + /* + * Yes, add it! + */ + + typedefnode = mxmlNewElement(MXML_NO_PARENT, "typedef"); + + for (node = type->child->next; node; node = node->next) + if (!strcmp(node->value.text.string, "(")) + break; + + if (node) + { + for (node = node->next; node; node = node->next) + if (strcmp(node->value.text.string, "*")) + break; + } + + if (!node) + node = type->last_child; + +#ifdef DEBUG + fprintf(stderr, " ADDING TYPEDEF FOR %p(%s)...\n", + node, node->value.text.string); +#endif /* DEBUG */ + + mxmlElementSetAttr(typedefnode, "name", + node->value.text.string); + sort_node(tree, typedefnode); + + if (type->child != node) + mxmlDelete(type->child); + + mxmlDelete(node); + + if (type->child) + type->child->value.text.whitespace = 0; + + mxmlAdd(typedefnode, MXML_ADD_AFTER, MXML_ADD_TO_PARENT, + type); + type = NULL; + break; + } + else if (typedefnode && enumeration) + { + /* + * Add enum typedef... + */ + + node = type->child; + +#ifdef DEBUG + fprintf(stderr, " ADDING TYPEDEF FOR %p(%s)...\n", + node, node->value.text.string); +#endif /* DEBUG */ + + mxmlElementSetAttr(typedefnode, "name", + node->value.text.string); + sort_node(tree, typedefnode); + mxmlDelete(type); + + type = mxmlNewElement(typedefnode, "type"); + mxmlNewText(type, 0, "enum"); + mxmlNewText(type, 1, + mxmlElementGetAttr(enumeration, "name")); + enumeration = NULL; + type = NULL; + break; + } + + mxmlDelete(type); + type = NULL; + } + break; + + case ':' : + if (type) + { +#ifdef DEBUG + fputs("Identifier: <<<< : >>>\n", stderr); +#endif /* DEBUG */ + mxmlNewText(type, 1, ":"); + } + break; + + case '*' : + if (type) + { +#ifdef DEBUG + fputs("Identifier: <<<< * >>>\n", stderr); +#endif /* DEBUG */ + ch = type->last_child->value.text.string[0]; + mxmlNewText(type, isalnum(ch) || ch == '_', "*"); + } + break; + + case ',' : + if (type && !enumeration) + { +#ifdef DEBUG + fputs("Identifier: <<<< , >>>\n", stderr); +#endif /* DEBUG */ + mxmlNewText(type, 0, ","); + } + break; + + case '&' : + if (type) + { +#ifdef DEBUG + fputs("Identifier: <<<< & >>>\n", stderr); +#endif /* DEBUG */ + mxmlNewText(type, 1, "&"); + } + break; + + case '+' : + if (type) + { +#ifdef DEBUG + fputs("Identifier: <<<< + >>>\n", stderr); +#endif /* DEBUG */ + ch = type->last_child->value.text.string[0]; + mxmlNewText(type, isalnum(ch) || ch == '_', "+"); + } + break; + + case '-' : + if (type) + { +#ifdef DEBUG + fputs("Identifier: <<<< - >>>\n", stderr); +#endif /* DEBUG */ + ch = type->last_child->value.text.string[0]; + mxmlNewText(type, isalnum(ch) || ch == '_', "-"); + } + break; + + case '=' : + if (type) + { +#ifdef DEBUG + fputs("Identifier: <<<< = >>>\n", stderr); +#endif /* DEBUG */ + ch = type->last_child->value.text.string[0]; + mxmlNewText(type, isalnum(ch) || ch == '_', "="); + } + break; + + default : /* Other */ + if (isalnum(ch) || ch == '_' || ch == '.' || ch == ':' || ch == '~') + { + state = STATE_IDENTIFIER; + bufptr = buffer; + *bufptr++ = ch; + } + break; + } + break; + + case STATE_PREPROCESSOR : /* Preprocessor directive */ + if (ch == '\n') + state = STATE_NONE; + else if (ch == '\\') + getc(fp); + break; + + case STATE_C_COMMENT : /* Inside a C comment */ + switch (ch) + { + case '\n' : + while ((ch = getc(fp)) != EOF) + if (ch == '*') + { + ch = getc(fp); + + if (ch == '/') + { + *bufptr = '\0'; + + if (comment->child != comment->last_child) + { +#ifdef DEBUG + fprintf(stderr, " removing comment %p(%20.20s), last comment %p(%20.20s)...\n", + comment->child, + comment->child ? comment->child->value.text.string : "", + comment->last_child, + comment->last_child ? comment->last_child->value.text.string : ""); +#endif /* DEBUG */ + mxmlDelete(comment->child); +#ifdef DEBUG + fprintf(stderr, " new comment %p, last comment %p...\n", + comment->child, comment->last_child); +#endif /* DEBUG */ + } + +#ifdef DEBUG + fprintf(stderr, + " processing comment, variable=%p, " + "constant=%p, typedefnode=%p, tree=\"%s\"\n", + variable, constant, typedefnode, + tree->value.element.name); +#endif /* DEBUG */ + + if (variable) + { + if (strstr(buffer, "@private@")) + { + /* + * Delete private variables... + */ + + mxmlDelete(variable); + } + else + { + description = mxmlNewElement(variable, "description"); +#ifdef DEBUG + fprintf(stderr, + " adding comment %p/%p to variable...\n", + comment->last_child, comment->child); +#endif /* DEBUG */ + mxmlNewText(comment, 0, buffer); + update_comment(variable, + mxmlNewText(description, 0, buffer)); + } + + variable = NULL; + } + else if (constant) + { + if (strstr(buffer, "@private@")) + { + /* + * Delete private constants... + */ + + mxmlDelete(constant); + } + else + { + description = mxmlNewElement(constant, "description"); +#ifdef DEBUG + fprintf(stderr, + " adding comment %p/%p to constant...\n", + comment->last_child, comment->child); +#endif /* DEBUG */ + mxmlNewText(comment, 0, buffer); + update_comment(constant, + mxmlNewText(description, 0, buffer)); + } + + constant = NULL; + } + else if (typedefnode) + { + if (strstr(buffer, "@private@")) + { + /* + * Delete private typedefs... + */ + + mxmlDelete(typedefnode); + + if (structclass) + { + mxmlDelete(structclass); + structclass = NULL; + } + + if (enumeration) + { + mxmlDelete(enumeration); + enumeration = NULL; + } + } + else + { + description = mxmlNewElement(typedefnode, "description"); +#ifdef DEBUG + fprintf(stderr, + " adding comment %p/%p to typedef %s...\n", + comment->last_child, comment->child, + mxmlElementGetAttr(typedefnode, "name")); +#endif /* DEBUG */ + mxmlNewText(comment, 0, buffer); + update_comment(typedefnode, + mxmlNewText(description, 0, buffer)); + + if (structclass) + { + description = mxmlNewElement(structclass, "description"); + update_comment(structclass, + mxmlNewText(description, 0, buffer)); + } + else if (enumeration) + { + description = mxmlNewElement(enumeration, "description"); + update_comment(enumeration, + mxmlNewText(description, 0, buffer)); + } + } + + typedefnode = NULL; + } + else if (strcmp(tree->value.element.name, "mxmldoc") && + !mxmlFindElement(tree, tree, "description", + NULL, NULL, MXML_DESCEND_FIRST)) + { + description = mxmlNewElement(tree, "description"); +#ifdef DEBUG + fprintf(stderr, " adding comment %p/%p to parent...\n", + comment->last_child, comment->child); +#endif /* DEBUG */ + mxmlNewText(comment, 0, buffer); + update_comment(tree, + mxmlNewText(description, 0, buffer)); + } + else + { +#ifdef DEBUG + fprintf(stderr, " before adding comment, child=%p, last_child=%p\n", + comment->child, comment->last_child); +#endif /* DEBUG */ + mxmlNewText(comment, 0, buffer); +#ifdef DEBUG + fprintf(stderr, " after adding comment, child=%p, last_child=%p\n", + comment->child, comment->last_child); +#endif /* DEBUG */ + } +#ifdef DEBUG + fprintf(stderr, "C comment: <<<< %s >>>\n", buffer); +#endif /* DEBUG */ + + state = STATE_NONE; + break; + } + else + ungetc(ch, fp); + } + else if (ch == '\n' && bufptr > buffer && + bufptr < (buffer + sizeof(buffer) - 1)) + *bufptr++ = ch; + else if (!isspace(ch)) + break; + + if (ch != EOF) + ungetc(ch, fp); + + if (bufptr > buffer && bufptr < (buffer + sizeof(buffer) - 1)) + *bufptr++ = '\n'; + break; + + case '/' : + if (ch == '/' && bufptr > buffer && bufptr[-1] == '*') + { + while (bufptr > buffer && + (bufptr[-1] == '*' || isspace(bufptr[-1] & 255))) + bufptr --; + *bufptr = '\0'; + + if (comment->child != comment->last_child) + { +#ifdef DEBUG + fprintf(stderr, " removing comment %p(%20.20s), last comment %p(%20.20s)...\n", + comment->child, + comment->child ? comment->child->value.text.string : "", + comment->last_child, + comment->last_child ? comment->last_child->value.text.string : ""); +#endif /* DEBUG */ + mxmlDelete(comment->child); +#ifdef DEBUG + fprintf(stderr, " new comment %p, last comment %p...\n", + comment->child, comment->last_child); +#endif /* DEBUG */ + } + +#ifdef DEBUG + fprintf(stderr, + " processing comment, variable=%p, " + "constant=%p, typedefnode=%p, tree=\"%s\"\n", + variable, constant, typedefnode, + tree->value.element.name); +#endif /* DEBUG */ + + if (variable) + { + if (strstr(buffer, "@private@")) + { + /* + * Delete private variables... + */ + + mxmlDelete(variable); + } + else + { + description = mxmlNewElement(variable, "description"); +#ifdef DEBUG + fprintf(stderr, " adding comment %p/%p to variable...\n", + comment->last_child, comment->child); +#endif /* DEBUG */ + mxmlNewText(comment, 0, buffer); + update_comment(variable, + mxmlNewText(description, 0, buffer)); + } + + variable = NULL; + } + else if (constant) + { + if (strstr(buffer, "@private@")) + { + /* + * Delete private constants... + */ + + mxmlDelete(constant); + } + else + { + description = mxmlNewElement(constant, "description"); +#ifdef DEBUG + fprintf(stderr, " adding comment %p/%p to constant...\n", + comment->last_child, comment->child); +#endif /* DEBUG */ + mxmlNewText(comment, 0, buffer); + update_comment(constant, + mxmlNewText(description, 0, buffer)); + } + + constant = NULL; + } + else if (typedefnode) + { + if (strstr(buffer, "@private@")) + { + /* + * Delete private typedefs... + */ + + mxmlDelete(typedefnode); + + if (structclass) + { + mxmlDelete(structclass); + structclass = NULL; + } + + if (enumeration) + { + mxmlDelete(enumeration); + enumeration = NULL; + } + } + else + { + description = mxmlNewElement(typedefnode, "description"); +#ifdef DEBUG + fprintf(stderr, + " adding comment %p/%p to typedef %s...\n", + comment->last_child, comment->child, + mxmlElementGetAttr(typedefnode, "name")); +#endif /* DEBUG */ + mxmlNewText(comment, 0, buffer); + update_comment(typedefnode, + mxmlNewText(description, 0, buffer)); + + if (structclass) + { + description = mxmlNewElement(structclass, "description"); + update_comment(structclass, + mxmlNewText(description, 0, buffer)); + } + else if (enumeration) + { + description = mxmlNewElement(enumeration, "description"); + update_comment(enumeration, + mxmlNewText(description, 0, buffer)); + } + } + + typedefnode = NULL; + } + else if (strcmp(tree->value.element.name, "mxmldoc") && + !mxmlFindElement(tree, tree, "description", + NULL, NULL, MXML_DESCEND_FIRST)) + { + description = mxmlNewElement(tree, "description"); +#ifdef DEBUG + fprintf(stderr, " adding comment %p/%p to parent...\n", + comment->last_child, comment->child); +#endif /* DEBUG */ + mxmlNewText(comment, 0, buffer); + update_comment(tree, + mxmlNewText(description, 0, buffer)); + } + else + mxmlNewText(comment, 0, buffer); + +#ifdef DEBUG + fprintf(stderr, "C comment: <<<< %s >>>\n", buffer); +#endif /* DEBUG */ + + state = STATE_NONE; + break; + } + + default : + if (ch == ' ' && bufptr == buffer) + break; + + if (bufptr < (buffer + sizeof(buffer) - 1)) + *bufptr++ = ch; + break; + } + break; + + case STATE_CXX_COMMENT : /* Inside a C++ comment */ + if (ch == '\n') + { + state = STATE_NONE; + *bufptr = '\0'; + + if (comment->child != comment->last_child) + { +#ifdef DEBUG + fprintf(stderr, " removing comment %p(%20.20s), last comment %p(%20.20s)...\n", + comment->child, + comment->child ? comment->child->value.text.string : "", + comment->last_child, + comment->last_child ? comment->last_child->value.text.string : ""); +#endif /* DEBUG */ + mxmlDelete(comment->child); +#ifdef DEBUG + fprintf(stderr, " new comment %p, last comment %p...\n", + comment->child, comment->last_child); +#endif /* DEBUG */ + } + + if (variable) + { + if (strstr(buffer, "@private@")) + { + /* + * Delete private variables... + */ + + mxmlDelete(variable); + } + else + { + description = mxmlNewElement(variable, "description"); +#ifdef DEBUG + fprintf(stderr, " adding comment %p/%p to variable...\n", + comment->last_child, comment->child); +#endif /* DEBUG */ + mxmlNewText(comment, 0, buffer); + update_comment(variable, + mxmlNewText(description, 0, buffer)); + } + + variable = NULL; + } + else if (constant) + { + if (strstr(buffer, "@private@")) + { + /* + * Delete private constants... + */ + + mxmlDelete(constant); + } + else + { + description = mxmlNewElement(constant, "description"); +#ifdef DEBUG + fprintf(stderr, " adding comment %p/%p to constant...\n", + comment->last_child, comment->child); +#endif /* DEBUG */ + mxmlNewText(comment, 0, buffer); + update_comment(constant, + mxmlNewText(description, 0, buffer)); + } + + constant = NULL; + } + else if (typedefnode) + { + if (strstr(buffer, "@private@")) + { + /* + * Delete private typedefs... + */ + + mxmlDelete(typedefnode); + typedefnode = NULL; + + if (structclass) + { + mxmlDelete(structclass); + structclass = NULL; + } + + if (enumeration) + { + mxmlDelete(enumeration); + enumeration = NULL; + } + } + else + { + description = mxmlNewElement(typedefnode, "description"); +#ifdef DEBUG + fprintf(stderr, " adding comment %p/%p to typedef %s...\n", + comment->last_child, comment->child, + mxmlElementGetAttr(typedefnode, "name")); +#endif /* DEBUG */ + mxmlNewText(comment, 0, buffer); + update_comment(typedefnode, + mxmlNewText(description, 0, buffer)); + + if (structclass) + { + description = mxmlNewElement(structclass, "description"); + update_comment(structclass, + mxmlNewText(description, 0, buffer)); + } + else if (enumeration) + { + description = mxmlNewElement(enumeration, "description"); + update_comment(enumeration, + mxmlNewText(description, 0, buffer)); + } + } + } + else if (strcmp(tree->value.element.name, "mxmldoc") && + !mxmlFindElement(tree, tree, "description", + NULL, NULL, MXML_DESCEND_FIRST)) + { + description = mxmlNewElement(tree, "description"); +#ifdef DEBUG + fprintf(stderr, " adding comment %p/%p to parent...\n", + comment->last_child, comment->child); +#endif /* DEBUG */ + mxmlNewText(comment, 0, buffer); + update_comment(tree, + mxmlNewText(description, 0, buffer)); + } + else + mxmlNewText(comment, 0, buffer); + +#ifdef DEBUG + fprintf(stderr, "C++ comment: <<<< %s >>>\n", buffer); +#endif /* DEBUG */ + } + else if (ch == ' ' && bufptr == buffer) + break; + else if (bufptr < (buffer + sizeof(buffer) - 1)) + *bufptr++ = ch; + break; + + case STATE_STRING : /* Inside a string constant */ + *bufptr++ = ch; + + if (ch == '\\') + *bufptr++ = getc(fp); + else if (ch == '\"') + { + *bufptr = '\0'; + + if (type) + mxmlNewText(type, type->child != NULL, buffer); + + state = STATE_NONE; + } + break; + + case STATE_CHARACTER : /* Inside a character constant */ + *bufptr++ = ch; + + if (ch == '\\') + *bufptr++ = getc(fp); + else if (ch == '\'') + { + *bufptr = '\0'; + + if (type) + mxmlNewText(type, type->child != NULL, buffer); + + state = STATE_NONE; + } + break; + + case STATE_IDENTIFIER : /* Inside a keyword or identifier */ + if (isalnum(ch) || ch == '_' || ch == '[' || ch == ']' || + (ch == ',' && (parens > 1 || (type && !enumeration && !function))) || + ch == ':' || ch == '.' || ch == '~') + { + if (bufptr < (buffer + sizeof(buffer) - 1)) + *bufptr++ = ch; + } + else + { + ungetc(ch, fp); + *bufptr = '\0'; + state = STATE_NONE; + +#ifdef DEBUG + fprintf(stderr, " braces=%d, type=%p, type->child=%p, buffer=\"%s\"\n", + braces, type, type ? type->child : NULL, buffer); +#endif /* DEBUG */ + + if (!braces) + { + if (!type || !type->child) + { + if (!strcmp(tree->value.element.name, "class")) + { + if (!strcmp(buffer, "public") || + !strcmp(buffer, "public:")) + { + scope = "public"; +#ifdef DEBUG + fputs(" scope = public\n", stderr); +#endif /* DEBUG */ + break; + } + else if (!strcmp(buffer, "private") || + !strcmp(buffer, "private:")) + { + scope = "private"; +#ifdef DEBUG + fputs(" scope = private\n", stderr); +#endif /* DEBUG */ + break; + } + else if (!strcmp(buffer, "protected") || + !strcmp(buffer, "protected:")) + { + scope = "protected"; +#ifdef DEBUG + fputs(" scope = protected\n", stderr); +#endif /* DEBUG */ + break; + } + } + } + + if (!type) + type = mxmlNewElement(MXML_NO_PARENT, "type"); + +#ifdef DEBUG + fprintf(stderr, " function=%p (%s), type->child=%p, ch='%c', parens=%d\n", + function, + function ? mxmlElementGetAttr(function, "name") : "null", + type->child, ch, parens); +#endif /* DEBUG */ + + if (!function && ch == '(') + { + if (type->child && + !strcmp(type->child->value.text.string, "extern")) + { + /* + * Remove external declarations... + */ + + mxmlDelete(type); + type = NULL; + break; + } + + if (type->child && + !strcmp(type->child->value.text.string, "static") && + !strcmp(tree->value.element.name, "mxmldoc")) + { + /* + * Remove static functions... + */ + + mxmlDelete(type); + type = NULL; + break; + } + + function = mxmlNewElement(MXML_NO_PARENT, "function"); + if ((bufptr = strchr(buffer, ':')) != NULL && bufptr[1] == ':') + { + *bufptr = '\0'; + bufptr += 2; + + if ((fstructclass = + mxmlFindElement(tree, tree, "class", "name", buffer, + MXML_DESCEND_FIRST)) == NULL) + fstructclass = + mxmlFindElement(tree, tree, "struct", "name", buffer, + MXML_DESCEND_FIRST); + } + else + bufptr = buffer; + + mxmlElementSetAttr(function, "name", bufptr); + + if (scope) + mxmlElementSetAttr(function, "scope", scope); + +#ifdef DEBUG + fprintf(stderr, "function: %s\n", buffer); + fprintf(stderr, " scope = %s\n", scope ? scope : "(null)"); + fprintf(stderr, " comment = %p\n", comment); + fprintf(stderr, " child = (%p) %s\n", + comment->child, + comment->child ? + comment->child->value.text.string : "(null)"); + fprintf(stderr, " last_child = (%p) %s\n", + comment->last_child, + comment->last_child ? + comment->last_child->value.text.string : "(null)"); +#endif /* DEBUG */ + + if (type->last_child && + strcmp(type->last_child->value.text.string, "void")) + { + returnvalue = mxmlNewElement(function, "returnvalue"); + + mxmlAdd(returnvalue, MXML_ADD_AFTER, MXML_ADD_TO_PARENT, type); + + description = mxmlNewElement(returnvalue, "description"); +#ifdef DEBUG + fprintf(stderr, " adding comment %p/%p to returnvalue...\n", + comment->last_child, comment->child); +#endif /* DEBUG */ + update_comment(returnvalue, comment->last_child); + mxmlAdd(description, MXML_ADD_AFTER, MXML_ADD_TO_PARENT, + comment->last_child); + } + else + mxmlDelete(type); + + description = mxmlNewElement(function, "description"); +#ifdef DEBUG + fprintf(stderr, " adding comment %p/%p to function...\n", + comment->last_child, comment->child); +#endif /* DEBUG */ + update_comment(function, comment->last_child); + mxmlAdd(description, MXML_ADD_AFTER, MXML_ADD_TO_PARENT, + comment->last_child); + + type = NULL; + } + else if (function && ((ch == ')' && parens == 1) || ch == ',')) + { + /* + * Argument definition... + */ + + if (strcmp(buffer, "void")) + { + mxmlNewText(type, type->child != NULL && + type->last_child->value.text.string[0] != '(' && + type->last_child->value.text.string[0] != '*', + buffer); + +#ifdef DEBUG + fprintf(stderr, "Argument: <<<< %s >>>\n", buffer); +#endif /* DEBUG */ + + variable = add_variable(function, "argument", type); + } + else + mxmlDelete(type); + + type = NULL; + } + else if (type->child && !function && (ch == ';' || ch == ',')) + { +#ifdef DEBUG + fprintf(stderr, " got semicolon, typedefnode=%p, structclass=%p\n", + typedefnode, structclass); +#endif /* DEBUG */ + + if (typedefnode || structclass) + { +#ifdef DEBUG + fprintf(stderr, "Typedef/struct/class: <<<< %s >>>>\n", buffer); +#endif /* DEBUG */ + + if (typedefnode) + { + mxmlElementSetAttr(typedefnode, "name", buffer); + + sort_node(tree, typedefnode); + } + + if (structclass && !mxmlElementGetAttr(structclass, "name")) + { +#ifdef DEBUG + fprintf(stderr, "setting struct/class name to %s!\n", + type->last_child->value.text.string); +#endif /* DEBUG */ + mxmlElementSetAttr(structclass, "name", buffer); + + sort_node(tree, structclass); + structclass = NULL; + } + + if (typedefnode) + mxmlAdd(typedefnode, MXML_ADD_BEFORE, MXML_ADD_TO_PARENT, + type); + else + mxmlDelete(type); + + type = NULL; + typedefnode = NULL; + } + else if (type->child && + !strcmp(type->child->value.text.string, "typedef")) + { + /* + * Simple typedef... + */ + +#ifdef DEBUG + fprintf(stderr, "Typedef: <<<< %s >>>\n", buffer); +#endif /* DEBUG */ + + typedefnode = mxmlNewElement(MXML_NO_PARENT, "typedef"); + mxmlElementSetAttr(typedefnode, "name", buffer); + mxmlDelete(type->child); + + sort_node(tree, typedefnode); + + if (type->child) + type->child->value.text.whitespace = 0; + + mxmlAdd(typedefnode, MXML_ADD_AFTER, MXML_ADD_TO_PARENT, type); + type = NULL; + } + else if (!parens) + { + /* + * Variable definition... + */ + + if (type->child && + !strcmp(type->child->value.text.string, "static") && + !strcmp(tree->value.element.name, "mxmldoc")) + { + /* + * Remove static functions... + */ + + mxmlDelete(type); + type = NULL; + break; + } + + mxmlNewText(type, type->child != NULL && + type->last_child->value.text.string[0] != '(' && + type->last_child->value.text.string[0] != '*', + buffer); + +#ifdef DEBUG + fprintf(stderr, "Variable: <<<< %s >>>>\n", buffer); + fprintf(stderr, " scope = %s\n", scope ? scope : "(null)"); +#endif /* DEBUG */ + + variable = add_variable(MXML_NO_PARENT, "variable", type); + type = NULL; + + sort_node(tree, variable); + + if (scope) + mxmlElementSetAttr(variable, "scope", scope); + } + } + else + { +#ifdef DEBUG + fprintf(stderr, "Identifier: <<<< %s >>>>\n", buffer); +#endif /* DEBUG */ + + mxmlNewText(type, type->child != NULL && + type->last_child->value.text.string[0] != '(' && + type->last_child->value.text.string[0] != '*', + buffer); + } + } + else if (enumeration && !isdigit(buffer[0] & 255)) + { +#ifdef DEBUG + fprintf(stderr, "Constant: <<<< %s >>>\n", buffer); +#endif /* DEBUG */ + + constant = mxmlNewElement(MXML_NO_PARENT, "constant"); + mxmlElementSetAttr(constant, "name", buffer); + sort_node(enumeration, constant); + } + else if (type) + { + mxmlDelete(type); + type = NULL; + } + } + break; + } + +#if DEBUG > 1 + if (state != oldstate) + { + fprintf(stderr, " changed states from %s to %s on receipt of character '%c'...\n", + states[oldstate], states[state], oldch); + fprintf(stderr, " variable = %p\n", variable); + if (type) + { + fputs(" type =", stderr); + for (temp = type->child; temp; temp = temp->next) + fprintf(stderr, " \"%s\"", temp->value.text.string); + fputs("\n", stderr); + } + } +#endif /* DEBUG > 1 */ + } + + mxmlDelete(comment); + + /* + * All done, return with no errors... + */ + + return (0); +} + + +/* + * 'sort_node()' - Insert a node sorted into a tree. + */ + +static void +sort_node(mxml_node_t *tree, /* I - Tree to sort into */ + mxml_node_t *node) /* I - Node to add */ +{ + mxml_node_t *temp; /* Current node */ + const char *tempname, /* Name of current node */ + *nodename, /* Name of node */ + *scope; /* Scope */ + + +#if DEBUG > 1 + fprintf(stderr, " sort_node(tree=%p, node=%p)\n", tree, node); +#endif /* DEBUG > 1 */ + + /* + * Range check input... + */ + + if (!tree || !node || node->parent == tree) + return; + + /* + * Get the node name... + */ + + if ((nodename = mxmlElementGetAttr(node, "name")) == NULL) + return; + + if (nodename[0] == '_') + return; /* Hide private names */ + +#if DEBUG > 1 + fprintf(stderr, " nodename=%p (\"%s\")\n", nodename, nodename); +#endif /* DEBUG > 1 */ + + /* + * Delete any existing definition at this level, if one exists... + */ + + if ((temp = mxmlFindElement(tree, tree, node->value.element.name, + "name", nodename, MXML_DESCEND_FIRST)) != NULL) + { + /* + * Copy the scope if needed... + */ + + if ((scope = mxmlElementGetAttr(temp, "scope")) != NULL && + mxmlElementGetAttr(node, "scope") == NULL) + { +#ifdef DEBUG + fprintf(stderr, " copying scope %s for %s\n", scope, nodename); +#endif /* DEBUG */ + + mxmlElementSetAttr(node, "scope", scope); + } + + mxmlDelete(temp); + } + + /* + * Add the node into the tree at the proper place... + */ + + for (temp = tree->child; temp; temp = temp->next) + { +#if DEBUG > 1 + fprintf(stderr, " temp=%p\n", temp); +#endif /* DEBUG > 1 */ + + if ((tempname = mxmlElementGetAttr(temp, "name")) == NULL) + continue; + +#if DEBUG > 1 + fprintf(stderr, " tempname=%p (\"%s\")\n", tempname, tempname); +#endif /* DEBUG > 1 */ + + if (strcmp(nodename, tempname) < 0) + break; + } + + if (temp) + mxmlAdd(tree, MXML_ADD_BEFORE, temp, node); + else + mxmlAdd(tree, MXML_ADD_AFTER, MXML_ADD_TO_PARENT, node); +} + + +/* + * 'update_comment()' - Update a comment node. + */ + +static void +update_comment(mxml_node_t *parent, /* I - Parent node */ + mxml_node_t *comment) /* I - Comment node */ +{ + char *ptr; /* Pointer into comment */ + + +#ifdef DEBUG + fprintf(stderr, "update_comment(parent=%p, comment=%p)\n", + parent, comment); +#endif /* DEBUG */ + + /* + * Range check the input... + */ + + if (!parent || !comment) + return; + + /* + * Update the comment... + */ + + ptr = comment->value.text.string; + + if (*ptr == '\'') + { + /* + * Convert "'name()' - description" to "description". + */ + + for (ptr ++; *ptr && *ptr != '\''; ptr ++); + + if (*ptr == '\'') + { + ptr ++; + while (isspace(*ptr & 255)) + ptr ++; + + if (*ptr == '-') + ptr ++; + + while (isspace(*ptr & 255)) + ptr ++; + + safe_strcpy(comment->value.text.string, ptr); + } + } + else if (!strncmp(ptr, "I ", 2) || !strncmp(ptr, "O ", 2) || + !strncmp(ptr, "IO ", 3)) + { + /* + * 'Convert "I - description", "IO - description", or "O - description" + * to description + directory attribute. + */ + + ptr = strchr(ptr, ' '); + *ptr++ = '\0'; + + if (!strcmp(parent->value.element.name, "argument")) + mxmlElementSetAttr(parent, "direction", comment->value.text.string); + + while (isspace(*ptr & 255)) + ptr ++; + + if (*ptr == '-') + ptr ++; + + while (isspace(*ptr & 255)) + ptr ++; + + safe_strcpy(comment->value.text.string, ptr); + } + + /* + * Eliminate leading and trailing *'s... + */ + + for (ptr = comment->value.text.string; *ptr == '*'; ptr ++); + for (; isspace(*ptr & 255); ptr ++); + if (ptr > comment->value.text.string) + safe_strcpy(comment->value.text.string, ptr); + + for (ptr = comment->value.text.string + strlen(comment->value.text.string) - 1; + ptr > comment->value.text.string && *ptr == '*'; + ptr --) + *ptr = '\0'; + for (; ptr > comment->value.text.string && isspace(*ptr & 255); ptr --) + *ptr = '\0'; + +#ifdef DEBUG + fprintf(stderr, " updated comment = %s\n", comment->value.text.string); +#endif /* DEBUG */ +} + + +/* + * 'usage()' - Show program usage... + */ + +static void +usage(const char *option) /* I - Unknown option */ +{ + if (option) + printf("mxmldoc: Bad option \"%s\"!\n\n", option); + + puts("Usage: mxmldoc [options] [filename.xml] [source files] >filename.html"); + puts("Options:"); + puts(" --css filename.css Set CSS stylesheet file"); + puts(" --docset bundleid.docset Generate documentation set"); + puts(" --docversion version Set documentation version"); + puts(" --feedname name Set documentation set feed name"); + puts(" --feedurl url Set documentation set feed URL"); + puts(" --footer footerfile Set footer file"); + puts(" --framed basename Generate framed HTML to basename*.html"); + puts(" --header headerfile Set header file"); + puts(" --intro introfile Set introduction file"); + puts(" --man name Generate man page"); + puts(" --no-output Do no generate documentation file"); + puts(" --section section Set section name"); + puts(" --title title Set documentation title"); + puts(" --tokens path Generate Xcode docset Tokens.xml file"); + + exit(1); +} + + +/* + * 'write_description()' - Write the description text. + */ + +static void +write_description( + FILE *out, /* I - Output file */ + mxml_node_t *description, /* I - Description node */ + const char *element, /* I - HTML element, if any */ + int summary) /* I - Show summary */ +{ + char text[10240], /* Text for description */ + *start, /* Start of code/link */ + *ptr; /* Pointer into text */ + int col; /* Current column */ + + + if (!description) + return; + + get_text(description, text, sizeof(text)); + + ptr = strstr(text, "\n\n"); + + if (summary) + { + if (ptr) + *ptr = '\0'; + + ptr = text; + } + else if (!ptr || !ptr[2]) + return; + else + ptr += 2; + + if (element && *element) + fprintf(out, "<%s class=\"%s\">", element, + summary ? "description" : "discussion"); + else if (!summary) + fputs(".PP\n", out); + + for (col = 0; *ptr; ptr ++) + { + if (*ptr == '@' && + (!strncmp(ptr + 1, "deprecated@", 11) || + !strncmp(ptr + 1, "since ", 6))) + { + ptr ++; + while (*ptr && *ptr != '@') + ptr ++; + + if (!*ptr) + return; + } + else if (!strncmp(ptr, "@code ", 6)) + { + for (ptr += 6; isspace(*ptr & 255); ptr ++); + + for (start = ptr, ptr ++; *ptr && *ptr != '@'; ptr ++); + + if (*ptr) + *ptr = '\0'; + else + ptr --; + + if (element && *element) + fprintf(out, "%s", start); + else if (element) + fputs(start, out); + else + fprintf(out, "\\fB%s\\fR", start); + } + else if (!strncmp(ptr, "@link ", 6)) + { + for (ptr += 6; isspace(*ptr & 255); ptr ++); + + for (start = ptr, ptr ++; *ptr && *ptr != '@'; ptr ++); + + if (*ptr) + *ptr = '\0'; + else + ptr --; + + if (element && *element) + fprintf(out, "%s", start, start); + else if (element) + fputs(start, out); + else + fprintf(out, "\\fI%s\\fR", start); + } + else if (element) + { + if (*ptr == '&') + fputs("&", out); + else if (*ptr == '<') + fputs("<", out); + else if (*ptr == '>') + fputs(">", out); + else if (*ptr == '\"') + fputs(""", out); + else if (*ptr & 128) + { + /* + * Convert UTF-8 to Unicode constant... + */ + + int ch; /* Unicode character */ + + + ch = *ptr & 255; + + if ((ch & 0xe0) == 0xc0) + { + ch = ((ch & 0x1f) << 6) | (ptr[1] & 0x3f); + ptr ++; + } + else if ((ch & 0xf0) == 0xe0) + { + ch = ((((ch * 0x0f) << 6) | (ptr[1] & 0x3f)) << 6) | (ptr[2] & 0x3f); + ptr += 2; + } + + if (ch == 0xa0) + { + /* + * Handle non-breaking space as-is... + */ + + fputs(" ", out); + } + else + fprintf(out, "&#x%x;", ch); + } + else if (*ptr == '\n' && ptr[1] == '\n' && ptr[2] && ptr[2] != '@') + { + fputs("
      \n
      \n", out); + ptr ++; + } + else + putc(*ptr, out); + } + else if (*ptr == '\n' && ptr[1] == '\n' && ptr[2] && ptr[2] != '@') + { + fputs("\n.PP\n", out); + ptr ++; + } + else + { + if (*ptr == '\\' || (*ptr == '.' && col == 0)) + putc('\\', out); + + putc(*ptr, out); + + if (*ptr == '\n') + col = 0; + else + col ++; + } + } + + if (element && *element) + fprintf(out, "\n", element); + else if (!element) + putc('\n', out); +} + + +/* + * 'write_element()' - Write an element's text nodes. + */ + +static void +write_element(FILE *out, /* I - Output file */ + mxml_node_t *doc, /* I - Document tree */ + mxml_node_t *element, /* I - Element to write */ + int mode) /* I - Output mode */ +{ + mxml_node_t *node; /* Current node */ + + + if (!element) + return; + + for (node = element->child; + node; + node = mxmlWalkNext(node, element, MXML_NO_DESCEND)) + if (node->type == MXML_TEXT) + { + if (node->value.text.whitespace) + putc(' ', out); + + if (mode == OUTPUT_HTML && + (mxmlFindElement(doc, doc, "class", "name", node->value.text.string, + MXML_DESCEND) || + mxmlFindElement(doc, doc, "enumeration", "name", + node->value.text.string, MXML_DESCEND) || + mxmlFindElement(doc, doc, "struct", "name", node->value.text.string, + MXML_DESCEND) || + mxmlFindElement(doc, doc, "typedef", "name", node->value.text.string, + MXML_DESCEND) || + mxmlFindElement(doc, doc, "union", "name", node->value.text.string, + MXML_DESCEND))) + { + fputs("value.text.string, mode); + fputs("\">", out); + write_string(out, node->value.text.string, mode); + fputs("", out); + } + else + write_string(out, node->value.text.string, mode); + } + + if (!strcmp(element->value.element.name, "type") && + element->last_child->value.text.string[0] != '*') + putc(' ', out); +} + + +/* + * 'write_file()' - Copy a file to the output. + */ + +static void +write_file(FILE *out, /* I - Output file */ + const char *file) /* I - File to copy */ +{ + FILE *fp; /* Copy file */ + char line[8192]; /* Line from file */ + + + if ((fp = fopen(file, "r")) == NULL) + { + fprintf(stderr, "mxmldoc: Unable to open \"%s\": %s\n", file, + strerror(errno)); + return; + } + + while (fgets(line, sizeof(line), fp)) + fputs(line, out); + + fclose(fp); +} + + +/* + * 'write_function()' - Write documentation for a function. + */ + +static void +write_function(FILE *out, /* I - Output file */ + mxml_node_t *doc, /* I - Document */ + mxml_node_t *function, /* I - Function */ + int level) /* I - Base heading level */ +{ + mxml_node_t *arg, /* Current argument */ + *adesc, /* Description of argument */ + *description, /* Description of function */ + *type, /* Type for argument */ + *node; /* Node in description */ + const char *name, /* Name of function/type */ + *defval; /* Default value */ + char prefix; /* Prefix character */ + char *sep; /* Newline separator */ + + + name = mxmlElementGetAttr(function, "name"); + description = mxmlFindElement(function, function, "description", NULL, + NULL, MXML_DESCEND_FIRST); + + fprintf(out, "%s%s\n", + level, level == 3 ? "function" : "method", + get_comment_info(description), name, name, level); + + if (description) + write_description(out, description, "p", 1); + + fputs("

      \n", out); + + arg = mxmlFindElement(function, function, "returnvalue", NULL, + NULL, MXML_DESCEND_FIRST); + + if (arg) + write_element(out, doc, mxmlFindElement(arg, arg, "type", NULL, + NULL, MXML_DESCEND_FIRST), + OUTPUT_HTML); + else + fputs("void ", out); + + fprintf(out, "%s ", name); + for (arg = mxmlFindElement(function, function, "argument", NULL, NULL, + MXML_DESCEND_FIRST), prefix = '('; + arg; + arg = mxmlFindElement(arg, function, "argument", NULL, NULL, + MXML_NO_DESCEND), prefix = ',') + { + type = mxmlFindElement(arg, arg, "type", NULL, NULL, + MXML_DESCEND_FIRST); + + fprintf(out, "%c
      \n    ", prefix); + if (type->child) + write_element(out, doc, type, OUTPUT_HTML); + + fputs(mxmlElementGetAttr(arg, "name"), out); + if ((defval = mxmlElementGetAttr(arg, "default")) != NULL) + fprintf(out, " %s", defval); + } + + if (prefix == '(') + fputs("(void);

      \n", out); + else + { + fprintf(out, + "
      \n);

      \n" + "Parameters\n" + "
      \n", level + 1, level + 1); + + for (arg = mxmlFindElement(function, function, "argument", NULL, NULL, + MXML_DESCEND_FIRST); + arg; + arg = mxmlFindElement(arg, function, "argument", NULL, NULL, + MXML_NO_DESCEND)) + { + fprintf(out, "
      %s
      \n", mxmlElementGetAttr(arg, "name")); + + adesc = mxmlFindElement(arg, arg, "description", NULL, NULL, + MXML_DESCEND_FIRST); + + write_description(out, adesc, "dd", 1); + write_description(out, adesc, "dd", 0); + } + + fputs("
      \n", out); + } + + arg = mxmlFindElement(function, function, "returnvalue", NULL, + NULL, MXML_DESCEND_FIRST); + + if (arg) + { + fprintf(out, "Return Value\n", level + 1, + level + 1); + + adesc = mxmlFindElement(arg, arg, "description", NULL, NULL, + MXML_DESCEND_FIRST); + + write_description(out, adesc, "p", 1); + write_description(out, adesc, "p", 0); + } + + if (description) + { + for (node = description->child; node; node = node->next) + if (node->value.text.string && + (sep = strstr(node->value.text.string, "\n\n")) != NULL) + { + sep += 2; + if (*sep && strncmp(sep, "@since ", 7) && + strncmp(sep, "@deprecated@", 12)) + break; + } + + if (node) + { + fprintf(out, "Discussion\n", level + 1, + level + 1); + write_description(out, description, "p", 0); + } + } +} + + +/* + * 'write_html()' - Write HTML documentation. + */ + +static void +write_html(const char *section, /* I - Section */ + const char *title, /* I - Title */ + const char *footerfile, /* I - Footer file */ + const char *headerfile, /* I - Header file */ + const char *introfile, /* I - Intro file */ + const char *cssfile, /* I - Stylesheet file */ + const char *framefile, /* I - Framed HTML basename */ + const char *docset, /* I - Documentation set directory */ + const char *docversion, /* I - Documentation set version */ + const char *feedname, /* I - Feed name for doc set */ + const char *feedurl, /* I - Feed URL for doc set */ + mxml_node_t *doc) /* I - XML documentation */ +{ + FILE *out; /* Output file */ + mxml_node_t *function, /* Current function */ + *scut, /* Struct/class/union/typedef */ + *arg, /* Current argument */ + *description, /* Description of function/var */ + *type; /* Type for argument */ + const char *name, /* Name of function/type */ + *defval, /* Default value */ + *basename; /* Base filename for framed output */ + char filename[1024]; /* Current output filename */ + + + if (framefile) + { + /* + * Get the basename of the frame file... + */ + + if ((basename = strrchr(framefile, '/')) != NULL) + basename ++; + else + basename = framefile; + + if (strstr(basename, ".html")) + fputs("mxmldoc: Frame base name should not contain .html extension!\n", + stderr); + + /* + * Create the container HTML file for the frames... + */ + + snprintf(filename, sizeof(filename), "%s.html", framefile); + + if ((out = fopen(filename, "w")) == NULL) + { + fprintf(stderr, "mxmldoc: Unable to create \"%s\": %s\n", filename, + strerror(errno)); + return; + } + + fputs("\n" + "\n" + "\n" + "", out); + write_string(out, title, OUTPUT_HTML); + fputs("\n", out); + + if (section) + fprintf(out, "\n", section); + + fputs("\n" + "\n", out); + fprintf(out, "\n", basename); + fprintf(out, "\n", basename); + fputs("\n" + "\n" + "<h1>", out); + write_string(out, title, OUTPUT_HTML); + fprintf(out, + "</h1>\n" + "<ul>\n" + "\t<li><a href=\"%s-toc.html\">Table of Contents</a></li>\n" + "\t<li><a href=\"%s-body.html\">Body</a></li>\n" + "</ul>\n", basename, basename); + fputs("\n" + "\n", out); + fclose(out); + + /* + * Write the table-of-contents file... + */ + + snprintf(filename, sizeof(filename), "%s-toc.html", framefile); + + if ((out = fopen(filename, "w")) == NULL) + { + fprintf(stderr, "mxmldoc: Unable to create \"%s\": %s\n", filename, + strerror(errno)); + return; + } + + write_html_head(out, section, title, cssfile); + + snprintf(filename, sizeof(filename), "%s-body.html", basename); + + fputs("
      \n", out); + fprintf(out, "

      ", + filename); + write_string(out, title, OUTPUT_HTML); + fputs("

      \n", out); + + write_toc(out, doc, introfile, filename, 0); + + fputs("
      \n" + "\n" + "\n", out); + fclose(out); + + /* + * Finally, open the body file... + */ + + snprintf(filename, sizeof(filename), "%s-body.html", framefile); + + if ((out = fopen(filename, "w")) == NULL) + { + fprintf(stderr, "mxmldoc: Unable to create \"%s\": %s\n", filename, + strerror(errno)); + return; + } + } + else if (docset) + { + /* + * Create an Xcode documentation set - start by removing any existing + * output directory... + */ + +#ifdef __APPLE__ + const char *id; /* Identifier */ + + + if (!access(docset, 0) && !remove_directory(docset)) + return; + + /* + * Then make the Apple standard bundle directory structure... + */ + + if (mkdir(docset, 0755)) + { + fprintf(stderr, "mxmldoc: Unable to create \"%s\": %s\n", docset, + strerror(errno)); + return; + } + + snprintf(filename, sizeof(filename), "%s/Contents", docset); + if (mkdir(filename, 0755)) + { + fprintf(stderr, "mxmldoc: Unable to create \"%s\": %s\n", filename, + strerror(errno)); + return; + } + + snprintf(filename, sizeof(filename), "%s/Contents/Resources", docset); + if (mkdir(filename, 0755)) + { + fprintf(stderr, "mxmldoc: Unable to create \"%s\": %s\n", filename, + strerror(errno)); + return; + } + + snprintf(filename, sizeof(filename), "%s/Contents/Resources/Documentation", + docset); + if (mkdir(filename, 0755)) + { + fprintf(stderr, "mxmldoc: Unable to create \"%s\": %s\n", filename, + strerror(errno)); + return; + } + + /* + * The Info.plist file, which describes the documentation set... + */ + + if ((id = strrchr(docset, '/')) != NULL) + id ++; + else + id = docset; + + snprintf(filename, sizeof(filename), "%s/Contents/Info.plist", docset); + if ((out = fopen(filename, "w")) == NULL) + { + fprintf(stderr, "mxmldoc: Unable to create \"%s\": %s\n", filename, + strerror(errno)); + return; + } + + fputs("\n" + "\n" + "\n" + "\n" + "\tCFBundleIdentifier\n" + "\t", out); + write_string(out, id, OUTPUT_HTML); + fputs("\n" + "\tCFBundleName\n" + "\t", out); + write_string(out, title, OUTPUT_HTML); + fputs("\n" + "\tCFBundleVersion\n" + "\t", out); + write_string(out, docversion ? docversion : "0.0", OUTPUT_HTML); + fputs("\n", out); + + if (feedname) + { + fputs("\tDocSetFeedName\n" + "\t", out); + write_string(out, feedname ? feedname : title, OUTPUT_HTML); + fputs("\n", out); + } + + if (feedurl) + { + fputs("\tDocSetFeedURL\n" + "\t", out); + write_string(out, feedurl, OUTPUT_HTML); + fputs("\n", out); + } + + fputs("\n" + "\n", out); + + fclose(out); + + /* + * Next the Nodes.xml file... + */ + + snprintf(filename, sizeof(filename), "%s/Contents/Resources/Nodes.xml", + docset); + if ((out = fopen(filename, "w")) == NULL) + { + fprintf(stderr, "mxmldoc: Unable to create \"%s\": %s\n", filename, + strerror(errno)); + return; + } + + fputs("\n" + "\n" + "\n" + "\n" + "", out); + write_string(out, title, OUTPUT_HTML); + fputs("\n" + "Documentation/index.html\n" + "\n", out); + + write_toc(out, doc, introfile, NULL, 1); + + fputs("\n" + "\n" + "\n" + "\n", out); + + fclose(out); + + /* + * Then the Tokens.xml file... + */ + + snprintf(filename, sizeof(filename), "%s/Contents/Resources/Tokens.xml", + docset); + if ((out = fopen(filename, "w")) == NULL) + { + fprintf(stderr, "mxmldoc: Unable to create \"%s\": %s\n", filename, + strerror(errno)); + return; + } + + fputs("\n" + "\n", out); + + write_tokens(out, doc, "index.html"); + + fputs("\n", out); + + fclose(out); + + /* + * Finally the HTML file... + */ + + snprintf(filename, sizeof(filename), + "%s/Contents/Resources/Documentation/index.html", + docset); + if ((out = fopen(filename, "w")) == NULL) + { + fprintf(stderr, "mxmldoc: Unable to create \"%s\": %s\n", filename, + strerror(errno)); + return; + } + +#else + fputs("mxmldoc: Xcode documentation sets can only be created on " + "Mac OS X.\n", stderr); + return; +#endif /* __APPLE__ */ + } + else + out = stdout; + + /* + * Standard header... + */ + + write_html_head(out, section, title, cssfile); + + fputs("
      \n", out); + + /* + * Header... + */ + + if (headerfile) + { + /* + * Use custom header... + */ + + write_file(out, headerfile); + } + else + { + /* + * Use standard header... + */ + + fputs("

      ", out); + write_string(out, title, OUTPUT_HTML); + fputs("

      \n", out); + } + + /* + * Table of contents... + */ + + if (!framefile) + write_toc(out, doc, introfile, NULL, 0); + + /* + * Intro... + */ + + if (introfile) + write_file(out, introfile); + + /* + * List of classes... + */ + + if ((scut = find_public(doc, doc, "class")) != NULL) + { + fputs("

      Classes

      \n", out); + + while (scut) + { + write_scu(out, doc, scut); + + scut = find_public(scut, doc, "class"); + } + } + + /* + * List of functions... + */ + + if ((function = find_public(doc, doc, "function")) != NULL) + { + fputs("

      Functions

      \n", out); + + while (function) + { + write_function(out, doc, function, 3); + + function = find_public(function, doc, "function"); + } + } + + /* + * List of types... + */ + + if ((scut = find_public(doc, doc, "typedef")) != NULL) + { + fputs("

      Data Types

      \n", out); + + while (scut) + { + name = mxmlElementGetAttr(scut, "name"); + description = mxmlFindElement(scut, scut, "description", NULL, + NULL, MXML_DESCEND_FIRST); + fprintf(out, "

      %s%s

      \n", + get_comment_info(description), name, name); + + if (description) + write_description(out, description, "p", 1); + + fputs("

      \n" + "typedef ", out); + + type = mxmlFindElement(scut, scut, "type", NULL, NULL, + MXML_DESCEND_FIRST); + + for (type = type->child; type; type = type->next) + if (!strcmp(type->value.text.string, "(")) + break; + else + { + if (type->value.text.whitespace) + putc(' ', out); + + if (mxmlFindElement(doc, doc, "class", "name", + type->value.text.string, MXML_DESCEND) || + mxmlFindElement(doc, doc, "enumeration", "name", + type->value.text.string, MXML_DESCEND) || + mxmlFindElement(doc, doc, "struct", "name", + type->value.text.string, MXML_DESCEND) || + mxmlFindElement(doc, doc, "typedef", "name", + type->value.text.string, MXML_DESCEND) || + mxmlFindElement(doc, doc, "union", "name", + type->value.text.string, MXML_DESCEND)) + { + fputs("value.text.string, OUTPUT_HTML); + fputs("\">", out); + write_string(out, type->value.text.string, OUTPUT_HTML); + fputs("", out); + } + else + write_string(out, type->value.text.string, OUTPUT_HTML); + } + + if (type) + { + /* + * Output function type... + */ + + if (type->prev && type->prev->value.text.string[0] != '*') + putc(' ', out); + + fprintf(out, "(*%s", name); + + for (type = type->next->next; type; type = type->next) + { + if (type->value.text.whitespace) + putc(' ', out); + + if (mxmlFindElement(doc, doc, "class", "name", + type->value.text.string, MXML_DESCEND) || + mxmlFindElement(doc, doc, "enumeration", "name", + type->value.text.string, MXML_DESCEND) || + mxmlFindElement(doc, doc, "struct", "name", + type->value.text.string, MXML_DESCEND) || + mxmlFindElement(doc, doc, "typedef", "name", + type->value.text.string, MXML_DESCEND) || + mxmlFindElement(doc, doc, "union", "name", + type->value.text.string, MXML_DESCEND)) + { + fputs("value.text.string, OUTPUT_HTML); + fputs("\">", out); + write_string(out, type->value.text.string, OUTPUT_HTML); + fputs("", out); + } + else + write_string(out, type->value.text.string, OUTPUT_HTML); + } + + fputs(";\n", out); + } + else + { + type = mxmlFindElement(scut, scut, "type", NULL, NULL, + MXML_DESCEND_FIRST); + if (type->last_child->value.text.string[0] != '*') + putc(' ', out); + + fprintf(out, "%s;\n", name); + } + + fputs("

      \n", out); + + scut = find_public(scut, doc, "typedef"); + } + } + + /* + * List of structures... + */ + + if ((scut = find_public(doc, doc, "struct")) != NULL) + { + fputs("

      Structures

      \n", + out); + + while (scut) + { + write_scu(out, doc, scut); + + scut = find_public(scut, doc, "struct"); + } + } + + /* + * List of unions... + */ + + if ((scut = find_public(doc, doc, "union")) != NULL) + { + fputs("

      Unions

      \n", out); + + while (scut) + { + write_scu(out, doc, scut); + + scut = find_public(scut, doc, "union"); + } + } + + /* + * Variables... + */ + + if ((arg = find_public(doc, doc, "variable")) != NULL) + { + fputs("

      Variables

      \n", + out); + + while (arg) + { + name = mxmlElementGetAttr(arg, "name"); + description = mxmlFindElement(arg, arg, "description", NULL, + NULL, MXML_DESCEND_FIRST); + fprintf(out, "

      %s%s

      \n", + get_comment_info(description), name, name); + + if (description) + write_description(out, description, "p", 1); + + fputs("

      ", out); + + write_element(out, doc, mxmlFindElement(arg, arg, "type", NULL, + NULL, MXML_DESCEND_FIRST), + OUTPUT_HTML); + fputs(mxmlElementGetAttr(arg, "name"), out); + if ((defval = mxmlElementGetAttr(arg, "default")) != NULL) + fprintf(out, " %s", defval); + fputs(";

      \n", out); + + arg = find_public(arg, doc, "variable"); + } + } + + /* + * List of enumerations... + */ + + if ((scut = find_public(doc, doc, "enumeration")) != NULL) + { + fputs("

      Constants

      \n", + out); + + while (scut) + { + name = mxmlElementGetAttr(scut, "name"); + description = mxmlFindElement(scut, scut, "description", NULL, + NULL, MXML_DESCEND_FIRST); + fprintf(out, "

      %s%s

      \n", + get_comment_info(description), name, name); + + if (description) + write_description(out, description, "p", 1); + + fputs("

      Constants

      \n" + "
      \n", out); + + for (arg = mxmlFindElement(scut, scut, "constant", NULL, NULL, + MXML_DESCEND_FIRST); + arg; + arg = mxmlFindElement(arg, scut, "constant", NULL, NULL, + MXML_NO_DESCEND)) + { + description = mxmlFindElement(arg, arg, "description", NULL, + NULL, MXML_DESCEND_FIRST); + fprintf(out, "
      %s %s
      \n", + mxmlElementGetAttr(arg, "name"), get_comment_info(description)); + + write_description(out, description, "dd", 1); + write_description(out, description, "dd", 0); + } + + fputs("
      \n", out); + + scut = find_public(scut, doc, "enumeration"); + } + } + + /* + * Footer... + */ + + if (footerfile) + { + /* + * Use custom footer... + */ + + write_file(out, footerfile); + } + + fputs("
      \n" + "\n" + "\n", out); + + /* + * Close output file as needed... + */ + + if (out != stdout) + fclose(out); + +#ifdef __APPLE__ + /* + * When generating document sets, run the docsetutil program to index it... + */ + + if (docset) + { + const char *args[4]; /* Argument array */ + pid_t pid; /* Process ID */ + int status; /* Exit status */ + + + args[0] = "/Developer/usr/bin/docsetutil"; + args[1] = "index"; + args[2] = docset; + args[3] = NULL; + + if (posix_spawn(&pid, args[0], NULL, NULL, (char **)args, environ)) + { + fprintf(stderr, "mxmldoc: Unable to index documentation set \"%s\": %s\n", + docset, strerror(errno)); + } + else + { + while (wait(&status) != pid); + + if (status) + { + if (WIFEXITED(status)) + fprintf(stderr, "mxmldoc: docsetutil exited with status %d\n", + WEXITSTATUS(status)); + else + fprintf(stderr, "mxmldoc: docsetutil crashed with signal %d\n", + WTERMSIG(status)); + } + else + { + /* + * Remove unneeded temporary XML files... + */ + + snprintf(filename, sizeof(filename), "%s/Contents/Resources/Nodes.xml", + docset); + unlink(filename); + + snprintf(filename, sizeof(filename), "%s/Contents/Resources/Tokens.xml", + docset); + unlink(filename); + } + } + } +#endif /* __APPLE__ */ +} + + +/* + * 'write_html_head()' - Write the standard HTML header. + */ + +static void +write_html_head(FILE *out, /* I - Output file */ + const char *section, /* I - Section */ + const char *title, /* I - Title */ + const char *cssfile) /* I - Stylesheet */ +{ + fputs("\n" + "\n", out); + + if (section) + fprintf(out, "\n", section); + + fputs("\n" + "", out); + write_string(out, title, OUTPUT_HTML); + fputs("\n", out); + + if (section) + fprintf(out, "\n", section); + + fputs("\n" + "\n" + "\n" + "\n", out); +} + + +/* + * 'write_man()' - Write manpage documentation. + */ + +static void +write_man(const char *man_name, /* I - Name of manpage */ + const char *section, /* I - Section */ + const char *title, /* I - Title */ + const char *footerfile, /* I - Footer file */ + const char *headerfile, /* I - Header file */ + const char *introfile, /* I - Intro file */ + mxml_node_t *doc) /* I - XML documentation */ +{ + int i; /* Looping var */ + mxml_node_t *function, /* Current function */ + *scut, /* Struct/class/union/typedef */ + *arg, /* Current argument */ + *description, /* Description of function/var */ + *type; /* Type for argument */ + const char *name, /* Name of function/type */ + *cname, /* Class name */ + *defval, /* Default value */ + *parent; /* Parent class */ + int inscope; /* Variable/method scope */ + char prefix; /* Prefix character */ + time_t curtime; /* Current time */ + struct tm *curdate; /* Current date */ + char buffer[1024]; /* String buffer */ + static const char * const scopes[] = /* Scope strings */ + { + "private", + "protected", + "public" + }; + + + /* + * Standard man page... + */ + + curtime = time(NULL); + curdate = localtime(&curtime); + strftime(buffer, sizeof(buffer), "%x", curdate); + + printf(".TH %s %s \"%s\" \"%s\" \"%s\"\n", man_name, section ? section : "3", + title ? title : "", buffer, title ? title : ""); + + /* + * Header... + */ + + if (headerfile) + { + /* + * Use custom header... + */ + + write_file(stdout, headerfile); + } + else + { + /* + * Use standard header... + */ + + puts(".SH NAME"); + printf("%s \\- %s\n", man_name, title ? title : man_name); + } + + /* + * Intro... + */ + + if (introfile) + write_file(stdout, introfile); + + /* + * List of classes... + */ + + if (find_public(doc, doc, "class")) + { + puts(".SH CLASSES"); + + for (scut = find_public(doc, doc, "class"); + scut; + scut = find_public(scut, doc, "class")) + { + cname = mxmlElementGetAttr(scut, "name"); + description = mxmlFindElement(scut, scut, "description", NULL, + NULL, MXML_DESCEND_FIRST); + printf(".SS %s\n", cname); + + write_description(stdout, description, NULL, 1); + + printf(".PP\n" + ".nf\n" + "class %s", cname); + if ((parent = mxmlElementGetAttr(scut, "parent")) != NULL) + printf(" %s", parent); + puts("\n{"); + + for (i = 0; i < 3; i ++) + { + inscope = 0; + + for (arg = mxmlFindElement(scut, scut, "variable", "scope", scopes[i], + MXML_DESCEND_FIRST); + arg; + arg = mxmlFindElement(arg, scut, "variable", "scope", scopes[i], + MXML_NO_DESCEND)) + { + if (!inscope) + { + inscope = 1; + printf(" %s:\n", scopes[i]); + } + + printf(" "); + write_element(stdout, doc, mxmlFindElement(arg, arg, "type", NULL, + NULL, MXML_DESCEND_FIRST), + OUTPUT_MAN); + printf("%s;\n", mxmlElementGetAttr(arg, "name")); + } + + for (function = mxmlFindElement(scut, scut, "function", "scope", + scopes[i], MXML_DESCEND_FIRST); + function; + function = mxmlFindElement(function, scut, "function", "scope", + scopes[i], MXML_NO_DESCEND)) + { + if (!inscope) + { + inscope = 1; + printf(" %s:\n", scopes[i]); + } + + name = mxmlElementGetAttr(function, "name"); + + printf(" "); + + arg = mxmlFindElement(function, function, "returnvalue", NULL, + NULL, MXML_DESCEND_FIRST); + + if (arg) + write_element(stdout, doc, mxmlFindElement(arg, arg, "type", NULL, + NULL, MXML_DESCEND_FIRST), + OUTPUT_MAN); + else if (strcmp(cname, name) && strcmp(cname, name + 1)) + fputs("void ", stdout); + + printf("%s", name); + + for (arg = mxmlFindElement(function, function, "argument", NULL, NULL, + MXML_DESCEND_FIRST), prefix = '('; + arg; + arg = mxmlFindElement(arg, function, "argument", NULL, NULL, + MXML_NO_DESCEND), prefix = ',') + { + type = mxmlFindElement(arg, arg, "type", NULL, NULL, + MXML_DESCEND_FIRST); + + putchar(prefix); + if (prefix == ',') + putchar(' '); + + if (type->child) + write_element(stdout, doc, type, OUTPUT_MAN); + fputs(mxmlElementGetAttr(arg, "name"), stdout); + if ((defval = mxmlElementGetAttr(arg, "default")) != NULL) + printf(" %s", defval); + } + + if (prefix == '(') + puts("(void);"); + else + puts(");"); + } + } + + puts("};\n" + ".fi"); + + write_description(stdout, description, NULL, 0); + } + } + + /* + * List of enumerations... + */ + + if (find_public(doc, doc, "enumeration")) + { + puts(".SH ENUMERATIONS"); + + for (scut = find_public(doc, doc, "enumeration"); + scut; + scut = find_public(scut, doc, "enumeration")) + { + name = mxmlElementGetAttr(scut, "name"); + description = mxmlFindElement(scut, scut, "description", NULL, + NULL, MXML_DESCEND_FIRST); + printf(".SS %s\n", name); + + write_description(stdout, description, NULL, 1); + write_description(stdout, description, NULL, 0); + + for (arg = mxmlFindElement(scut, scut, "constant", NULL, NULL, + MXML_DESCEND_FIRST); + arg; + arg = mxmlFindElement(arg, scut, "constant", NULL, NULL, + MXML_NO_DESCEND)) + { + description = mxmlFindElement(arg, arg, "description", NULL, + NULL, MXML_DESCEND_FIRST); + printf(".TP 5\n%s\n.br\n", mxmlElementGetAttr(arg, "name")); + write_description(stdout, description, NULL, 1); + } + } + } + + /* + * List of functions... + */ + + if (find_public(doc, doc, "function")) + { + puts(".SH FUNCTIONS"); + + for (function = find_public(doc, doc, "function"); + function; + function = find_public(function, doc, "function")) + { + name = mxmlElementGetAttr(function, "name"); + description = mxmlFindElement(function, function, "description", NULL, + NULL, MXML_DESCEND_FIRST); + printf(".SS %s\n", name); + + write_description(stdout, description, NULL, 1); + + puts(".PP\n" + ".nf"); + + arg = mxmlFindElement(function, function, "returnvalue", NULL, + NULL, MXML_DESCEND_FIRST); + + if (arg) + write_element(stdout, doc, mxmlFindElement(arg, arg, "type", NULL, + NULL, MXML_DESCEND_FIRST), + OUTPUT_MAN); + else + fputs("void", stdout); + + printf(" %s ", name); + for (arg = mxmlFindElement(function, function, "argument", NULL, NULL, + MXML_DESCEND_FIRST), prefix = '('; + arg; + arg = mxmlFindElement(arg, function, "argument", NULL, NULL, + MXML_NO_DESCEND), prefix = ',') + { + type = mxmlFindElement(arg, arg, "type", NULL, NULL, + MXML_DESCEND_FIRST); + + printf("%c\n ", prefix); + if (type->child) + write_element(stdout, doc, type, OUTPUT_MAN); + fputs(mxmlElementGetAttr(arg, "name"), stdout); + if ((defval = mxmlElementGetAttr(arg, "default")) != NULL) + printf(" %s", defval); + } + + if (prefix == '(') + puts("(void);"); + else + puts("\n);"); + + puts(".fi"); + + write_description(stdout, description, NULL, 0); + } + } + + /* + * List of structures... + */ + + if (find_public(doc, doc, "struct")) + { + puts(".SH STRUCTURES"); + + for (scut = find_public(doc, doc, "struct"); + scut; + scut = find_public(scut, doc, "struct")) + { + cname = mxmlElementGetAttr(scut, "name"); + description = mxmlFindElement(scut, scut, "description", NULL, + NULL, MXML_DESCEND_FIRST); + printf(".SS %s\n", cname); + + write_description(stdout, description, NULL, 1); + + printf(".PP\n" + ".nf\n" + "struct %s\n{\n", cname); + for (arg = mxmlFindElement(scut, scut, "variable", NULL, NULL, + MXML_DESCEND_FIRST); + arg; + arg = mxmlFindElement(arg, scut, "variable", NULL, NULL, + MXML_NO_DESCEND)) + { + printf(" "); + write_element(stdout, doc, mxmlFindElement(arg, arg, "type", NULL, + NULL, MXML_DESCEND_FIRST), + OUTPUT_MAN); + printf("%s;\n", mxmlElementGetAttr(arg, "name")); + } + + for (function = mxmlFindElement(scut, scut, "function", NULL, NULL, + MXML_DESCEND_FIRST); + function; + function = mxmlFindElement(function, scut, "function", NULL, NULL, + MXML_NO_DESCEND)) + { + name = mxmlElementGetAttr(function, "name"); + + printf(" "); + + arg = mxmlFindElement(function, function, "returnvalue", NULL, + NULL, MXML_DESCEND_FIRST); + + if (arg) + write_element(stdout, doc, mxmlFindElement(arg, arg, "type", NULL, + NULL, MXML_DESCEND_FIRST), + OUTPUT_MAN); + else if (strcmp(cname, name) && strcmp(cname, name + 1)) + fputs("void ", stdout); + + fputs(name, stdout); + + for (arg = mxmlFindElement(function, function, "argument", NULL, NULL, + MXML_DESCEND_FIRST), prefix = '('; + arg; + arg = mxmlFindElement(arg, function, "argument", NULL, NULL, + MXML_NO_DESCEND), prefix = ',') + { + type = mxmlFindElement(arg, arg, "type", NULL, NULL, + MXML_DESCEND_FIRST); + + putchar(prefix); + if (prefix == ',') + putchar(' '); + + if (type->child) + write_element(stdout, doc, type, OUTPUT_MAN); + fputs(mxmlElementGetAttr(arg, "name"), stdout); + if ((defval = mxmlElementGetAttr(arg, "default")) != NULL) + printf(" %s", defval); + } + + if (prefix == '(') + puts("(void);"); + else + puts(");"); + } + + puts("};\n" + ".fi"); + + write_description(stdout, description, NULL, 0); + } + } + + /* + * List of types... + */ + + if (find_public(doc, doc, "typedef")) + { + puts(".SH TYPES"); + + for (scut = find_public(doc, doc, "typedef"); + scut; + scut = find_public(scut, doc, "typedef")) + { + name = mxmlElementGetAttr(scut, "name"); + description = mxmlFindElement(scut, scut, "description", NULL, + NULL, MXML_DESCEND_FIRST); + printf(".SS %s\n", name); + + write_description(stdout, description, NULL, 1); + + fputs(".PP\n" + ".nf\n" + "typedef ", stdout); + + type = mxmlFindElement(scut, scut, "type", NULL, NULL, + MXML_DESCEND_FIRST); + + for (type = type->child; type; type = type->next) + if (!strcmp(type->value.text.string, "(")) + break; + else + { + if (type->value.text.whitespace) + putchar(' '); + + write_string(stdout, type->value.text.string, OUTPUT_MAN); + } + + if (type) + { + /* + * Output function type... + */ + + printf(" (*%s", name); + + for (type = type->next->next; type; type = type->next) + { + if (type->value.text.whitespace) + putchar(' '); + + write_string(stdout, type->value.text.string, OUTPUT_MAN); + } + + puts(";"); + } + else + printf(" %s;\n", name); + + puts(".fi"); + + write_description(stdout, description, NULL, 0); + } + } + + /* + * List of unions... + */ + + if (find_public(doc, doc, "union")) + { + puts(".SH UNIONS"); + + for (scut = find_public(doc, doc, "union"); + scut; + scut = find_public(scut, doc, "union")) + { + name = mxmlElementGetAttr(scut, "name"); + description = mxmlFindElement(scut, scut, "description", NULL, + NULL, MXML_DESCEND_FIRST); + printf(".SS %s\n", name); + + write_description(stdout, description, NULL, 1); + + printf(".PP\n" + ".nf\n" + "union %s\n{\n", name); + for (arg = mxmlFindElement(scut, scut, "variable", NULL, NULL, + MXML_DESCEND_FIRST); + arg; + arg = mxmlFindElement(arg, scut, "variable", NULL, NULL, + MXML_NO_DESCEND)) + { + printf(" "); + write_element(stdout, doc, mxmlFindElement(arg, arg, "type", NULL, + NULL, MXML_DESCEND_FIRST), + OUTPUT_MAN); + printf("%s;\n", mxmlElementGetAttr(arg, "name")); + } + + puts("};\n" + ".fi"); + + write_description(stdout, description, NULL, 0); + } + } + + /* + * Variables... + */ + + if (find_public(doc, doc, "variable")) + { + puts(".SH VARIABLES"); + + for (arg = find_public(doc, doc, "variable"); + arg; + arg = find_public(arg, doc, "variable")) + { + name = mxmlElementGetAttr(arg, "name"); + description = mxmlFindElement(arg, arg, "description", NULL, + NULL, MXML_DESCEND_FIRST); + printf(".SS %s\n", name); + + write_description(stdout, description, NULL, 1); + + puts(".PP\n" + ".nf"); + + write_element(stdout, doc, mxmlFindElement(arg, arg, "type", NULL, + NULL, MXML_DESCEND_FIRST), + OUTPUT_MAN); + fputs(mxmlElementGetAttr(arg, "name"), stdout); + if ((defval = mxmlElementGetAttr(arg, "default")) != NULL) + printf(" %s", defval); + puts(";\n" + ".fi"); + + write_description(stdout, description, NULL, 0); + } + } + + if (footerfile) + { + /* + * Use custom footer... + */ + + write_file(stdout, footerfile); + } +} + + +/* + * 'write_scu()' - Write a structure, class, or union. + */ + +static void +write_scu(FILE *out, /* I - Output file */ + mxml_node_t *doc, /* I - Document */ + mxml_node_t *scut) /* I - Structure, class, or union */ +{ + int i; /* Looping var */ + mxml_node_t *function, /* Current function */ + *arg, /* Current argument */ + *description, /* Description of function/var */ + *type; /* Type for argument */ + const char *name, /* Name of function/type */ + *cname, /* Class name */ + *defval, /* Default value */ + *parent, /* Parent class */ + *scope; /* Scope for variable/function */ + int inscope, /* Variable/method scope */ + maxscope; /* Maximum scope */ + char prefix; /* Prefix character */ + static const char * const scopes[] = /* Scope strings */ + { + "private", + "protected", + "public" + }; + + + cname = mxmlElementGetAttr(scut, "name"); + description = mxmlFindElement(scut, scut, "description", NULL, + NULL, MXML_DESCEND_FIRST); + + fprintf(out, "

      %s%s

      \n", + scut->value.element.name, get_comment_info(description), cname, + cname); + + if (description) + write_description(out, description, "p", 1); + + fprintf(out, "

      %s %s", scut->value.element.name, cname); + if ((parent = mxmlElementGetAttr(scut, "parent")) != NULL) + fprintf(out, " %s", parent); + fputs(" {
      \n", out); + + maxscope = !strcmp(scut->value.element.name, "class") ? 3 : 1; + + for (i = 0; i < maxscope; i ++) + { + inscope = maxscope == 1; + + for (arg = mxmlFindElement(scut, scut, "variable", NULL, NULL, + MXML_DESCEND_FIRST); + arg; + arg = mxmlFindElement(arg, scut, "variable", NULL, NULL, + MXML_NO_DESCEND)) + { + if (maxscope > 1 && + ((scope = mxmlElementGetAttr(arg, "scope")) == NULL || + strcmp(scope, scopes[i]))) + continue; + + if (!inscope) + { + inscope = 1; + fprintf(out, "  %s:
      \n", scopes[i]); + } + + fputs("    ", out); + write_element(out, doc, mxmlFindElement(arg, arg, "type", NULL, + NULL, MXML_DESCEND_FIRST), + OUTPUT_HTML); + fprintf(out, "%s;
      \n", mxmlElementGetAttr(arg, "name")); + } + + for (function = mxmlFindElement(scut, scut, "function", NULL, NULL, + MXML_DESCEND_FIRST); + function; + function = mxmlFindElement(function, scut, "function", NULL, NULL, + MXML_NO_DESCEND)) + { + if (maxscope > 1 && + ((scope = mxmlElementGetAttr(arg, "scope")) == NULL || + strcmp(scope, scopes[i]))) + continue; + + if (!inscope) + { + inscope = 1; + fprintf(out, "  %s:
      \n", scopes[i]); + } + + name = mxmlElementGetAttr(function, "name"); + + fputs("    ", out); + + arg = mxmlFindElement(function, function, "returnvalue", NULL, + NULL, MXML_DESCEND_FIRST); + + if (arg) + write_element(out, doc, mxmlFindElement(arg, arg, "type", NULL, + NULL, MXML_DESCEND_FIRST), + OUTPUT_HTML); + else if (strcmp(cname, name) && strcmp(cname, name + 1)) + fputs("void ", out); + + fprintf(out, "%s", cname, name, name); + + for (arg = mxmlFindElement(function, function, "argument", NULL, NULL, + MXML_DESCEND_FIRST), prefix = '('; + arg; + arg = mxmlFindElement(arg, function, "argument", NULL, NULL, + MXML_NO_DESCEND), prefix = ',') + { + type = mxmlFindElement(arg, arg, "type", NULL, NULL, + MXML_DESCEND_FIRST); + + putc(prefix, out); + if (prefix == ',') + putc(' ', out); + + if (type->child) + write_element(out, doc, type, OUTPUT_HTML); + + fputs(mxmlElementGetAttr(arg, "name"), out); + if ((defval = mxmlElementGetAttr(arg, "default")) != NULL) + fprintf(out, " %s", defval); + } + + if (prefix == '(') + fputs("(void);
      \n", out); + else + fputs(");
      \n", out); + } + } + + fputs("};

      \n" + "

      Members

      \n" + "
      \n", out); + + for (arg = mxmlFindElement(scut, scut, "variable", NULL, NULL, + MXML_DESCEND_FIRST); + arg; + arg = mxmlFindElement(arg, scut, "variable", NULL, NULL, + MXML_NO_DESCEND)) + { + description = mxmlFindElement(arg, arg, "description", NULL, + NULL, MXML_DESCEND_FIRST); + + fprintf(out, "
      %s %s
      \n", + mxmlElementGetAttr(arg, "name"), get_comment_info(description)); + + write_description(out, description, "dd", 1); + write_description(out, description, "dd", 0); + } + + fputs("
      \n", out); + + for (function = mxmlFindElement(scut, scut, "function", NULL, NULL, + MXML_DESCEND_FIRST); + function; + function = mxmlFindElement(function, scut, "function", NULL, NULL, + MXML_NO_DESCEND)) + { + write_function(out, doc, function, 4); + } +} + + +/* + * 'write_string()' - Write a string, quoting HTML special chars as needed. + */ + +static void +write_string(FILE *out, /* I - Output file */ + const char *s, /* I - String to write */ + int mode) /* I - Output mode */ +{ + switch (mode) + { + case OUTPUT_HTML : + case OUTPUT_XML : + while (*s) + { + if (*s == '&') + fputs("&", out); + else if (*s == '<') + fputs("<", out); + else if (*s == '>') + fputs(">", out); + else if (*s == '\"') + fputs(""", out); + else if (*s & 128) + { + /* + * Convert UTF-8 to Unicode constant... + */ + + int ch; /* Unicode character */ + + + ch = *s & 255; + + if ((ch & 0xe0) == 0xc0) + { + ch = ((ch & 0x1f) << 6) | (s[1] & 0x3f); + s ++; + } + else if ((ch & 0xf0) == 0xe0) + { + ch = ((((ch * 0x0f) << 6) | (s[1] & 0x3f)) << 6) | (s[2] & 0x3f); + s += 2; + } + + if (ch == 0xa0) + { + /* + * Handle non-breaking space as-is... + */ + + fputs(" ", out); + } + else + fprintf(out, "&#x%x;", ch); + } + else + putc(*s, out); + + s ++; + } + break; + + case OUTPUT_MAN : + while (*s) + { + if (*s == '\\' || *s == '-') + putc('\\', out); + + putc(*s++, out); + } + break; + } +} + + +/* + * 'write_toc()' - Write a table-of-contents. + */ + +static void +write_toc(FILE *out, /* I - Output file */ + mxml_node_t *doc, /* I - Document */ + const char *introfile, /* I - Introduction file */ + const char *target, /* I - Target name */ + int xml) /* I - Write XML nodes? */ +{ + FILE *fp; /* Intro file */ + mxml_node_t *function, /* Current function */ + *scut, /* Struct/class/union/typedef */ + *arg, /* Current argument */ + *description; /* Description of function/var */ + const char *name, /* Name of function/type */ + *targetattr; /* Target attribute, if any */ + int xmlid = 1; /* Current XML node ID */ + + + /* + * If target is set, it is the frame file that contains the body. + * Otherwise, we are creating a single-file... + */ + + if (target) + targetattr = " target=\"body\""; + else + targetattr = ""; + + /* + * The table-of-contents is a nested unordered list. Start by + * reading any intro file to see if there are any headings there. + */ + + if (!xml) + fputs("

      Contents

      \n" + "
        \n", out); + + if (introfile && (fp = fopen(introfile, "r")) != NULL) + { + char line[8192], /* Line from file */ + *ptr, /* Pointer in line */ + *end, /* End of line */ + *anchor, /* Anchor name */ + quote, /* Quote character for value */ + level = '1', /* Current heading level */ + newlevel; /* New heading level */ + int inelement; /* In an element? */ + + + while (fgets(line, sizeof(line), fp)) + { + /* + * See if this line has a heading... + */ + + if ((ptr = strstr(line, "') + inelement = 0; + + *ptr++ = '\0'; + } + + /* + * Write text until we see ""... + */ + + if (xml) + { + if (newlevel < level) + fputs("\n" + "\n", out); + else if (newlevel > level && newlevel == '3') + fputs("\n", out); + else if (xmlid > 1) + fputs("\n", out); + + level = newlevel; + + fprintf(out, "\n" + "Documentation/index.html\n" + "%s\n" + "", xmlid ++, anchor); + + quote = 0; + + while (*ptr) + { + if (inelement) + { + if (*ptr == quote) + quote = 0; + else if (*ptr == '>') + inelement = 0; + else if (*ptr == '\'' || *ptr == '\"') + quote = *ptr; + } + else if (*ptr == '<') + { + if (!strncmp(ptr, "", 4) || !strncmp(ptr, "", 4)) + break; + + inelement = 1; + } + else + putc(*ptr, out); + + ptr ++; + } + + fputs("\n", out); + } + else + { + if (newlevel < level) + fputs("\n" + "
      \n", out); + else if (newlevel > level) + fputs("\n", out); + } + } + + fclose(fp); + } + + /* + * Next the classes... + */ + + if ((scut = find_public(doc, doc, "class")) != NULL) + { + if (xml) + fprintf(out, "\n" + "Documentation/index.html\n" + "CLASSES\n" + "Classes\n" + "\n", xmlid ++); + else + fprintf(out, "
    • Classes" + "
        \n", + target ? target : "", targetattr); + + while (scut) + { + name = mxmlElementGetAttr(scut, "name"); + description = mxmlFindElement(scut, scut, "description", + NULL, NULL, MXML_DESCEND_FIRST); + + if (xml) + { + fprintf(out, "\n" + "Documentation/index.html\n" + "%s\n" + "%s\n" + "\n", xmlid ++, name, name); + } + else + { + fprintf(out, "
      • %s
        • \n", name); + } + + scut = find_public(scut, doc, "class"); + } + + if (xml) + fputs("\n", out); + else + fputs("
      • \n", out); + } + + /* + * Functions... + */ + + if ((function = find_public(doc, doc, "function")) != NULL) + { + if (xml) + fprintf(out, "\n" + "Documentation/index.html\n" + "FUNCTIONS\n" + "Functions\n" + "\n", xmlid ++); + else + fprintf(out, "
    • Functions" + "
        \n", target ? target : "", targetattr); + + while (function) + { + name = mxmlElementGetAttr(function, "name"); + description = mxmlFindElement(function, function, "description", + NULL, NULL, MXML_DESCEND_FIRST); + + if (xml) + { + fprintf(out, "\n" + "Documentation/index.html\n" + "%s\n" + "%s\n" + "\n", xmlid ++, name, name); + } + else + { + fprintf(out, "
      • %s
        • \n", name); + } + + function = find_public(function, doc, "function"); + } + + if (xml) + fputs("\n", out); + else + fputs("
      • \n", out); + } + + /* + * Data types... + */ + + if ((scut = find_public(doc, doc, "typedef")) != NULL) + { + if (xml) + fprintf(out, "\n" + "Documentation/index.html\n" + "TYPES\n" + "Data Types\n" + "\n", xmlid ++); + else + fprintf(out, "
    • Data Types" + "
        \n", target ? target : "", targetattr); + + while (scut) + { + name = mxmlElementGetAttr(scut, "name"); + description = mxmlFindElement(scut, scut, "description", + NULL, NULL, MXML_DESCEND_FIRST); + + if (xml) + { + fprintf(out, "\n" + "Documentation/index.html\n" + "%s\n" + "%s\n" + "\n", xmlid ++, name, name); + } + else + { + fprintf(out, "\t
      • %s
        • \n", name); + } + + scut = find_public(scut, doc, "typedef"); + } + + if (xml) + fputs("\n", out); + else + fputs("
      • \n", out); + } + + /* + * Structures... + */ + + if ((scut = find_public(doc, doc, "struct")) != NULL) + { + if (xml) + fprintf(out, "\n" + "Documentation/index.html\n" + "STRUCTURES\n" + "Structures\n" + "\n", xmlid ++); + else + fprintf(out, "
    • Structures" + "
        \n", target ? target : "", targetattr); + + while (scut) + { + name = mxmlElementGetAttr(scut, "name"); + description = mxmlFindElement(scut, scut, "description", + NULL, NULL, MXML_DESCEND_FIRST); + + if (xml) + { + fprintf(out, "\n" + "Documentation/index.html\n" + "%s\n" + "%s\n" + "\n", xmlid ++, name, name); + } + else + { + fprintf(out, "\t
      • %s
        • \n", name); + } + + scut = find_public(scut, doc, "struct"); + } + + if (xml) + fputs("\n", out); + else + fputs("
      • \n", out); + } + + /* + * Unions... + */ + + if ((scut = find_public(doc, doc, "union")) != NULL) + { + if (xml) + fprintf(out, "\n" + "Documentation/index.html\n" + "UNIONS\n" + "Unions\n" + "\n", xmlid ++); + else + fprintf(out, + "
    • Unions
        \n", + target ? target : "", targetattr); + + while (scut) + { + name = mxmlElementGetAttr(scut, "name"); + description = mxmlFindElement(scut, scut, "description", + NULL, NULL, MXML_DESCEND_FIRST); + + if (xml) + { + fprintf(out, "\n" + "Documentation/index.html\n" + "%s\n" + "%s\n" + "\n", xmlid ++, name, name); + } + else + { + fprintf(out, "\t
      • %s
        • \n", name); + } + + scut = find_public(scut, doc, "union"); + } + + if (xml) + fputs("\n", out); + else + fputs("
      • \n", out); + } + + /* + * Globals variables... + */ + + if ((arg = find_public(doc, doc, "variable")) != NULL) + { + if (xml) + fprintf(out, "\n" + "Documentation/index.html\n" + "VARIABLES\n" + "Variables\n" + "\n", xmlid ++); + else + fprintf(out, "
    • Variables" + "
        \n", target ? target : "", targetattr); + + while (arg) + { + name = mxmlElementGetAttr(arg, "name"); + description = mxmlFindElement(arg, arg, "description", + NULL, NULL, MXML_DESCEND_FIRST); + + if (xml) + { + fprintf(out, "\n" + "Documentation/index.html\n" + "%s\n" + "%s\n" + "\n", xmlid ++, name, name); + } + else + { + fprintf(out, "\t
      • %s
        • \n", name); + } + + arg = find_public(arg, doc, "variable"); + } + + if (xml) + fputs("\n", out); + else + fputs("
      • \n", out); + } + + /* + * Enumerations/constants... + */ + + if ((scut = find_public(doc, doc, "enumeration")) != NULL) + { + if (xml) + fprintf(out, "\n" + "Documentation/index.html\n" + "ENUMERATIONS\n" + "Constants\n" + "\n", xmlid ++); + else + fprintf(out, "
    • Constants" + "
        \n", target ? target : "", targetattr); + + while (scut) + { + name = mxmlElementGetAttr(scut, "name"); + description = mxmlFindElement(scut, scut, "description", + NULL, NULL, MXML_DESCEND_FIRST); + + if (xml) + { + fprintf(out, "\n" + "Documentation/index.html\n" + "%s\n" + "%s\n" + "\n", xmlid ++, name, name); + } + else + { + fprintf(out, "\t
      • %s
        • \n", name); + } + + scut = find_public(scut, doc, "enumeration"); + } + + if (xml) + fputs("\n", out); + else + fputs("
      • \n", out); + } +} + + +/* + * 'write_tokens()' - Write nodes for all APIs. + */ + +static void +write_tokens(FILE *out, /* I - Output file */ + mxml_node_t *doc, /* I - Document */ + const char *path) /* I - Path to help file */ +{ + mxml_node_t *function, /* Current function */ + *scut, /* Struct/class/union/typedef */ + *arg, /* Current argument */ + *description, /* Description of function/var */ + *type, /* Type node */ + *node; /* Current child node */ + const char *name, /* Name of function/type */ + *cename, /* Current class/enum name */ + *defval; /* Default value for argument */ + char prefix; /* Prefix for declarations */ + + + /* + * Classes... + */ + + if ((scut = find_public(doc, doc, "class")) != NULL) + { + while (scut) + { + cename = mxmlElementGetAttr(scut, "name"); + description = mxmlFindElement(scut, scut, "description", + NULL, NULL, MXML_DESCEND_FIRST); + + fprintf(out, "\n" + "Documentation/%s\n" + "%s\n" + "//apple_ref/cpp/cl/%s\n" + "", path, cename, cename); + write_description(out, description, "", 1); + fputs("\n" + "\n", out); + + if ((function = find_public(scut, scut, "function")) != NULL) + { + while (function) + { + name = mxmlElementGetAttr(function, "name"); + description = mxmlFindElement(function, function, "description", + NULL, NULL, MXML_DESCEND_FIRST); + + fprintf(out, "\n" + "Documentation/%s\n" + "%s.%s\n" + "//apple_ref/cpp/clm/%s/%s", path, + cename, name, cename, name); + + arg = mxmlFindElement(function, function, "returnvalue", NULL, + NULL, MXML_DESCEND_FIRST); + + if (arg && (type = mxmlFindElement(arg, arg, "type", NULL, + NULL, MXML_DESCEND_FIRST)) != NULL) + { + for (node = type->child; node; node = node->next) + fputs(node->value.text.string, out); + } + else if (strcmp(cename, name) && strcmp(cename, name + 1)) + fputs("void", out); + + fputs("/", out); + + for (arg = mxmlFindElement(function, function, "argument", NULL, NULL, + MXML_DESCEND_FIRST), prefix = '('; + arg; + arg = mxmlFindElement(arg, function, "argument", NULL, NULL, + MXML_NO_DESCEND), prefix = ',') + { + type = mxmlFindElement(arg, arg, "type", NULL, NULL, + MXML_DESCEND_FIRST); + + putc(prefix, out); + + for (node = type->child; node; node = node->next) + fputs(node->value.text.string, out); + + fputs(mxmlElementGetAttr(arg, "name"), out); + } + + if (prefix == '(') + fputs("(void", out); + + fputs(")\n" + "", out); + write_description(out, description, "", 1); + fputs("\n" + "", out); + + arg = mxmlFindElement(function, function, "returnvalue", NULL, + NULL, MXML_DESCEND_FIRST); + + if (arg) + write_element(out, doc, mxmlFindElement(arg, arg, "type", NULL, + NULL, MXML_DESCEND_FIRST), + OUTPUT_XML); + else if (strcmp(cename, name) && strcmp(cename, name + 1)) + fputs("void ", out); + + fputs(name, out); + + for (arg = mxmlFindElement(function, function, "argument", NULL, NULL, + MXML_DESCEND_FIRST), prefix = '('; + arg; + arg = mxmlFindElement(arg, function, "argument", NULL, NULL, + MXML_NO_DESCEND), prefix = ',') + { + type = mxmlFindElement(arg, arg, "type", NULL, NULL, + MXML_DESCEND_FIRST); + + putc(prefix, out); + if (prefix == ',') + putc(' ', out); + + if (type->child) + write_element(out, doc, type, OUTPUT_XML); + + fputs(mxmlElementGetAttr(arg, "name"), out); + if ((defval = mxmlElementGetAttr(arg, "default")) != NULL) + fprintf(out, " %s", defval); + } + + if (prefix == '(') + fputs("(void);", out); + else + fputs(");", out); + + fputs("\n" + "\n", out); + + function = find_public(function, doc, "function"); + } + } + scut = find_public(scut, doc, "class"); + } + } + + /* + * Functions... + */ + + if ((function = find_public(doc, doc, "function")) != NULL) + { + while (function) + { + name = mxmlElementGetAttr(function, "name"); + description = mxmlFindElement(function, function, "description", + NULL, NULL, MXML_DESCEND_FIRST); + + fprintf(out, "\n" + "Documentation/%s\n" + "%s\n" + "//apple_ref/c/func/%s\n" + "", path, name, name); + write_description(out, description, "", 1); + fputs("\n" + "", out); + + arg = mxmlFindElement(function, function, "returnvalue", NULL, + NULL, MXML_DESCEND_FIRST); + + if (arg) + write_element(out, doc, mxmlFindElement(arg, arg, "type", NULL, + NULL, MXML_DESCEND_FIRST), + OUTPUT_XML); + else // if (strcmp(cname, name) && strcmp(cname, name + 1)) + fputs("void ", out); + + fputs(name, out); + + for (arg = mxmlFindElement(function, function, "argument", NULL, NULL, + MXML_DESCEND_FIRST), prefix = '('; + arg; + arg = mxmlFindElement(arg, function, "argument", NULL, NULL, + MXML_NO_DESCEND), prefix = ',') + { + type = mxmlFindElement(arg, arg, "type", NULL, NULL, + MXML_DESCEND_FIRST); + + putc(prefix, out); + if (prefix == ',') + putc(' ', out); + + if (type->child) + write_element(out, doc, type, OUTPUT_XML); + + fputs(mxmlElementGetAttr(arg, "name"), out); + if ((defval = mxmlElementGetAttr(arg, "default")) != NULL) + fprintf(out, " %s", defval); + } + + if (prefix == '(') + fputs("(void);", out); + else + fputs(");", out); + + fputs("\n" + "\n", out); + + function = find_public(function, doc, "function"); + } + } + + /* + * Data types... + */ + + if ((scut = find_public(doc, doc, "typedef")) != NULL) + { + while (scut) + { + name = mxmlElementGetAttr(scut, "name"); + description = mxmlFindElement(scut, scut, "description", + NULL, NULL, MXML_DESCEND_FIRST); + + fprintf(out, "\n" + "Documentation/%s\n" + "%s\n" + "//apple_ref/c/tdef/%s\n" + "", path, name, name); + write_description(out, description, "", 1); + fputs("\n" + "\n", out); + + scut = find_public(scut, doc, "typedef"); + } + } + + /* + * Structures... + */ + + if ((scut = find_public(doc, doc, "struct")) != NULL) + { + while (scut) + { + name = mxmlElementGetAttr(scut, "name"); + description = mxmlFindElement(scut, scut, "description", + NULL, NULL, MXML_DESCEND_FIRST); + + fprintf(out, "\n" + "Documentation/%s\n" + "%s\n" + "//apple_ref/c/tag/%s\n" + "", path, name, name); + write_description(out, description, "", 1); + fputs("\n" + "\n", out); + + scut = find_public(scut, doc, "struct"); + } + } + + /* + * Unions... + */ + + if ((scut = find_public(doc, doc, "union")) != NULL) + { + while (scut) + { + name = mxmlElementGetAttr(scut, "name"); + description = mxmlFindElement(scut, scut, "description", + NULL, NULL, MXML_DESCEND_FIRST); + + fprintf(out, "\n" + "Documentation/%s\n" + "%s\n" + "//apple_ref/c/tag/%s\n" + "", path, name, name); + write_description(out, description, "", 1); + fputs("\n" + "\n", out); + + scut = find_public(scut, doc, "union"); + } + } + + /* + * Globals variables... + */ + + if ((arg = find_public(doc, doc, "variable")) != NULL) + { + while (arg) + { + name = mxmlElementGetAttr(arg, "name"); + description = mxmlFindElement(arg, arg, "description", + NULL, NULL, MXML_DESCEND_FIRST); + + fprintf(out, "\n" + "Documentation/%s\n" + "%s\n" + "//apple_ref/c/data/%s\n" + "", path, name, name); + write_description(out, description, "", 1); + fputs("\n" + "\n", out); + + arg = find_public(arg, doc, "variable"); + } + } + + /* + * Enumerations/constants... + */ + + if ((scut = find_public(doc, doc, "enumeration")) != NULL) + { + while (scut) + { + cename = mxmlElementGetAttr(scut, "name"); + description = mxmlFindElement(scut, scut, "description", + NULL, NULL, MXML_DESCEND_FIRST); + + fprintf(out, "\n" + "Documentation/%s\n" + "%s\n" + "//apple_ref/c/tag/%s\n" + "", path, cename, cename); + write_description(out, description, "", 1); + fputs("\n" + "\n", out); + + for (arg = mxmlFindElement(scut, scut, "constant", NULL, NULL, + MXML_DESCEND_FIRST); + arg; + arg = mxmlFindElement(arg, scut, "constant", NULL, NULL, + MXML_NO_DESCEND)) + { + name = mxmlElementGetAttr(arg, "name"); + description = mxmlFindElement(arg, arg, "description", NULL, + NULL, MXML_DESCEND_FIRST); + fprintf(out, "\n" + "Documentation/%s\n" + "%s\n" + "//apple_ref/c/econst/%s\n" + "", path, cename, name); + write_description(out, description, "", 1); + fputs("\n" + "\n", out); + } + + scut = find_public(scut, doc, "enumeration"); + } + } +} + + +/* + * 'ws_cb()' - Whitespace callback for saving. + */ + +static const char * /* O - Whitespace string or NULL for none */ +ws_cb(mxml_node_t *node, /* I - Element node */ + int where) /* I - Where value */ +{ + const char *name; /* Name of element */ + int depth; /* Depth of node */ + static const char *spaces = " "; + /* Whitespace (40 spaces) for indent */ + + + name = node->value.element.name; + + switch (where) + { + case MXML_WS_BEFORE_CLOSE : + if (strcmp(name, "argument") && + strcmp(name, "class") && + strcmp(name, "constant") && + strcmp(name, "enumeration") && + strcmp(name, "function") && + strcmp(name, "mxmldoc") && + strcmp(name, "namespace") && + strcmp(name, "returnvalue") && + strcmp(name, "struct") && + strcmp(name, "typedef") && + strcmp(name, "union") && + strcmp(name, "variable")) + return (NULL); + + for (depth = -4; node; node = node->parent, depth += 2); + if (depth > 40) + return (spaces); + else if (depth < 2) + return (NULL); + else + return (spaces + 40 - depth); + + case MXML_WS_AFTER_CLOSE : + return ("\n"); + + case MXML_WS_BEFORE_OPEN : + for (depth = -4; node; node = node->parent, depth += 2); + if (depth > 40) + return (spaces); + else if (depth < 2) + return (NULL); + else + return (spaces + 40 - depth); + + default : + case MXML_WS_AFTER_OPEN : + if (strcmp(name, "argument") && + strcmp(name, "class") && + strcmp(name, "constant") && + strcmp(name, "enumeration") && + strcmp(name, "function") && + strcmp(name, "mxmldoc") && + strcmp(name, "namespace") && + strcmp(name, "returnvalue") && + strcmp(name, "struct") && + strcmp(name, "typedef") && + strcmp(name, "union") && + strcmp(name, "variable") && + strncmp(name, "?xml", 4)) + return (NULL); + else + return ("\n"); + } +} + + +/* + * End of "$Id: mxmldoc.c 390 2009-05-05 13:38:00Z mike $". + */ diff -Naur mxml-2.6/temp1.xmlfd mxml-2.6-haiku/temp1.xmlfd --- mxml-2.6/temp1.xmlfd 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/temp1.xmlfd 2009-10-26 02:35:54.000000000 +0000 @@ -0,0 +1,29 @@ + + + + 123 + Now is the time for all good men to come to the aid of their +country. + + + diff -Naur mxml-2.6/test/class.cxx mxml-2.6-haiku/test/class.cxx --- mxml-2.6/test/class.cxx 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/test/class.cxx 2008-01-26 23:27:19.000000000 +0000 @@ -0,0 +1,84 @@ +class foo_c : public bar_c // Foo class derived from bar +{ + float foo; /* Real number */ + int bar; /* Integer */ + + public: + + foo_c(float f, int b); + ~foo_c(); + + // 'get_bar()' - Get the value of bar. + int // O - Value of bar + get_bar() + { + return (bar); + } + + // 'get_foo()' - Get the value of foo. + float // O - Value of foo + get_foo() + { + return (foo); + } + + // 'set_bar()' - Set the value of bar. + void + set_bar(int b) // I - Value of bar + { + bar = b; + } + + // 'set_foo()' - Set the value of foo. + void + set_foo(float f) // I - Value of foo + { + foo = f; + } + + // 'set_foobar()' - Set foo and optionally bar (should show default args). + void + set_foobar(float f, // I - Value of foo + int b = 0) // I - Value of bar + { + foo = f; + bar = b; + } + + protected: + + static int global; /* Global integer */ + + // 'get_global()' - Get the global integer. + int // O - Integer + get_global() + { + return (global); + } + + private: + + int barfoo; // Another private integer + + public: + + // 'get_barfoo()' - Get the barfoo value. + int // O - Barfoo value + get_barfoo() + { + return (barfoo); + } +} + +// 'foo_c::foo_c()' - Create a foo_c class. +foo_c::foo_c(float f, // I - Value of foo + int b) // I - Value of bar +{ + foo = f; + bar = b; +} + +// 'foo_c::~foo_c()' - Destroy a foo_c class. +foo_c::~foo_c() +{ +} diff -Naur mxml-2.6/test/dotest.sh mxml-2.6-haiku/test/dotest.sh --- mxml-2.6/test/dotest.sh 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/test/dotest.sh 2008-03-19 21:09:21.000000000 +0000 @@ -0,0 +1,47 @@ +#!/bin/sh +(cd ..; make mxmldoc-static) + +files="" +mode="" + +while test $# -gt 0; do + arg="$1" + shift + + case "$arg" in + -f) framed="--framed framed" ;; + -g) mode="gdb" ;; + -v) mode="valgrind" ;; + *.h | *.c | *.cxx) files="$files $arg" ;; + *) + echo "Usage: ./dotest.sh [-f] [-g] [-v] [files]" + exit 1 + ;; + esac +done + +if test "$files" = ""; then + files=*.cxx +fi + +rm -f test.xml + +case "$mode" in + gdb) + echo "break malloc_error_break" >.gdbcmds + echo "set env DYLD_INSERT_LIBRARIES /usr/lib/libgmalloc.dylib" >>.gdbcmds + echo "run $framed test.xml $files >test.html 2>test.log" >>.gdbcmds + gdb -x .gdbcmds ../mxmldoc-static + ;; + + valgrind) + valgrind --log-fd=3 --leak-check=yes \ + ../mxmldoc-static $framed test.xml $files \ + >test.html 2>test.log 3>test.valgrind + ;; + + *) + ../mxmldoc-static $framed test.xml $files >test.html 2>test.log + ;; +esac + diff -Naur mxml-2.6/test/enum.cxx mxml-2.6-haiku/test/enum.cxx --- mxml-2.6/test/enum.cxx 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/test/enum.cxx 2009-05-05 04:43:18.000000000 +0000 @@ -0,0 +1,17 @@ +typedef enum foo_enum_e /* Sample enumeration type */ +{ + FOO_ONE, /* One fish */ + FOO_TWO, /* Two fish */ + FOO_RED, /* Red fish */ + FOO_BLUE, /* Blue fish */ + FOO_PRIVATE /* Private fish @private@ */ +} foo_enum_t; + +typedef enum foo_enum2_e /* Sample enumeration type #2 */ +{ + FOO2_ONE, /* One fish #2 */ + FOO2_TWO, /* Two fish #2 */ + FOO2_RED, /* Red fish #2 */ + FOO2_BLUE, /* Blue fish #2 */ + FOO2_PRIVATE /* Private fish #2 @private@ */ +} foo_enum2_t; diff -Naur mxml-2.6/test/function.cxx mxml-2.6-haiku/test/function.cxx --- mxml-2.6/test/function.cxx 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/test/function.cxx 2008-01-27 08:01:43.000000000 +0000 @@ -0,0 +1,107 @@ +/* + * 'foo_void_function()' - Do foo with bar. + * + * Use the @link foo_float_function@ or @link foo_int_function@ functions + * instead. Pass @code NULL@ for "three" then there is no string to print. + * + * @deprecated@ + */ + +void +foo_void_function(int one, /* I - Integer */ + float *two, /* O - Real number */ + const char *three) /* I - String */ +{ + if (one) + { + puts("Hello, World!"); + } + else + puts(three); + + *two = 2.0f; +} + + +/* + * 'foo_float_function()' - Do foo with bar. + * + * @since 1.2@ + */ + +float /* O - Real number */ +foo_float_function(int one, /* I - Integer */ + const char *two) /* I - String */ +{ + if (one) + { + puts("Hello, World!"); + } + else + puts(two); + + return (2.0f); +} + + +/* + * 'foo_default_string()' - Do something with a defaulted string arg. + */ + +int /* O - Integer value */ +foo_default_string(int one, /* I - Integer */ + const char *two = "2") + /* I - String */ +{ + if (one) + { + puts("Hello, World!"); + } + else + puts(two); + + return (2); +} + + +/* + * 'foo_default_int()' - Do something with a defaulted int arg. + */ + +int /* O - Integer value */ +foo_default_int(int one, /* I - Integer */ + int two = 2) /* I - Integer */ +{ + if (one) + { + puts("Hello, World!"); + } + else + puts(two); + + return (2); +} + + +/* + * 'foo_void_func()' - Function taking no arguments. + */ + +void +foo_void_func(void) +{ + puts("foo_void_func()"); +} + + +/* + * 'foo_private_func()' - Private function. + * + * @private@ + */ + +void +foo_private_func(void) +{ + puts("foo_private_func()"); +} diff -Naur mxml-2.6/test/functype.cxx mxml-2.6-haiku/test/functype.cxx --- mxml-2.6/test/functype.cxx 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/test/functype.cxx 2005-09-29 02:20:19.000000000 +0000 @@ -0,0 +1 @@ +typedef int (*foo_func_t)(void *foo, int bar); /**** Foo function type ****/ diff -Naur mxml-2.6/test/struct.cxx mxml-2.6-haiku/test/struct.cxx --- mxml-2.6/test/struct.cxx 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/test/struct.cxx 2008-01-26 20:50:28.000000000 +0000 @@ -0,0 +1,55 @@ +typedef struct foo_s /* Foo structure */ +{ + float foo; /* Real number */ + int bar; /* Integer */ + + foo_s(float f, int b); + ~foo_s(); + + // 'get_bar()' - Get the value of bar. + int // O - Value of bar + get_bar() + { + return (bar); + } + + // 'get_foo()' - Get the value of foo. + float // O - Value of foo + get_foo() + { + return (foo); + } + + // 'set_bar()' - Set the value of bar. + void + set_bar(int b) // I - Value of bar + { + bar = b; + } + + // 'set_foo()' - Set the value of foo. + void + set_foo(float f) // I - Value of foo + { + foo = f; + } +} foo_t; + +// 'foo_s::foo_s()' - Create a foo_s structure. +foo_s::foo_s(float f, // I - Value of foo + int b) // I - Value of bar +{ + foo = f; + bar = b; +} + +// 'foo_s::~foo_s()' - Destroy a foo_s structure. +foo_s::~foo_s() +{ +} + +typedef struct foo_private_s /* @private@ */ +{ + int a; /* Value of "a" */ + char b[255]; /* Value of "b" */ +} foo_private_t; diff -Naur mxml-2.6/test/type.cxx mxml-2.6-haiku/test/type.cxx --- mxml-2.6/test/type.cxx 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/test/type.cxx 2005-11-30 15:31:58.000000000 +0000 @@ -0,0 +1,3 @@ +typedef int foo_simple_t; /* Simple integer type */ + +typedef int foo_simple_private_t; /* @private@ */ diff -Naur mxml-2.6/test.xml mxml-2.6-haiku/test.xml --- mxml-2.6/test.xml 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/test.xml 2005-01-29 17:03:33.000000000 +0000 @@ -0,0 +1,29 @@ + + + + 123 + Now is the time for all good men to come to the aid of their +country. + + + diff -Naur mxml-2.6/testmxml.c mxml-2.6-haiku/testmxml.c --- mxml-2.6/testmxml.c 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/testmxml.c 2009-02-05 06:06:11.000000000 +0000 @@ -0,0 +1,748 @@ +/* + * "$Id: testmxml.c 381 2009-02-05 06:06:11Z mike $" + * + * Test program for Mini-XML, a small XML-like file parsing library. + * + * Copyright 2003-2007 by Michael Sweet. + * + * This program is free software; you can redistribute it and/or + * modify it under the terms of the GNU Library General Public + * License as published by the Free Software Foundation; either + * version 2, or (at your option) any later version. + * + * This program is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU General Public License for more details. + * + * Contents: + * + * main() - Main entry for test program. + * sax_cb() - SAX callback. + * type_cb() - XML data type callback for mxmlLoadFile()... + * whitespace_cb() - Let the mxmlSaveFile() function know when to insert + * newlines and tabs... + */ + +/* + * Include necessary headers... + */ + +#include "config.h" +#include "mxml.h" +#ifndef WIN32 +# include +#endif /* !WIN32 */ +#include +#ifndef O_BINARY +# define O_BINARY 0 +#endif /* !O_BINARY */ + + +/* + * Globals... + */ + +int event_counts[6]; + + +/* + * Local functions... + */ + +void sax_cb(mxml_node_t *node, mxml_sax_event_t event, void *data); +mxml_type_t type_cb(mxml_node_t *node); +const char *whitespace_cb(mxml_node_t *node, int where); + + +/* + * 'main()' - Main entry for test program. + */ + +int /* O - Exit status */ +main(int argc, /* I - Number of command-line args */ + char *argv[]) /* I - Command-line args */ +{ + int i; /* Looping var */ + FILE *fp; /* File to read */ + int fd; /* File descriptor */ + mxml_node_t *tree, /* XML tree */ + *node; /* Node which should be in test.xml */ + mxml_index_t *ind; /* XML index */ + char buffer[16384]; /* Save string */ + static const char *types[] = /* Strings for node types */ + { + "MXML_ELEMENT", + "MXML_INTEGER", + "MXML_OPAQUE", + "MXML_REAL", + "MXML_TEXT" + }; + + + /* + * Check arguments... + */ + + if (argc != 2) + { + fputs("Usage: testmxml filename.xml\n", stderr); + return (1); + } + + /* + * Test the basic functionality... + */ + + tree = mxmlNewElement(MXML_NO_PARENT, "element"); + + if (!tree) + { + fputs("ERROR: No parent node in basic test!\n", stderr); + return (1); + } + + if (tree->type != MXML_ELEMENT) + { + fprintf(stderr, "ERROR: Parent has type %s (%d), expected MXML_ELEMENT!\n", + tree->type < MXML_ELEMENT || tree->type > MXML_TEXT ? + "UNKNOWN" : types[tree->type], tree->type); + mxmlDelete(tree); + return (1); + } + + if (strcmp(tree->value.element.name, "element")) + { + fprintf(stderr, "ERROR: Parent value is \"%s\", expected \"element\"!\n", + tree->value.element.name); + mxmlDelete(tree); + return (1); + } + + mxmlNewInteger(tree, 123); + mxmlNewOpaque(tree, "opaque"); + mxmlNewReal(tree, 123.4f); + mxmlNewText(tree, 1, "text"); + + mxmlLoadString(tree, "string string string", + MXML_NO_CALLBACK); + mxmlLoadString(tree, "1 2 3", + MXML_INTEGER_CALLBACK); + mxmlLoadString(tree, "1.0 2.0 3.0", + MXML_REAL_CALLBACK); + mxmlLoadString(tree, "opaque opaque opaque", + MXML_OPAQUE_CALLBACK); + + node = tree->child; + + if (!node) + { + fputs("ERROR: No first child node in basic test!\n", stderr); + mxmlDelete(tree); + return (1); + } + + if (node->type != MXML_INTEGER) + { + fprintf(stderr, "ERROR: First child has type %s (%d), expected MXML_INTEGER!\n", + node->type < MXML_ELEMENT || node->type > MXML_TEXT ? + "UNKNOWN" : types[node->type], node->type); + mxmlDelete(tree); + return (1); + } + + if (node->value.integer != 123) + { + fprintf(stderr, "ERROR: First child value is %d, expected 123!\n", + node->value.integer); + mxmlDelete(tree); + return (1); + } + + node = node->next; + + if (!node) + { + fputs("ERROR: No second child node in basic test!\n", stderr); + mxmlDelete(tree); + return (1); + } + + if (node->type != MXML_OPAQUE) + { + fprintf(stderr, "ERROR: Second child has type %s (%d), expected MXML_OPAQUE!\n", + node->type < MXML_ELEMENT || node->type > MXML_TEXT ? + "UNKNOWN" : types[node->type], node->type); + mxmlDelete(tree); + return (1); + } + + if (!node->value.opaque || strcmp(node->value.opaque, "opaque")) + { + fprintf(stderr, "ERROR: Second child value is \"%s\", expected \"opaque\"!\n", + node->value.opaque ? node->value.opaque : "(null)"); + mxmlDelete(tree); + return (1); + } + + node = node->next; + + if (!node) + { + fputs("ERROR: No third child node in basic test!\n", stderr); + mxmlDelete(tree); + return (1); + } + + if (node->type != MXML_REAL) + { + fprintf(stderr, "ERROR: Third child has type %s (%d), expected MXML_REAL!\n", + node->type < MXML_ELEMENT || node->type > MXML_TEXT ? + "UNKNOWN" : types[node->type], node->type); + mxmlDelete(tree); + return (1); + } + + if (node->value.real != 123.4f) + { + fprintf(stderr, "ERROR: Third child value is %f, expected 123.4!\n", + node->value.real); + mxmlDelete(tree); + return (1); + } + + node = node->next; + + if (!node) + { + fputs("ERROR: No fourth child node in basic test!\n", stderr); + mxmlDelete(tree); + return (1); + } + + if (node->type != MXML_TEXT) + { + fprintf(stderr, "ERROR: Fourth child has type %s (%d), expected MXML_TEXT!\n", + node->type < MXML_ELEMENT || node->type > MXML_TEXT ? + "UNKNOWN" : types[node->type], node->type); + mxmlDelete(tree); + return (1); + } + + if (!node->value.text.whitespace || + !node->value.text.string || strcmp(node->value.text.string, "text")) + { + fprintf(stderr, "ERROR: Fourth child value is %d,\"%s\", expected 1,\"text\"!\n", + node->value.text.whitespace, + node->value.text.string ? node->value.text.string : "(null)"); + mxmlDelete(tree); + return (1); + } + + for (i = 0; i < 4; i ++) + { + node = node->next; + + if (!node) + { + fprintf(stderr, "ERROR: No group #%d child node in basic test!\n", i + 1); + mxmlDelete(tree); + return (1); + } + + if (node->type != MXML_ELEMENT) + { + fprintf(stderr, "ERROR: Group child #%d has type %s (%d), expected MXML_ELEMENT!\n", + i + 1, node->type < MXML_ELEMENT || node->type > MXML_TEXT ? + "UNKNOWN" : types[node->type], node->type); + mxmlDelete(tree); + return (1); + } + } + + /* + * Test indices... + */ + + ind = mxmlIndexNew(tree, NULL, NULL); + if (!ind) + { + fputs("ERROR: Unable to create index of all nodes!\n", stderr); + mxmlDelete(tree); + return (1); + } + + if (ind->num_nodes != 5) + { + fprintf(stderr, "ERROR: Index of all nodes contains %d " + "nodes; expected 5!\n", ind->num_nodes); + mxmlIndexDelete(ind); + mxmlDelete(tree); + return (1); + } + + mxmlIndexReset(ind); + if (!mxmlIndexFind(ind, "group", NULL)) + { + fputs("ERROR: mxmlIndexFind for \"group\" failed!\n", stderr); + mxmlIndexDelete(ind); + mxmlDelete(tree); + return (1); + } + + mxmlIndexDelete(ind); + + ind = mxmlIndexNew(tree, "group", NULL); + if (!ind) + { + fputs("ERROR: Unable to create index of groups!\n", stderr); + mxmlDelete(tree); + return (1); + } + + if (ind->num_nodes != 4) + { + fprintf(stderr, "ERROR: Index of groups contains %d " + "nodes; expected 4!\n", ind->num_nodes); + mxmlIndexDelete(ind); + mxmlDelete(tree); + return (1); + } + + mxmlIndexReset(ind); + if (!mxmlIndexEnum(ind)) + { + fputs("ERROR: mxmlIndexEnum failed!\n", stderr); + mxmlIndexDelete(ind); + mxmlDelete(tree); + return (1); + } + + mxmlIndexDelete(ind); + + ind = mxmlIndexNew(tree, NULL, "type"); + if (!ind) + { + fputs("ERROR: Unable to create index of type attributes!\n", stderr); + mxmlDelete(tree); + return (1); + } + + if (ind->num_nodes != 3) + { + fprintf(stderr, "ERROR: Index of type attributes contains %d " + "nodes; expected 3!\n", ind->num_nodes); + mxmlIndexDelete(ind); + mxmlDelete(tree); + return (1); + } + + mxmlIndexReset(ind); + if (!mxmlIndexFind(ind, NULL, "string")) + { + fputs("ERROR: mxmlIndexFind for \"string\" failed!\n", stderr); + mxmlIndexDelete(ind); + mxmlDelete(tree); + return (1); + } + + mxmlIndexDelete(ind); + + ind = mxmlIndexNew(tree, "group", "type"); + if (!ind) + { + fputs("ERROR: Unable to create index of elements and attributes!\n", stderr); + mxmlDelete(tree); + return (1); + } + + if (ind->num_nodes != 3) + { + fprintf(stderr, "ERROR: Index of elements and attributes contains %d " + "nodes; expected 3!\n", ind->num_nodes); + mxmlIndexDelete(ind); + mxmlDelete(tree); + return (1); + } + + mxmlIndexReset(ind); + if (!mxmlIndexFind(ind, "group", "string")) + { + fputs("ERROR: mxmlIndexFind for \"string\" failed!\n", stderr); + mxmlIndexDelete(ind); + mxmlDelete(tree); + return (1); + } + + mxmlIndexDelete(ind); + + /* + * Check the mxmlDelete() works properly... + */ + + for (i = 0; i < 8; i ++) + { + if (tree->child) + mxmlDelete(tree->child); + else + { + fprintf(stderr, "ERROR: Child pointer prematurely NULL on child #%d\n", + i + 1); + mxmlDelete(tree); + return (1); + } + } + + if (tree->child) + { + fputs("ERROR: Child pointer not NULL after deleting all children!\n", stderr); + return (1); + } + + if (tree->last_child) + { + fputs("ERROR: Last child pointer not NULL after deleting all children!\n", stderr); + return (1); + } + + mxmlDelete(tree); + + /* + * Open the file... + */ + + if (argv[1][0] == '<') + tree = mxmlLoadString(NULL, argv[1], type_cb); + else if ((fp = fopen(argv[1], "rb")) == NULL) + { + perror(argv[1]); + return (1); + } + else + { + /* + * Read the file... + */ + + tree = mxmlLoadFile(NULL, fp, type_cb); + + fclose(fp); + } + + if (!tree) + { + fputs("Unable to read XML file!\n", stderr); + return (1); + } + + if (!strcmp(argv[1], "test.xml")) + { + /* + * Verify that mxmlFindElement() and indirectly mxmlWalkNext() work + * properly... + */ + + if ((node = mxmlFindElement(tree, tree, "choice", NULL, NULL, + MXML_DESCEND)) == NULL) + { + fputs("Unable to find first element in XML tree!\n", stderr); + mxmlDelete(tree); + return (1); + } + + if (!mxmlFindElement(node, tree, "choice", NULL, NULL, MXML_NO_DESCEND)) + { + fputs("Unable to find second element in XML tree!\n", stderr); + mxmlDelete(tree); + return (1); + } + } + + /* + * Print the XML tree... + */ + + mxmlSaveFile(tree, stdout, whitespace_cb); + + /* + * Save the XML tree to a string and print it... + */ + + if (mxmlSaveString(tree, buffer, sizeof(buffer), whitespace_cb) > 0) + fputs(buffer, stderr); + + /* + * Delete the tree... + */ + + mxmlDelete(tree); + + /* + * Read from/write to file descriptors... + */ + + if (argv[1][0] != '<') + { + /* + * Open the file again... + */ + + if ((fd = open(argv[1], O_RDONLY | O_BINARY)) < 0) + { + perror(argv[1]); + return (1); + } + + /* + * Read the file... + */ + + tree = mxmlLoadFd(NULL, fd, type_cb); + + close(fd); + + /* + * Create filename.xmlfd... + */ + + snprintf(buffer, sizeof(buffer), "%sfd", argv[1]); + + if ((fd = open(buffer, O_WRONLY | O_CREAT | O_TRUNC | O_BINARY, 0666)) < 0) + { + perror(buffer); + mxmlDelete(tree); + return (1); + } + + /* + * Write the file... + */ + + mxmlSaveFd(tree, fd, whitespace_cb); + + close(fd); + + /* + * Delete the tree... + */ + + mxmlDelete(tree); + } + + /* + * Test SAX methods... + */ + + memset(event_counts, 0, sizeof(event_counts)); + + if (argv[1][0] == '<') + mxmlSAXLoadString(NULL, argv[1], type_cb, sax_cb, NULL); + else if ((fp = fopen(argv[1], "rb")) == NULL) + { + perror(argv[1]); + return (1); + } + else + { + /* + * Read the file... + */ + + mxmlSAXLoadFile(NULL, fp, type_cb, sax_cb, NULL); + + fclose(fp); + } + + if (!strcmp(argv[1], "test.xml")) + { + if (event_counts[MXML_SAX_CDATA] != 1) + { + fprintf(stderr, "MXML_SAX_CDATA seen %d times, expected 1 times!\n", + event_counts[MXML_SAX_CDATA]); + return (1); + } + + if (event_counts[MXML_SAX_COMMENT] != 1) + { + fprintf(stderr, "MXML_SAX_COMMENT seen %d times, expected 1 times!\n", + event_counts[MXML_SAX_COMMENT]); + return (1); + } + + if (event_counts[MXML_SAX_DATA] != 61) + { + fprintf(stderr, "MXML_SAX_DATA seen %d times, expected 61 times!\n", + event_counts[MXML_SAX_DATA]); + return (1); + } + + if (event_counts[MXML_SAX_DIRECTIVE] != 1) + { + fprintf(stderr, "MXML_SAX_DIRECTIVE seen %d times, expected 1 times!\n", + event_counts[MXML_SAX_DIRECTIVE]); + return (1); + } + + if (event_counts[MXML_SAX_ELEMENT_CLOSE] != 20) + { + fprintf(stderr, "MXML_SAX_ELEMENT_CLOSE seen %d times, expected 20 times!\n", + event_counts[MXML_SAX_ELEMENT_CLOSE]); + return (1); + } + + if (event_counts[MXML_SAX_ELEMENT_OPEN] != 20) + { + fprintf(stderr, "MXML_SAX_ELEMENT_OPEN seen %d times, expected 20 times!\n", + event_counts[MXML_SAX_ELEMENT_OPEN]); + return (1); + } + } + + /* + * Return... + */ + + return (0); +} + + +/* + * 'sax_cb()' - Process nodes via SAX. + */ + +void +sax_cb(mxml_node_t *node, /* I - Current node */ + mxml_sax_event_t event, /* I - SAX event */ + void *data) /* I - SAX user data */ +{ + /* + * This SAX callback just counts the different events. + */ + + event_counts[event] ++; +} + + +/* + * 'type_cb()' - XML data type callback for mxmlLoadFile()... + */ + +mxml_type_t /* O - Data type */ +type_cb(mxml_node_t *node) /* I - Element node */ +{ + const char *type; /* Type string */ + + + /* + * You can lookup attributes and/or use the element name, hierarchy, etc... + */ + + if ((type = mxmlElementGetAttr(node, "type")) == NULL) + type = node->value.element.name; + + if (!strcmp(type, "integer")) + return (MXML_INTEGER); + else if (!strcmp(type, "opaque") || !strcmp(type, "pre")) + return (MXML_OPAQUE); + else if (!strcmp(type, "real")) + return (MXML_REAL); + else + return (MXML_TEXT); +} + + +/* + * 'whitespace_cb()' - Let the mxmlSaveFile() function know when to insert + * newlines and tabs... + */ + +const char * /* O - Whitespace string or NULL */ +whitespace_cb(mxml_node_t *node, /* I - Element node */ + int where) /* I - Open or close tag? */ +{ + mxml_node_t *parent; /* Parent node */ + int level; /* Indentation level */ + const char *name; /* Name of element */ + static const char *tabs = "\t\t\t\t\t\t\t\t"; + /* Tabs for indentation */ + + + /* + * We can conditionally break to a new line before or after any element. + * These are just common HTML elements... + */ + + name = node->value.element.name; + + if (!strcmp(name, "html") || !strcmp(name, "head") || !strcmp(name, "body") || + !strcmp(name, "pre") || !strcmp(name, "p") || + !strcmp(name, "h1") || !strcmp(name, "h2") || !strcmp(name, "h3") || + !strcmp(name, "h4") || !strcmp(name, "h5") || !strcmp(name, "h6")) + { + /* + * Newlines before open and after close... + */ + + if (where == MXML_WS_BEFORE_OPEN || where == MXML_WS_AFTER_CLOSE) + return ("\n"); + } + else if (!strcmp(name, "dl") || !strcmp(name, "ol") || !strcmp(name, "ul")) + { + /* + * Put a newline before and after list elements... + */ + + return ("\n"); + } + else if (!strcmp(name, "dd") || !strcmp(name, "dt") || !strcmp(name, "li")) + { + /* + * Put a tab before
    • 's,
      's, and
      's, and a newline after them... + */ + + if (where == MXML_WS_BEFORE_OPEN) + return ("\t"); + else if (where == MXML_WS_AFTER_CLOSE) + return ("\n"); + } + else if (!strncmp(name, "?xml", 4)) + { + if (where == MXML_WS_AFTER_OPEN) + return ("\n"); + else + return (NULL); + } + else if (where == MXML_WS_BEFORE_OPEN || + ((!strcmp(name, "choice") || !strcmp(name, "option")) && + where == MXML_WS_BEFORE_CLOSE)) + { + for (level = -1, parent = node->parent; + parent; + level ++, parent = parent->parent); + + if (level > 8) + level = 8; + else if (level < 0) + level = 0; + + return (tabs + 8 - level); + } + else if (where == MXML_WS_AFTER_CLOSE || + ((!strcmp(name, "group") || !strcmp(name, "option") || + !strcmp(name, "choice")) && + where == MXML_WS_AFTER_OPEN)) + return ("\n"); + else if (where == MXML_WS_AFTER_OPEN && !node->child) + return ("\n"); + + /* + * Return NULL for no added whitespace... + */ + + return (NULL); +} + + +/* + * End of "$Id: testmxml.c 381 2009-02-05 06:06:11Z mike $". + */ diff -Naur mxml-2.6/vcnet/config.h mxml-2.6-haiku/vcnet/config.h --- mxml-2.6/vcnet/config.h 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/vcnet/config.h 2009-04-18 17:05:52.000000000 +0000 @@ -0,0 +1,125 @@ +/* + * "$Id: config.h 387 2009-04-18 17:05:52Z mike $" + * + * Configuration file for Mini-XML, a small XML-like file parsing library. + * + * Copyright 2003-2009 by Michael Sweet. + * + * This program is free software; you can redistribute it and/or + * modify it under the terms of the GNU Library General Public + * License as published by the Free Software Foundation; either + * version 2, or (at your option) any later version. + * + * This program is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU General Public License for more details. + */ + +/* + * Beginning with VC2005, Microsoft breaks ISO C and POSIX conformance + * by deprecating a number of functions in the name of security, even + * when many of the affected functions are otherwise completely secure. + * The _CRT_SECURE_NO_DEPRECATE definition ensures that we won't get + * warnings from their use... + * + * Then Microsoft decided that they should ignore this in VC2008 and use + * yet another define (_CRT_SECURE_NO_WARNINGS) instead. Bastards. + */ + +#define _CRT_SECURE_NO_DEPRECATE +#define _CRT_SECURE_NO_WARNINGS + + +/* + * Include necessary headers... + */ + +#include +#include +#include +#include +#include +#include + + +/* + * Microsoft also renames the POSIX functions to _name, and introduces + * a broken compatibility layer using the original names. As a result, + * random crashes can occur when, for example, strdup() allocates memory + * from a different heap than used by malloc() and free(). + * + * To avoid moronic problems like this, we #define the POSIX function + * names to the corresponding non-standard Microsoft names. + */ + +#define close _close +#define open _open +#define read _read +#define snprintf _snprintf +#define strdup _strdup +#define vsnprintf _vsnprintf +#define write _write + + +/* + * Version number... + */ + +#define MXML_VERSION "Mini-XML v2.6" + + +/* + * Inline function support... + */ + +#define inline _inline + + +/* + * Long long support... + */ + +#define HAVE_LONG_LONG 1 + + +/* + * Do we have the snprintf() and vsnprintf() functions? + */ + +#define HAVE_SNPRINTF 1 +#define HAVE_VSNPRINTF 1 + + +/* + * Do we have the strXXX() functions? + */ + +#define HAVE_STRDUP 1 + + +/* + * Define prototypes for string functions as needed... + */ + +# ifndef HAVE_STRDUP +extern char *_mxml_strdup(const char *); +# define strdup _mxml_strdup +# endif /* !HAVE_STRDUP */ + +extern char *_mxml_strdupf(const char *, ...); +extern char *_mxml_vstrdupf(const char *, va_list); + +# ifndef HAVE_SNPRINTF +extern int _mxml_snprintf(char *, size_t, const char *, ...); +# define snprintf _mxml_snprintf +# endif /* !HAVE_SNPRINTF */ + +# ifndef HAVE_VSNPRINTF +extern int _mxml_vsnprintf(char *, size_t, const char *, va_list); +# define vsnprintf _mxml_vsnprintf +# endif /* !HAVE_VSNPRINTF */ + +/* + * End of "$Id: config.h 387 2009-04-18 17:05:52Z mike $". + */ diff -Naur mxml-2.6/vcnet/mxml.sln mxml-2.6-haiku/vcnet/mxml.sln --- mxml-2.6/vcnet/mxml.sln 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/vcnet/mxml.sln 2009-05-17 16:10:38.000000000 +0000 @@ -0,0 +1,37 @@ +Microsoft Visual Studio Solution File, Format Version 10.00 +# Visual Studio 2008 +Project("{8BC9CEB8-8B4A-11D0-8D11-00A0C91BC942}") = "mxmldoc", "mxmldoc.vcproj", "{D909892E-520A-4322-9A47-DAEBDA9CC7A7}" + ProjectSection(ProjectDependencies) = postProject + {E5AA9476-9751-4654-8109-B1A2112D5E73} = {E5AA9476-9751-4654-8109-B1A2112D5E73} + EndProjectSection +EndProject +Project("{8BC9CEB8-8B4A-11D0-8D11-00A0C91BC942}") = "mxml1", "mxml1.vcproj", "{E5AA9476-9751-4654-8109-B1A2112D5E73}" +EndProject +Project("{8BC9CEB8-8B4A-11D0-8D11-00A0C91BC942}") = "testmxml", "testmxml.vcproj", "{75CAC6C4-A6BC-4935-A3C9-8F0AE0744227}" + ProjectSection(ProjectDependencies) = postProject + {E5AA9476-9751-4654-8109-B1A2112D5E73} = {E5AA9476-9751-4654-8109-B1A2112D5E73} + EndProjectSection +EndProject +Global + GlobalSection(SolutionConfigurationPlatforms) = preSolution + Debug|Win32 = Debug|Win32 + Release|Win32 = Release|Win32 + EndGlobalSection + GlobalSection(ProjectConfigurationPlatforms) = postSolution + {D909892E-520A-4322-9A47-DAEBDA9CC7A7}.Debug|Win32.ActiveCfg = Debug|Win32 + {D909892E-520A-4322-9A47-DAEBDA9CC7A7}.Debug|Win32.Build.0 = Debug|Win32 + {D909892E-520A-4322-9A47-DAEBDA9CC7A7}.Release|Win32.ActiveCfg = Release|Win32 + {D909892E-520A-4322-9A47-DAEBDA9CC7A7}.Release|Win32.Build.0 = Release|Win32 + {E5AA9476-9751-4654-8109-B1A2112D5E73}.Debug|Win32.ActiveCfg = Debug|Win32 + {E5AA9476-9751-4654-8109-B1A2112D5E73}.Debug|Win32.Build.0 = Debug|Win32 + {E5AA9476-9751-4654-8109-B1A2112D5E73}.Release|Win32.ActiveCfg = Release|Win32 + {E5AA9476-9751-4654-8109-B1A2112D5E73}.Release|Win32.Build.0 = Release|Win32 + {75CAC6C4-A6BC-4935-A3C9-8F0AE0744227}.Debug|Win32.ActiveCfg = Debug|Win32 + {75CAC6C4-A6BC-4935-A3C9-8F0AE0744227}.Debug|Win32.Build.0 = Debug|Win32 + {75CAC6C4-A6BC-4935-A3C9-8F0AE0744227}.Release|Win32.ActiveCfg = Release|Win32 + {75CAC6C4-A6BC-4935-A3C9-8F0AE0744227}.Release|Win32.Build.0 = Release|Win32 + EndGlobalSection + GlobalSection(SolutionProperties) = preSolution + HideSolutionNode = FALSE + EndGlobalSection +EndGlobal diff -Naur mxml-2.6/vcnet/mxml1.def mxml-2.6-haiku/vcnet/mxml1.def --- mxml-2.6/vcnet/mxml1.def 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/vcnet/mxml1.def 2007-12-06 06:07:50.000000000 +0000 @@ -0,0 +1,59 @@ +LIBRARY "MXML1" +EXPORTS + _mxml_strdupf + _mxml_vstrdupf + mxml_ignore_cb + mxml_integer_cb + mxml_opaque_cb + mxml_real_cb + mxmlAdd + mxmlDelete + mxmlElementDeleteAttr + mxmlElementGetAttr + mxmlElementSetAttr + mxmlElementSetAttrf + mxmlEntityAddCallback + mxmlEntityGetName + mxmlEntityGetValue + mxmlEntityRemoveCallback + mxmlFindElement + mxmlIndexDelete + mxmlIndexEnum + mxmlIndexFind + mxmlIndexNew + mxmlIndexReset + mxmlLoadFd + mxmlLoadFile + mxmlLoadString + mxmlNewCDATA + mxmlNewCustom + mxmlNewElement + mxmlNewInteger + mxmlNewOpaque + mxmlNewReal + mxmlNewText + mxmlNewTextf + mxmlNewXML + mxmlRelease + mxmlRemove + mxmlRetain + mxmlSaveAllocString + mxmlSaveFd + mxmlSaveFile + mxmlSaveString + mxmlSAXLoadFd + mxmlSAXLoadFile + mxmlSAXLoadString + mxmlSetCDATA + mxmlSetCustom + mxmlSetCustomHandlers + mxmlSetElement + mxmlSetErrorCallback + mxmlSetInteger + mxmlSetOpaque + mxmlSetReal + mxmlSetText + mxmlSetTextf + mxmlSetWrapMargin + mxmlWalkNext + mxmlWalkPrev diff -Naur mxml-2.6/vcnet/mxml1.vcproj mxml-2.6-haiku/vcnet/mxml1.vcproj --- mxml-2.6/vcnet/mxml1.vcproj 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/vcnet/mxml1.vcproj 2008-10-26 19:44:57.000000000 +0000 @@ -0,0 +1,255 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff -Naur mxml-2.6/vcnet/mxmldoc.vcproj mxml-2.6-haiku/vcnet/mxmldoc.vcproj --- mxml-2.6/vcnet/mxmldoc.vcproj 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/vcnet/mxmldoc.vcproj 2008-10-26 19:44:57.000000000 +0000 @@ -0,0 +1,203 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + diff -Naur mxml-2.6/vcnet/testmxml.vcproj mxml-2.6-haiku/vcnet/testmxml.vcproj --- mxml-2.6/vcnet/testmxml.vcproj 1970-01-01 00:00:00.000000000 +0000 +++ mxml-2.6-haiku/vcnet/testmxml.vcproj 2008-10-26 19:44:57.000000000 +0000 @@ -0,0 +1,203 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +