haikuprojects/haikuports
1
0
Fork 0
mirror of https://github.com/yann64/haikuports.git synced 2026-04-09 13:20:08 +02:00
Code Issues Packages Projects Releases Wiki Activity
Files
a11e56d15ef9359b86f65a5bc65a8ea32be5c80b
haikuports/dev-cpp/mxml/mxml-2.6.patch
Michael Vinícius de Oliveira a11e56d15e add mxml port
2009-10-30 07:49:16 +00:00

33485 lines
1.1 MiB
Raw Blame History

This file contains invisible Unicode characters
This file contains invisible Unicode characters that are indistinguishable to humans but may be processed differently by a computer. If you think that this is intentional, you can safely ignore this warning. Use the Escape button to reveal them.
This file contains Unicode characters that might be confused with other characters. If you think that this is intentional, you can safely ignore this warning. Use the Escape button to reveal them.
diff -Naur mxml-2.6/ANNOUNCEMENT mxml-2.6-haiku/ANNOUNCEMENT
--- mxml-2.6/ANNOUNCEMENT 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/ANNOUNCEMENT 2007-11-23 02:15:07.000000000 +0000
@@ -0,0 +1,7 @@
+Mini-XML 2.4 is now available for download from:
+
+ http://www.easysw.com/~mike/mxml/software.php
+
+Mini-XML 2.4 fixes some build and XML parsing bugs, adds support
+for the apos character entity, and adds per-thread global settings.
+
diff -Naur mxml-2.6/CHANGES mxml-2.6-haiku/CHANGES
--- mxml-2.6/CHANGES 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/CHANGES 2009-05-17 17:31:51.000000000 +0000
@@ -0,0 +1,323 @@
+CHANGES - 2009-05-17
+--------------------
+
+CHANGES IN Mini-XML 2.6
+
+ - Documentation fixes (STR #91, STR #92)
+ - The mxmldoc program did not handle typedef comments properly (STR #72)
+ - Added support for "long long" printf formats.
+ - The XML parser now ignores BOMs in UTF-8 XML files (STR #89)
+ - The mxmldoc program now supports generating Xcode documentation sets.
+ - mxmlSave*() did not output UTF-8 correctly on some platforms.
+ - mxmlNewXML() now adds encoding="utf-8" in the ?xml directive to avoid
+ problems with non-conformant XML parsers that assume something other
+ than UTF-8 as the default encoding.
+ - Wrapping was not disabled when mxmlSetWrapMargin(0) was called, and
+ "<?xml ... ?>" was always followed by a newline (STR #76)
+ - The mxml.pc.in file was broken (STR #79)
+ - The mxmldoc program now handles "typedef enum name {} name" correctly
+ (STR #72)
+
+
+CHANGES IN Mini-XML 2.5
+
+ - The mxmldoc program now makes greater use of CSS and
+ supports a --css option to embed an alternate stylesheet.
+ - The mxmldoc program now supports --header and --footer
+ options to insert documentation content before and
+ after the generated content.
+ - The mxmldoc program now supports a --framed option to
+ generate framed HTML output.
+ - The mxmldoc program now creates a table of contents
+ including any headings in the --intro file when
+ generating HTML output.
+ - The man pages and man page output from mxmldoc did
+ not use "\-" for dashes (STR #68)
+ - The debug version of the Mini-XML DLL could not be
+ built (STR #65)
+ - Processing instructions and directives did not work
+ when not at the top level of a document (STR #67)
+ - Spaces around the "=" in attributes were not supported
+ (STR #67)
+
+
+CHANGES IN Mini-XML 2.4
+
+ - Fixed shared library build problems on HP-UX and Mac OS X.
+ - The mxmldoc program did not output argument descriptions
+ for functions properly.
+ - All global settings (custom, error, and entity callbacks
+ and the wrap margin) are now managed separately for each
+ thread.
+ - Added mxmlElementDeleteAttr() function (STR #59)
+ - mxmlElementSetAttrf() did not work (STR #57)
+ - mxmlLoad*() incorrectly treated declarations as parent
+ elements (STR #56)
+ - mxmlLoad*() incorrectly allowed attributes without values
+ (STR #47)
+ - Fixed Visual C++ build problems (STR #49)
+ - mxmlLoad*() did not return NULL when an element contained
+ an error (STR #46)
+ - Added support for the apos character entity (STR #54)
+ - Fixed whitespace detection with Unicode characters (STR
+ #48)
+ - mxmlWalkNext() and mxmlWalkPrev() did not work correctly
+ when called with a node with no children as the top node
+ (STR #53)
+
+
+CHANGES IN Mini-XML 2.3
+
+ - Added two exceptions to the LGPL to support static
+ linking of applications against Mini-XML
+ - The mxmldoc utility can now generate man pages, too.
+ - Added a mxmlNewXML() function
+ - Added a mxmlElementSetAttrf() function (STR #43)
+ - Added snprintf() emulation function for test program (STR
+ #32)
+ - Added the _CRT_SECURE_NO_DEPRECATE definition when
+ building on VC++ 2005 (STR #36)
+ - mxmlLoad*() did not detect missing > characters in
+ elements (STR #41)
+ - mxmlLoad*() did not detect missing close tags at the end
+ of an XML document (STR #45)
+ - Added user_data and ref_count members to mxml_node_t
+ structure
+ - Added mxmlReleaseNode() and mxmlRetainNode() APIs for
+ reference-counted nodes
+ - Added mxmlSetWrapMargin() to control the wrapping of XML
+ output
+ - Added conditional check for EINTR error code for
+ certain Windows compilers that do not define it (STR
+ #33)
+ - The mxmldoc program now generates correct HTML 4.0
+ output - previously it generated invalid XHTML
+ - The mxmldoc program now supports "@deprecated@,
+ "@private@", and "@since version@" comments
+ - Fixed function and enumeration type bugs in mxmldoc.
+ - Fixed the XML schema for mxmldoc
+ - The mxmldoc program now supports --intro, --section,
+ and --title options
+ - The mxmlLoad*() functions could leak a node on an error
+ (STR #27)
+ - The mxml_vsnprintf() function could get in an infinite
+ loop on a buffer overflow (STR #25)
+ - Added new mxmlNewCDATA() and mxmlSetCDATA() functions
+ to create and set CDATA nodes, which are really just
+ special element nodes
+ - Added new MXML_IGNORE type and MXML_IGNORE_CB callback
+ to ignore non-element nodes, e.g. whitespace
+ - mxmlLoad*() crashed when reporting an error in some
+ invalid XML (STR #23)
+
+
+CHANGES IN Mini-XML 2.2.2
+
+ - mxmlLoad*() did not treat custom data as opaque, so
+ whitespace characters would be lost.
+
+
+CHANGES IN Mini-XML 2.2.1
+
+ - mxmlLoadFd(), mxmlLoadFile(), and mxmlLoadString() now
+ correctly return NULL on error (STR #21)
+ - mxmlNewInteger(), mxmlNewOpaque(), mxmlNewReal(),
+ mxmlNewText(), and mxmlNewTextf() incorrectly required
+ a parent node (STR #22)
+ - Fixed an XML output bug in mxmldoc.
+ - The "make install" target now uses the install command
+ to set the proper permissions on UNIX/Linux/OSX.
+ - Fixed a MingW/Cygwin compilation problem (STR #18)
+
+
+CHANGES IN Mini-XML 2.2
+
+ - Added shared library support (STR #17)
+ - mxmlLoad*() now returns an error when an XML stream
+ contains illegal control characters (STR #10)
+ - mxmlLoad*() now returns an error when an element
+ contains two attributes with the same name in
+ conformance with the XML spec (STR #16)
+ - Added support for CDATA (STR #14, STR #15)
+ - Updated comment and processing instruction handling -
+ no entity support per XML specification.
+ - Added checking for invalid comment termination ("--->"
+ is not allowed)
+
+
+CHANGES IN Mini-XML 2.1
+
+ - Added support for custom data nodes (STR #6)
+ - Now treat UTF-8 sequences which are longer than
+ necessary as an error (STR #4)
+ - Fixed entity number support (STR #8)
+ - Fixed mxmlLoadString() bug with UTF-8 (STR #7)
+ - Fixed entity lookup bug (STR #5)
+ - Added mxmlLoadFd() and mxmlSaveFd() functions.
+ - Fixed multi-word UTF-16 handling.
+
+
+CHANGES IN Mini-XML 2.0
+
+ - New programmers manual.
+ - Added Visual C++ project files for Microsoft Windows
+ users.
+ - Added optimizations to mxmldoc, mxmlSaveFile(), and
+ mxmlIndexNew() (STR #2)
+ - mxmlEntityAddCallback() now returns an integer status
+ (STR #2)
+ - Added UTF-16 support (input only; all output is UTF-8)
+ - Added index functions to build a searchable index of
+ XML nodes.
+ - Added character entity callback interface to support
+ additional character entities beyond those defined in
+ the XHTML specification.
+ - Added support for XHTML character entities.
+ - The mxmldoc utility now produces XML output which
+ conforms to an updated XML schema, described in the file
+ "doc/mxmldoc.xsd".
+ - Changed the whitespace callback interface to return
+ strings instead of a single character, allowing for
+ greater control over the formatting of XML files
+ written using Mini-XML. THIS CHANGE WILL REQUIRE
+ CHANGES TO YOUR 1.x CODE IF YOU USE WHITESPACE
+ CALLBACKS.
+ - The mxmldoc utility is now capable of documenting C++
+ classes, functions, and structures, and correctly
+ handles C++ comments.
+ - Added new modular tests for mxmldoc.
+ - Updated the mxmldoc output to be more compatible with
+ embedding in manuals produced with HTMLDOC.
+ - The makefile incorrectly included a "/" separator
+ between the destination path and install path. This
+ caused problems when building and installing with
+ MingW.
+
+
+CHANGES IN Mini-XML 1.3
+
+ - Fixes for mxmldoc.
+ - Added support for reading standard HTML entity names.
+ - mxmlLoadString/File() did not decode character
+ entities in element names, attribute names, or
+ attribute values.
+ - mxmlLoadString/File() would crash when loading non-
+ conformant XML data under an existing parent (top)
+ node.
+ - Fixed several bugs in the mxmldoc utility.
+ - Added new error callback function to catch a variety
+ of errors and log them to someplace other than stderr.
+ - The mxmlElementSetAttr() function now allows for NULL
+ attribute values.
+ - The load and save functions now properly handle quoted
+ element and attribute name strings properly, e.g. for
+ !DOCTYPE declarations.
+
+
+CHANGES IN Mini-XML 1.2
+
+ - Added new "set" methods to set the value of a node.
+ - Added new formatted text methods mxmlNewTextf() and
+ mxmlSetTextf() to create/set a text node value using
+ printf-style formats.
+ - Added new standard callbacks for use with the mxmlLoad
+ functions.
+ - Updated the HTML documentation to include examples of
+ the walk and load function output.
+ - Added --with/without-ansi configure option to control
+ the strdup() function check.
+ - Added --with/without-snprintf configure option to
+ control the snprintf() and vsnprintf() function
+ checks.
+
+
+CHANGES IN Mini-XML 1.1.2
+
+ - The mxml(3) man page wasn't updated for the string
+ functions.
+ - mxmlSaveString() returned the wrong number of
+ characters.
+ - mxml_add_char() updated the buffer pointer in the
+ wrong place.
+
+
+CHANGES IN Mini-XML 1.1.1
+
+ - The private mxml_add_ch() function did not update the
+ start-of-buffer pointer which could cause a crash when
+ using mxmlSaveString().
+ - The private mxml_write_ws() function called putc()
+ instead of using the proper callback which could cause
+ a crash when using mxmlSaveString().
+ - Added a mxmlSaveAllocString() convenience function for
+ saving an XML node tree to an allocated string.
+
+
+CHANGES IN Mini-XML 1.1
+
+ - The mxmlLoadFile() function now uses dynamically
+ allocated string buffers for element names, attribute
+ names, and attribute values. Previously they were
+ capped at 16383, 255, and 255 bytes, respectively.
+ - Added a new mxmlLoadString() function for loading an
+ XML node tree from a string.
+ - Added a new mxmlSaveString() function for saving an
+ XML node tree to a string.
+ - Add emulation of strdup() if the local platform does
+ not provide the function.
+
+
+CHANGES IN Mini-XML 1.0
+
+ - The mxmldoc program now handles function arguments,
+ structures, unions, enumerations, classes, and
+ typedefs properly.
+ - Documentation provided via mxmldoc and more in-line
+ comments in the code.
+ - Added man pages and packaging files.
+
+
+CHANGES IN Mini-XML 0.93
+
+ - New mxmldoc example program that is also used to
+ create and update code documentation using XML and
+ produce HTML reference pages.
+ - Added mxmlAdd() and mxmlRemove() functions to add and
+ remove nodes from a tree. This provides more
+ flexibility over where the nodes are inserted and
+ allows nodes to be moved within the tree as needed.
+ - mxmlLoadFile() now correctly handles comments.
+ - mxmlLoadFile() now supports the required "gt", "quot",
+ and "nbsp" character entities.
+ - mxmlSaveFile() now uses newlines as whitespace
+ when valid to do so.
+ - mxmlFindElement() now also takes attribute name and
+ attribute value string arguments to limit the search
+ to specific elements with attributes and/or values.
+ NULL pointers can be used as "wildcards".
+ - Added uninstall target to makefile, and auto-reconfig
+ if Makefile.in or configure.in are changed.
+ - mxmlFindElement(), mxmlWalkNext(), and mxmlWalkPrev()
+ now all provide "descend" arguments to control whether
+ they descend into child nodes in the tree.
+ - Fixed some whitespace issues in mxmlLoadFile().
+ - Fixed Unicode output and whitespace issues in
+ mxmlSaveFile().
+ - mxmlSaveFile() now supports a whitespace callback to
+ provide more human-readable XML output under program
+ control.
+
+
+CHANGES IN Mini-XML 0.92
+
+ - mxmlSaveFile() didn't return a value on success.
+
+
+CHANGES IN Mini-XML 0.91
+
+ - mxmlWalkNext() would go into an infinite loop.
+
+
+CHANGES IN Mini-XML 0.9
+
+ - Initial public release.
diff -Naur mxml-2.6/COPYING mxml-2.6-haiku/COPYING
--- mxml-2.6/COPYING 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/COPYING 2005-10-18 19:26:08.000000000 +0000
@@ -0,0 +1,507 @@
+ Mini-XML License
+ October 18, 2005
+
+
+The Mini-XML library and included programs are provided under the
+terms of the GNU Library General Public License (LGPL) with the
+following exceptions:
+
+ 1. Static linking of applications to the Mini-XML library
+ does not constitute a derivative work and does not require
+ the author to provide source code for the application, use
+ the shared Mini-XML libraries, or link their applications
+ against a user-supplied version of Mini-XML.
+
+ If you link the application to a modified version of
+ Mini-XML, then the changes to Mini-XML must be provided
+ under the terms of the LGPL in sections 1, 2, and 4.
+
+ 2. You do not have to provide a copy of the Mini-XML license
+ with programs that are linked to the Mini-XML library, nor
+ do you have to identify the Mini-XML license in your
+ program or documentation as required by section 6 of the
+ LGPL.
+
+
+ GNU LIBRARY GENERAL PUBLIC LICENSE
+ Version 2, June 1991
+
+ Copyright (C) 1991 Free Software Foundation, Inc.
+ 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA
+
+ Everyone is permitted to copy and distribute verbatim copies
+ of this license document, but changing it is not allowed.
+
+ [This is the first released version of the library GPL. It is
+ numbered 2 because it goes with version 2 of the ordinary GPL.]
+
+ Preamble
+
+ The licenses for most software are designed to take away your
+freedom to share and change it. By contrast, the GNU General Public
+Licenses are intended to guarantee your freedom to share and change
+free software--to make sure the software is free for all its users.
+
+ This license, the Library General Public License, applies to some
+specially designated Free Software Foundation software, and to any
+other libraries whose authors decide to use it. You can use it for
+your libraries, too.
+
+ When we speak of free software, we are referring to freedom, not
+price. Our General Public Licenses are designed to make sure that you
+have the freedom to distribute copies of free software (and charge for
+this service if you wish), that you receive source code or can get it
+if you want it, that you can change the software or use pieces of it
+in new free programs; and that you know you can do these things.
+
+ To protect your rights, we need to make restrictions that forbid
+anyone to deny you these rights or to ask you to surrender the rights.
+These restrictions translate to certain responsibilities for you if
+you distribute copies of the library, or if you modify it.
+
+ For example, if you distribute copies of the library, whether gratis
+or for a fee, you must give the recipients all the rights that we gave
+you. You must make sure that they, too, receive or can get the source
+code. If you link a program with the library, you must provide
+complete object files to the recipients so that they can relink them
+with the library, after making changes to the library and recompiling
+it. And you must show them these terms so they know their rights.
+
+ Our method of protecting your rights has two steps: (1) copyright
+the library, and (2) offer you this license which gives you legal
+permission to copy, distribute and/or modify the library.
+
+ Also, for each distributor's protection, we want to make certain
+that everyone understands that there is no warranty for this free
+library. If the library is modified by someone else and passed on, we
+want its recipients to know that what they have is not the original
+version, so that any problems introduced by others will not reflect on
+the original authors' reputations.
+
+ Finally, any free program is threatened constantly by software
+patents. We wish to avoid the danger that companies distributing free
+software will individually obtain patent licenses, thus in effect
+transforming the program into proprietary software. To prevent this,
+we have made it clear that any patent must be licensed for everyone's
+free use or not licensed at all.
+
+ Most GNU software, including some libraries, is covered by the ordinary
+GNU General Public License, which was designed for utility programs. This
+license, the GNU Library General Public License, applies to certain
+designated libraries. This license is quite different from the ordinary
+one; be sure to read it in full, and don't assume that anything in it is
+the same as in the ordinary license.
+
+ The reason we have a separate public license for some libraries is that
+they blur the distinction we usually make between modifying or adding to a
+program and simply using it. Linking a program with a library, without
+changing the library, is in some sense simply using the library, and is
+analogous to running a utility program or application program. However, in
+a textual and legal sense, the linked executable is a combined work, a
+derivative of the original library, and the ordinary General Public License
+treats it as such.
+
+ Because of this blurred distinction, using the ordinary General
+Public License for libraries did not effectively promote software
+sharing, because most developers did not use the libraries. We
+concluded that weaker conditions might promote sharing better.
+
+ However, unrestricted linking of non-free programs would deprive the
+users of those programs of all benefit from the free status of the
+libraries themselves. This Library General Public License is intended to
+permit developers of non-free programs to use free libraries, while
+preserving your freedom as a user of such programs to change the free
+libraries that are incorporated in them. (We have not seen how to achieve
+this as regards changes in header files, but we have achieved it as regards
+changes in the actual functions of the Library.) The hope is that this
+will lead to faster development of free libraries.
+
+ The precise terms and conditions for copying, distribution and
+modification follow. Pay close attention to the difference between a
+"work based on the library" and a "work that uses the library". The
+former contains code derived from the library, while the latter only
+works together with the library.
+
+ Note that it is possible for a library to be covered by the ordinary
+General Public License rather than by this special one.
+
+ GNU LIBRARY GENERAL PUBLIC LICENSE
+ TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION
+
+ 0. This License Agreement applies to any software library which
+contains a notice placed by the copyright holder or other authorized
+party saying it may be distributed under the terms of this Library
+General Public License (also called "this License"). Each licensee is
+addressed as "you".
+
+ A "library" means a collection of software functions and/or data
+prepared so as to be conveniently linked with application programs
+(which use some of those functions and data) to form executables.
+
+ The "Library", below, refers to any such software library or work
+which has been distributed under these terms. A "work based on the
+Library" means either the Library or any derivative work under
+copyright law: that is to say, a work containing the Library or a
+portion of it, either verbatim or with modifications and/or translated
+straightforwardly into another language. (Hereinafter, translation is
+included without limitation in the term "modification".)
+
+ "Source code" for a work means the preferred form of the work for
+making modifications to it. For a library, complete source code means
+all the source code for all modules it contains, plus any associated
+interface definition files, plus the scripts used to control compilation
+and installation of the library.
+
+ Activities other than copying, distribution and modification are not
+covered by this License; they are outside its scope. The act of
+running a program using the Library is not restricted, and output from
+such a program is covered only if its contents constitute a work based
+on the Library (independent of the use of the Library in a tool for
+writing it). Whether that is true depends on what the Library does
+and what the program that uses the Library does.
+
+ 1. You may copy and distribute verbatim copies of the Library's
+complete source code as you receive it, in any medium, provided that
+you conspicuously and appropriately publish on each copy an
+appropriate copyright notice and disclaimer of warranty; keep intact
+all the notices that refer to this License and to the absence of any
+warranty; and distribute a copy of this License along with the
+Library.
+
+ You may charge a fee for the physical act of transferring a copy,
+and you may at your option offer warranty protection in exchange for a
+fee.
+
+ 2. You may modify your copy or copies of the Library or any portion
+of it, thus forming a work based on the Library, and copy and
+distribute such modifications or work under the terms of Section 1
+above, provided that you also meet all of these conditions:
+
+ a) The modified work must itself be a software library.
+
+ b) You must cause the files modified to carry prominent notices
+ stating that you changed the files and the date of any change.
+
+ c) You must cause the whole of the work to be licensed at no
+ charge to all third parties under the terms of this License.
+
+ d) If a facility in the modified Library refers to a function or a
+ table of data to be supplied by an application program that uses
+ the facility, other than as an argument passed when the facility
+ is invoked, then you must make a good faith effort to ensure that,
+ in the event an application does not supply such function or
+ table, the facility still operates, and performs whatever part of
+ its purpose remains meaningful.
+
+ (For example, a function in a library to compute square roots has
+ a purpose that is entirely well-defined independent of the
+ application. Therefore, Subsection 2d requires that any
+ application-supplied function or table used by this function must
+ be optional: if the application does not supply it, the square
+ root function must still compute square roots.)
+
+These requirements apply to the modified work as a whole. If
+identifiable sections of that work are not derived from the Library,
+and can be reasonably considered independent and separate works in
+themselves, then this License, and its terms, do not apply to those
+sections when you distribute them as separate works. But when you
+distribute the same sections as part of a whole which is a work based
+on the Library, the distribution of the whole must be on the terms of
+this License, whose permissions for other licensees extend to the
+entire whole, and thus to each and every part regardless of who wrote
+it.
+
+Thus, it is not the intent of this section to claim rights or contest
+your rights to work written entirely by you; rather, the intent is to
+exercise the right to control the distribution of derivative or
+collective works based on the Library.
+
+In addition, mere aggregation of another work not based on the Library
+with the Library (or with a work based on the Library) on a volume of
+a storage or distribution medium does not bring the other work under
+the scope of this License.
+
+ 3. You may opt to apply the terms of the ordinary GNU General Public
+License instead of this License to a given copy of the Library. To do
+this, you must alter all the notices that refer to this License, so
+that they refer to the ordinary GNU General Public License, version 2,
+instead of to this License. (If a newer version than version 2 of the
+ordinary GNU General Public License has appeared, then you can specify
+that version instead if you wish.) Do not make any other change in
+these notices.
+
+ Once this change is made in a given copy, it is irreversible for
+that copy, so the ordinary GNU General Public License applies to all
+subsequent copies and derivative works made from that copy.
+
+ This option is useful when you wish to copy part of the code of
+the Library into a program that is not a library.
+
+ 4. You may copy and distribute the Library (or a portion or
+derivative of it, under Section 2) in object code or executable form
+under the terms of Sections 1 and 2 above provided that you accompany
+it with the complete corresponding machine-readable source code, which
+must be distributed under the terms of Sections 1 and 2 above on a
+medium customarily used for software interchange.
+
+ If distribution of object code is made by offering access to copy
+from a designated place, then offering equivalent access to copy the
+source code from the same place satisfies the requirement to
+distribute the source code, even though third parties are not
+compelled to copy the source along with the object code.
+
+ 5. A program that contains no derivative of any portion of the
+Library, but is designed to work with the Library by being compiled or
+linked with it, is called a "work that uses the Library". Such a
+work, in isolation, is not a derivative work of the Library, and
+therefore falls outside the scope of this License.
+
+ However, linking a "work that uses the Library" with the Library
+creates an executable that is a derivative of the Library (because it
+contains portions of the Library), rather than a "work that uses the
+library". The executable is therefore covered by this License.
+Section 6 states terms for distribution of such executables.
+
+ When a "work that uses the Library" uses material from a header file
+that is part of the Library, the object code for the work may be a
+derivative work of the Library even though the source code is not.
+Whether this is true is especially significant if the work can be
+linked without the Library, or if the work is itself a library. The
+threshold for this to be true is not precisely defined by law.
+
+ If such an object file uses only numerical parameters, data
+structure layouts and accessors, and small macros and small inline
+functions (ten lines or less in length), then the use of the object
+file is unrestricted, regardless of whether it is legally a derivative
+work. (Executables containing this object code plus portions of the
+Library will still fall under Section 6.)
+
+ Otherwise, if the work is a derivative of the Library, you may
+distribute the object code for the work under the terms of Section 6.
+Any executables containing that work also fall under Section 6,
+whether or not they are linked directly with the Library itself.
+
+ 6. As an exception to the Sections above, you may also compile or
+link a "work that uses the Library" with the Library to produce a
+work containing portions of the Library, and distribute that work
+under terms of your choice, provided that the terms permit
+modification of the work for the customer's own use and reverse
+engineering for debugging such modifications.
+
+ You must give prominent notice with each copy of the work that the
+Library is used in it and that the Library and its use are covered by
+this License. You must supply a copy of this License. If the work
+during execution displays copyright notices, you must include the
+copyright notice for the Library among them, as well as a reference
+directing the user to the copy of this License. Also, you must do one
+of these things:
+
+ a) Accompany the work with the complete corresponding
+ machine-readable source code for the Library including whatever
+ changes were used in the work (which must be distributed under
+ Sections 1 and 2 above); and, if the work is an executable linked
+ with the Library, with the complete machine-readable "work that
+ uses the Library", as object code and/or source code, so that the
+ user can modify the Library and then relink to produce a modified
+ executable containing the modified Library. (It is understood
+ that the user who changes the contents of definitions files in the
+ Library will not necessarily be able to recompile the application
+ to use the modified definitions.)
+
+ b) Accompany the work with a written offer, valid for at
+ least three years, to give the same user the materials
+ specified in Subsection 6a, above, for a charge no more
+ than the cost of performing this distribution.
+
+ c) If distribution of the work is made by offering access to copy
+ from a designated place, offer equivalent access to copy the above
+ specified materials from the same place.
+
+ d) Verify that the user has already received a copy of these
+ materials or that you have already sent this user a copy.
+
+ For an executable, the required form of the "work that uses the
+Library" must include any data and utility programs needed for
+reproducing the executable from it. However, as a special exception,
+the source code distributed need not include anything that is normally
+distributed (in either source or binary form) with the major
+components (compiler, kernel, and so on) of the operating system on
+which the executable runs, unless that component itself accompanies
+the executable.
+
+ It may happen that this requirement contradicts the license
+restrictions of other proprietary libraries that do not normally
+accompany the operating system. Such a contradiction means you cannot
+use both them and the Library together in an executable that you
+distribute.
+
+ 7. You may place library facilities that are a work based on the
+Library side-by-side in a single library together with other library
+facilities not covered by this License, and distribute such a combined
+library, provided that the separate distribution of the work based on
+the Library and of the other library facilities is otherwise
+permitted, and provided that you do these two things:
+
+ a) Accompany the combined library with a copy of the same work
+ based on the Library, uncombined with any other library
+ facilities. This must be distributed under the terms of the
+ Sections above.
+
+ b) Give prominent notice with the combined library of the fact
+ that part of it is a work based on the Library, and explaining
+ where to find the accompanying uncombined form of the same work.
+
+ 8. You may not copy, modify, sublicense, link with, or distribute
+the Library except as expressly provided under this License. Any
+attempt otherwise to copy, modify, sublicense, link with, or
+distribute the Library is void, and will automatically terminate your
+rights under this License. However, parties who have received copies,
+or rights, from you under this License will not have their licenses
+terminated so long as such parties remain in full compliance.
+
+ 9. You are not required to accept this License, since you have not
+signed it. However, nothing else grants you permission to modify or
+distribute the Library or its derivative works. These actions are
+prohibited by law if you do not accept this License. Therefore, by
+modifying or distributing the Library (or any work based on the
+Library), you indicate your acceptance of this License to do so, and
+all its terms and conditions for copying, distributing or modifying
+the Library or works based on it.
+
+ 10. Each time you redistribute the Library (or any work based on the
+Library), the recipient automatically receives a license from the
+original licensor to copy, distribute, link with or modify the Library
+subject to these terms and conditions. You may not impose any further
+restrictions on the recipients' exercise of the rights granted herein.
+You are not responsible for enforcing compliance by third parties to
+this License.
+
+ 11. If, as a consequence of a court judgment or allegation of patent
+infringement or for any other reason (not limited to patent issues),
+conditions are imposed on you (whether by court order, agreement or
+otherwise) that contradict the conditions of this License, they do not
+excuse you from the conditions of this License. If you cannot
+distribute so as to satisfy simultaneously your obligations under this
+License and any other pertinent obligations, then as a consequence you
+may not distribute the Library at all. For example, if a patent
+license would not permit royalty-free redistribution of the Library by
+all those who receive copies directly or indirectly through you, then
+the only way you could satisfy both it and this License would be to
+refrain entirely from distribution of the Library.
+
+If any portion of this section is held invalid or unenforceable under any
+particular circumstance, the balance of the section is intended to apply,
+and the section as a whole is intended to apply in other circumstances.
+
+It is not the purpose of this section to induce you to infringe any
+patents or other property right claims or to contest validity of any
+such claims; this section has the sole purpose of protecting the
+integrity of the free software distribution system which is
+implemented by public license practices. Many people have made
+generous contributions to the wide range of software distributed
+through that system in reliance on consistent application of that
+system; it is up to the author/donor to decide if he or she is willing
+to distribute software through any other system and a licensee cannot
+impose that choice.
+
+This section is intended to make thoroughly clear what is believed to
+be a consequence of the rest of this License.
+
+ 12. If the distribution and/or use of the Library is restricted in
+certain countries either by patents or by copyrighted interfaces, the
+original copyright holder who places the Library under this License may add
+an explicit geographical distribution limitation excluding those countries,
+so that distribution is permitted only in or among countries not thus
+excluded. In such case, this License incorporates the limitation as if
+written in the body of this License.
+
+ 13. The Free Software Foundation may publish revised and/or new
+versions of the Library General Public License from time to time.
+Such new versions will be similar in spirit to the present version,
+but may differ in detail to address new problems or concerns.
+
+Each version is given a distinguishing version number. If the Library
+specifies a version number of this License which applies to it and
+"any later version", you have the option of following the terms and
+conditions either of that version or of any later version published by
+the Free Software Foundation. If the Library does not specify a
+license version number, you may choose any version ever published by
+the Free Software Foundation.
+
+ 14. If you wish to incorporate parts of the Library into other free
+programs whose distribution conditions are incompatible with these,
+write to the author to ask for permission. For software which is
+copyrighted by the Free Software Foundation, write to the Free
+Software Foundation; we sometimes make exceptions for this. Our
+decision will be guided by the two goals of preserving the free status
+of all derivatives of our free software and of promoting the sharing
+and reuse of software generally.
+
+ NO WARRANTY
+
+ 15. BECAUSE THE LIBRARY IS LICENSED FREE OF CHARGE, THERE IS NO
+WARRANTY FOR THE LIBRARY, TO THE EXTENT PERMITTED BY APPLICABLE LAW.
+EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR
+OTHER PARTIES PROVIDE THE LIBRARY "AS IS" WITHOUT WARRANTY OF ANY
+KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE
+IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR
+PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE
+LIBRARY IS WITH YOU. SHOULD THE LIBRARY PROVE DEFECTIVE, YOU ASSUME
+THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION.
+
+ 16. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN
+WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY
+AND/OR REDISTRIBUTE THE LIBRARY AS PERMITTED ABOVE, BE LIABLE TO YOU
+FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR
+CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE
+LIBRARY (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING
+RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A
+FAILURE OF THE LIBRARY TO OPERATE WITH ANY OTHER SOFTWARE), EVEN IF
+SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH
+DAMAGES.
+
+ END OF TERMS AND CONDITIONS
+
+ Appendix: How to Apply These Terms to Your New Libraries
+
+ If you develop a new library, and you want it to be of the greatest
+possible use to the public, we recommend making it free software that
+everyone can redistribute and change. You can do so by permitting
+redistribution under these terms (or, alternatively, under the terms of the
+ordinary General Public License).
+
+ To apply these terms, attach the following notices to the library. It is
+safest to attach them to the start of each source file to most effectively
+convey the exclusion of warranty; and each file should have at least the
+"copyright" line and a pointer to where the full notice is found.
+
+ <one line to give the library's name and a brief idea of what it does.>
+ Copyright (C) <year> <name of author>
+
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Library General Public
+ License as published by the Free Software Foundation; either
+ version 2 of the License, or (at your option) any later version.
+
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+ Library General Public License for more details.
+
+ You should have received a copy of the GNU Library General Public
+ License along with this library; if not, write to the Free
+ Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA.
+
+Also add information on how to contact you by electronic and paper mail.
+
+You should also get your employer (if you work as a programmer) or your
+school, if any, to sign a "copyright disclaimer" for the library, if
+necessary. Here is a sample; alter the names:
+
+ Yoyodyne, Inc., hereby disclaims all copyright interest in the
+ library `Frob' (a library for tweaking knobs) written by James Random Hacker.
+
+ <signature of Ty Coon>, 1 April 1990
+ Ty Coon, President of Vice
+
+That's all there is to it!
diff -Naur mxml-2.6/Makefile.in mxml-2.6-haiku/Makefile.in
--- mxml-2.6/Makefile.in 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/Makefile.in 2008-12-06 04:20:38.000000000 +0000
@@ -0,0 +1,380 @@
+#
+# "$Id: Makefile.in 370 2008-12-06 04:20:38Z mike $"
+#
+# Makefile for Mini-XML, a small XML-like file parsing library.
+#
+# Copyright 2003-2008 by Michael Sweet.
+#
+# This program is free software; you can redistribute it and/or
+# modify it under the terms of the GNU Library General Public
+# License as published by the Free Software Foundation; either
+# version 2, or (at your option) any later version.
+#
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+# GNU General Public License for more details.
+#
+
+#
+# Compiler tools definitions...
+#
+
+AR = @AR@
+ARFLAGS = @ARFLAGS@
+ARCHFLAGS = @ARCHFLAGS@
+CC = @CC@
+CFLAGS = $(OPTIM) $(ARCHFLAGS) @CFLAGS@ @CPPFLAGS@ @PTHREAD_FLAGS@
+CP = @CP@
+DSO = @DSO@
+DSOFLAGS = @DSOFLAGS@
+LDFLAGS = $(OPTIM) $(ARCHFLAGS) @LDFLAGS@
+INSTALL = @INSTALL@
+LIBMXML = @LIBMXML@
+LIBS = @LIBS@ @PTHREAD_LIBS@
+LN = @LN@ -s
+MKDIR = @MKDIR@
+OPTIM = @OPTIM@
+RANLIB = @RANLIB@
+RM = @RM@ -f
+SHELL = /bin/sh
+
+
+#
+# Configured directories...
+#
+
+prefix = @prefix@
+exec_prefix = @exec_prefix@
+bindir = @bindir@
+datarootdir = @datarootdir@
+includedir = @includedir@
+libdir = @libdir@
+mandir = @mandir@
+docdir = @docdir@
+BUILDROOT = $(DSTROOT)
+
+
+#
+# Install commands...
+#
+
+INSTALL_BIN = $(LIBTOOL) $(INSTALL) -m 755 -s
+INSTALL_DATA = $(INSTALL) -m 644
+INSTALL_DIR = $(INSTALL) -d
+INSTALL_LIB = $(LIBTOOL) $(INSTALL) -m 755
+INSTALL_MAN = $(INSTALL) -m 644
+INSTALL_SCRIPT = $(INSTALL) -m 755
+
+
+#
+# Rules...
+#
+
+.SUFFIXES: .c .man .o
+.c.o:
+ $(CC) $(CFLAGS) -c $<
+
+
+#
+# Targets...
+#
+
+DOCFILES = doc/0.gif doc/1.gif doc/2.gif doc/3.gif doc/4.gif \
+ doc/A.gif doc/B.gif doc/C.gif doc/D.gif \
+ doc/mxml.html doc/mxmldoc.xsd \
+ README COPYING CHANGES
+PUBLIBOBJS = mxml-attr.o mxml-entity.o mxml-file.o mxml-index.o \
+ mxml-node.o mxml-search.o mxml-set.o
+LIBOBJS = $(PUBLIBOBJS) mxml-private.o mxml-string.o
+OBJS = mxmldoc.o testmxml.o $(LIBOBJS)
+TARGETS = $(LIBMXML) mxmldoc testmxml mxml.xml doc/mxml.man
+
+
+#
+# Make everything...
+#
+
+all: Makefile config.h $(TARGETS)
+
+
+#
+# Clean everything...
+#
+
+clean:
+ $(RM) $(OBJS) $(TARGETS)
+ $(RM) mxmldoc-static libmxml.a
+
+
+#
+# Really clean everything...
+#
+
+distclean: clean
+ $(RM) config.cache config.log config.status
+ $(RM) Makefile config.h
+ $(RM) -r autom4te*.cache
+ $(RM) *.bck *.bak
+ $(RM) -r clang
+
+
+#
+# Run the clang.llvm.org static code analysis tool on the C sources.
+#
+
+.PHONY: clang
+clang:
+ $(RM) -r clang
+ scan-build -k -V -o `pwd`/clang $(MAKE) $(MFLAGS) CC=ccc-analyzer clean all
+
+
+#
+# Install everything...
+#
+
+install: $(TARGETS) install-$(LIBMXML) install-libmxml.a
+ $(INSTALL_DIR) $(BUILDROOT)$(bindir)
+ $(INSTALL_BIN) mxmldoc $(BUILDROOT)$(bindir)
+ $(INSTALL_DIR) $(BUILDROOT)$(docdir)
+ for file in $(DOCFILES); do \
+ $(INSTALL_MAN) $$file $(BUILDROOT)$(docdir); \
+ done
+ $(INSTALL_DIR) $(BUILDROOT)$(includedir)
+ $(INSTALL_DATA) mxml.h $(BUILDROOT)$(includedir)
+ $(INSTALL_DIR) $(BUILDROOT)$(libdir)/pkgconfig
+ $(INSTALL_DATA) mxml.pc $(BUILDROOT)$(libdir)/pkgconfig
+ $(INSTALL_DIR) $(BUILDROOT)$(mandir)/man1
+ $(INSTALL_MAN) doc/mxmldoc.man $(BUILDROOT)$(mandir)/man1/mxmldoc.1
+ $(INSTALL_DIR) $(BUILDROOT)$(mandir)/man3
+ $(INSTALL_MAN) doc/mxml.man $(BUILDROOT)$(mandir)/man3/mxml.3
+
+install-libmxml.a:
+ $(INSTALL_DIR) $(BUILDROOT)$(libdir)
+ $(INSTALL_LIB) libmxml.a $(BUILDROOT)$(libdir)
+ $(RANLIB) $(BUILDROOT)$(libdir)/libmxml.a
+
+install-libmxml.so.1.4:
+ $(INSTALL_DIR) $(BUILDROOT)$(libdir)
+ $(INSTALL_LIB) libmxml.so.1.4 $(BUILDROOT)$(libdir)
+ $(RM) $(BUILDROOT)$(libdir)/libmxml.so
+ $(LN) libmxml.so.1.4 $(BUILDROOT)$(libdir)/libmxml.so
+ $(RM) $(BUILDROOT)$(libdir)/libmxml.so.1
+ $(LN) libmxml.so.1.4 $(BUILDROOT)$(libdir)/libmxml.so.1
+
+install-libmxml.sl.1:
+ $(INSTALL_DIR) $(BUILDROOT)$(libdir)
+ $(INSTALL_LIB) libmxml.sl.1 $(BUILDROOT)$(libdir)
+ $(RM) $(BUILDROOT)$(libdir)/libmxml.so
+ $(LN) libmxml.sl.1 $(BUILDROOT)$(libdir)/libmxml.sl
+
+install-libmxml.1.dylib:
+ $(INSTALL_DIR) $(BUILDROOT)$(libdir)
+ $(INSTALL_LIB) libmxml.1.dylib $(BUILDROOT)$(libdir)
+ $(RM) $(BUILDROOT)$(libdir)/libmxml.dylib
+ $(LN) libmxml.1.dylib $(BUILDROOT)$(libdir)/libmxml.dylib
+
+
+#
+# Uninstall everything...
+#
+
+uninstall: uninstall-$(LIBMXML) uninstall-libmxml.a
+ $(RM) $(BUILDROOT)$(bindir)/mxmldoc
+ $(RM) -r $(BUILDROOT)$(docdir)
+ $(RM) $(BUILDROOT)$(includedir)/mxml.h
+ $(RM) $(BUILDROOT)$(libdir)/pkgconfig/mxml.pc
+ $(RM) $(BUILDROOT)$(mandir)/man1/mxmldoc.1
+ $(RM) $(BUILDROOT)$(mandir)/man3/mxml.3
+
+uninstall-libmxml.a:
+ $(RM) $(BUILDROOT)$(libdir)/libmxml.a
+
+uninstall-libmxml.so.1.4:
+ $(RM) $(BUILDROOT)$(libdir)/libmxml.so
+ $(RM) $(BUILDROOT)$(libdir)/libmxml.so.1
+ $(RM) $(BUILDROOT)$(libdir)/libmxml.so.1.4
+
+uninstall-libmxml.sl.1:
+ $(RM) $(BUILDROOT)$(libdir)/libmxml.sl
+ $(RM) $(BUILDROOT)$(libdir)/libmxml.sl.1
+
+uninstall-libmxml.1.dylib:
+ $(RM) $(BUILDROOT)$(libdir)/libmxml.dylib
+ $(RM) $(BUILDROOT)$(libdir)/libmxml.1.dylib
+
+
+#
+# Make packages using EPM (http://www.easysw.com/epm/)
+#
+
+epm: all
+ epm --output-dir dist -v -f native mxml
+ epm --output-dir dist -v -f portable mxml
+
+
+#
+# autoconf stuff...
+#
+
+Makefile: configure Makefile.in
+ if test -f config.status; then \
+ ./config.status --recheck; \
+ ./config.status; \
+ else \
+ ./configure; \
+ fi
+ touch config.h
+
+
+config.h: configure config.h.in
+ autoconf
+ if test -f config.status; then \
+ ./config.status --recheck; \
+ ./config.status; \
+ else \
+ ./configure; \
+ fi
+ touch config.h
+
+
+#
+# libmxml.a
+#
+
+libmxml.a: $(LIBOBJS)
+ $(RM) $@
+ $(AR) $(ARFLAGS) $@ $(LIBOBJS)
+ $(RANLIB) $@
+
+$(LIBOBJS): mxml.h
+mxml-entity.o mxml-file.o mxml-private.o: mxml-private.h
+
+
+#
+# libmxml.so.1.4
+#
+
+libmxml.so.1.4: $(LIBOBJS)
+ $(DSO) $(DSOFLAGS) -o libmxml.so.1.4 $(LIBOBJS)
+ $(RM) libmxml.so libmxml.so.1
+ $(LN) libmxml.so.1.4 libmxml.so
+ $(LN) libmxml.so.1.4 libmxml.so.1
+
+
+#
+# libmxml.sl.1
+#
+
+libmxml.sl.1: $(LIBOBJS)
+ $(DSO) $(DSOFLAGS) -o libmxml.sl.1 $(LIBOBJS)
+ $(RM) libmxml.sl
+ $(LN) libmxml.sl.1 libmxml.sl
+
+
+#
+# libmxml.1.dylib
+#
+
+libmxml.1.dylib: $(LIBOBJS)
+ $(DSO) $(DSOFLAGS) -o libmxml.1.dylib \
+ -install_name $(libdir)/libmxml.dylib \
+ -current_version 1.4.0 \
+ -compatibility_version 1.0.0 \
+ $(LIBOBJS)
+ $(RM) libmxml.dylib
+ $(LN) libmxml.1.dylib libmxml.dylib
+
+
+#
+# mxmldoc
+#
+
+mxmldoc: $(LIBMXML) mxmldoc.o
+ $(CC) -L. $(LDFLAGS) -o $@ mxmldoc.o -lmxml $(LIBS)
+
+mxmldoc-static: libmxml.a mxmldoc.o
+ $(CC) $(LDFLAGS) -o $@ mxmldoc.o libmxml.a $(LIBS)
+
+mxmldoc.o: mxml.h
+
+
+#
+# testmxml
+#
+
+testmxml: libmxml.a testmxml.o
+ $(CC) $(LDFLAGS) -o $@ testmxml.o libmxml.a $(LIBS)
+ @echo Testing library...
+ ./testmxml test.xml >temp1.xml 2>temp1s.xml
+ ./testmxml temp1.xml >temp2.xml 2>temp2s.xml
+ @if cmp temp1.xml temp2.xml; then \
+ echo Stdio file test passed!; \
+ $(RM) temp2.xml temp2s.xml; \
+ else \
+ echo Stdio file test failed!; \
+ fi
+ @if cmp temp1.xml temp1s.xml; then \
+ echo String test passed!; \
+ $(RM) temp1.xml temp1s.xml; \
+ else \
+ echo String test failed!; \
+ fi
+ @if cmp test.xml test.xmlfd; then \
+ echo File descriptor test passed!; \
+ $(RM) test.xmlfd; \
+ else \
+ echo File descriptor test failed!; \
+ fi
+
+testmxml.o: mxml.h
+
+
+#
+# mxml.xml
+#
+
+mxml.xml: mxmldoc-static mxml.h $(PUBLIBOBJS:.o=.c)
+ $(RM) mxml.xml
+ ./mxmldoc-static --header doc/reference.heading mxml.xml mxml.h $(PUBLIBOBJS:.o=.c) >doc/reference.html
+ if test "x`uname`" = xDarwin; then \
+ ./mxmldoc-static --docset org.minixml.docset \
+ --docversion @VERSION@ --feedname minixml.org \
+ --feedurl http://www.minixml.org/org.minixml.atom \
+ --header doc/docset.header --intro doc/docset.intro \
+ --css doc/docset.css --title "Mini-XML API Reference" \
+ mxml.xml || exit 1; \
+ /Developer/usr/bin/docsetutil package --output org.minixml.xar \
+ --atom org.minixml.atom \
+ --download-url http://www.minixml.org/org.minixml.xar \
+ org.minixml.docset || exit 1; \
+ fi
+
+valgrind: mxmldoc-static
+ $(RM) valgrind.xml
+ valgrind --tool=memcheck --leak-check=yes ./mxmldoc-static \
+ valgrind.xml mxml.h $(PUBLIBOBJS:.o=.c) \
+ >valgrind.html 2>valgrind.out
+
+
+#
+# doc/mxml.man
+#
+
+doc/mxml.man: mxmldoc-static mxml.xml
+ $(RM) doc/mxml.man
+ ./mxmldoc-static --man mxml --title "Mini-XML API" \
+ --intro doc/intro.man --footer doc/footer.man \
+ mxml.xml >doc/mxml.man
+
+
+#
+# All object files depend on the makefile...
+#
+
+$(OBJS): Makefile config.h
+
+
+#
+# End of "$Id: Makefile.in 370 2008-12-06 04:20:38Z mike $".
+#
diff -Naur mxml-2.6/README mxml-2.6-haiku/README
--- mxml-2.6/README 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/README 2009-05-17 17:17:46.000000000 +0000
@@ -0,0 +1,177 @@
+README - 2009-05-17
+-------------------
+
+
+INTRODUCTION
+
+ This README file describes the Mini-XML library version 2.6.
+
+ Mini-XML is a small XML parsing library that you can use to read XML and
+ XML-like data files in your application without requiring large non-standard
+ libraries. Mini-XML only requires an ANSI C compatible compiler (GCC works,
+ as do most vendors' ANSI C compilers) and a "make" program.
+
+ Mini-XML provides the following functionality:
+
+ - Reading of UTF-8 and UTF-16 and writing of UTF-8 encoded XML files and
+ strings.
+ - Data is stored in a linked-list tree structure, preserving the XML
+ data hierarchy.
+ - Supports arbitrary element names, attributes, and attribute values
+ with no preset limits, just available memory.
+ - Supports integer, real, opaque ("cdata"), and text data types in
+ "leaf" nodes.
+ - Functions for creating and managing trees of data.
+ - "Find" and "walk" functions for easily locating and navigating trees
+ of data.
+
+ Mini-XML doesn't do validation or other types of processing on the data
+ based upon schema files or other sources of definition information.
+
+
+BUILDING Mini-XML
+
+ Mini-XML comes with an autoconf-based configure script; just type the
+ following command to get things going:
+
+ ./configure
+
+ The default install prefix is /usr/local, which can be overridden using the
+ --prefix option:
+
+ ./configure --prefix=/foo
+
+ Other configure options can be found using the --help option:
+
+ ./configure --help
+
+ Once you have configured the software, type "make" to do the build and run
+ the test program to verify that things are working, as follows:
+
+ make
+
+ If you are using Mini-XML under Microsoft Windows with Visual C++ 2008, use
+ the included project files in the "vcnet" subdirectory to build the library
+ instead.
+
+
+INSTALLING Mini-XML
+
+ The "install" target will install Mini-XML in the lib and include
+ directories:
+
+ make install
+
+ Once you have installed it, use the "-lmxml" option to link your application
+ against it.
+
+
+DOCUMENTATION
+
+ The documentation is available in the "doc" subdirectory in the files
+ "mxml.html" (HTML) and "mxml.pdf" (PDF). You can also look at the
+ "testmxml.c" and "mxmldoc.c" source files for examples of using Mini-XML.
+
+ Mini-XML provides a single header file which you include:
+
+ #include <mxml.h>
+
+ Nodes are defined by the "mxml_node_t" structure; the "type" member defines
+ the node type (element, integer, opaque, real, or text) which determines
+ which value you want to look at in the "value" union. New nodes can be
+ created using the "mxmlNewElement()", "mxmlNewInteger()", "mxmlNewOpaque()",
+ "mxmlNewReal()", and "mxmlNewText()" functions. Only elements can have
+ child nodes, and the top node must be an element, usually "?xml".
+
+ You load an XML file using the "mxmlLoadFile()" function:
+
+ FILE *fp;
+ mxml_node_t *tree;
+
+ fp = fopen("filename.xml", "r");
+ tree = mxmlLoadFile(NULL, fp, MXML_NO_CALLBACK);
+ fclose(fp);
+
+ Similarly, you save an XML file using the "mxmlSaveFile()" function:
+
+ FILE *fp;
+ mxml_node_t *tree;
+
+ fp = fopen("filename.xml", "w");
+ mxmlSaveFile(tree, fp, MXML_NO_CALLBACK);
+ fclose(fp);
+
+ The "mxmlLoadString()", "mxmlSaveAllocString()", and "mxmlSaveString()"
+ functions load XML node trees from and save XML node trees to strings:
+
+ char buffer[8192];
+ char *ptr;
+ mxml_node_t *tree;
+
+ ...
+ tree = mxmlLoadString(NULL, buffer, MXML_NO_CALLBACK);
+
+ ...
+ mxmlSaveString(tree, buffer, sizeof(buffer), MXML_NO_CALLBACK);
+
+ ...
+ ptr = mxmlSaveAllocString(tree, MXML_NO_CALLBACK);
+
+ You can find a named element/node using the "mxmlFindElement()" function:
+
+ mxml_node_t *node = mxmlFindElement(tree, tree, "name", "attr",
+ "value", MXML_DESCEND);
+
+ The "name", "attr", and "value" arguments can be passed as NULL to act as
+ wildcards, e.g.:
+
+ /* Find the first "a" element */
+ node = mxmlFindElement(tree, tree, "a", NULL, NULL, MXML_DESCEND);
+
+ /* Find the first "a" element with "href" attribute */
+ node = mxmlFindElement(tree, tree, "a", "href", NULL, MXML_DESCEND);
+
+ /* Find the first "a" element with "href" to a URL */
+ node = mxmlFindElement(tree, tree, "a", "href",
+ "http://www.easysw.com/~mike/mxml/",
+ MXML_DESCEND);
+
+ /* Find the first element with a "src" attribute*/
+ node = mxmlFindElement(tree, tree, NULL, "src", NULL, MXML_DESCEND);
+
+ /* Find the first element with a "src" = "foo.jpg" */
+ node = mxmlFindElement(tree, tree, NULL, "src", "foo.jpg",
+ MXML_DESCEND);
+
+ You can also iterate with the same function:
+
+ mxml_node_t *node;
+
+ for (node = mxmlFindElement(tree, tree, "name", NULL, NULL,
+ MXML_DESCEND);
+ node != NULL;
+ node = mxmlFindElement(node, tree, "name", NULL, NULL,
+ MXML_DESCEND))
+ {
+ ... do something ...
+ }
+
+ Finally, once you are done with the XML data, use the "mxmlDelete()"
+ function to recursively free the memory that is used for a particular node
+ or the entire tree:
+
+ mxmlDelete(tree);
+
+
+GETTING HELP AND REPORTING PROBLEMS
+
+ The Mini-XML web site provides access to a discussion forum and bug
+ reporting page:
+
+ http://www.minixml.org/
+
+
+LEGAL STUFF
+
+ The Mini-XML library is Copyright 2003-2009 by Michael Sweet. License terms
+ are described in the file "COPYING".
diff -Naur mxml-2.6/config.h.in mxml-2.6-haiku/config.h.in
--- mxml-2.6/config.h.in 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/config.h.in 2009-04-18 17:05:52.000000000 +0000
@@ -0,0 +1,97 @@
+/*
+ * "$Id: config.h.in 387 2009-04-18 17:05:52Z mike $"
+ *
+ * Configuration file for Mini-XML, a small XML-like file parsing library.
+ *
+ * Copyright 2003-2009 by Michael Sweet.
+ *
+ * This program is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU Library General Public
+ * License as published by the Free Software Foundation; either
+ * version 2, or (at your option) any later version.
+ *
+ * This program is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+ * GNU General Public License for more details.
+ */
+
+/*
+ * Include necessary headers...
+ */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <string.h>
+#include <stdarg.h>
+#include <ctype.h>
+
+
+/*
+ * Version number...
+ */
+
+#define MXML_VERSION ""
+
+
+/*
+ * Inline function support...
+ */
+
+#define inline
+
+
+/*
+ * Long long support...
+ */
+
+#undef HAVE_LONG_LONG
+
+
+/*
+ * Do we have the snprintf() and vsnprintf() functions?
+ */
+
+#undef HAVE_SNPRINTF
+#undef HAVE_VSNPRINTF
+
+
+/*
+ * Do we have the strXXX() functions?
+ */
+
+#undef HAVE_STRDUP
+
+
+/*
+ * Do we have threading support?
+ */
+
+#undef HAVE_PTHREAD_H
+
+
+/*
+ * Define prototypes for string functions as needed...
+ */
+
+# ifndef HAVE_STRDUP
+extern char *_mxml_strdup(const char *);
+# define strdup _mxml_strdup
+# endif /* !HAVE_STRDUP */
+
+extern char *_mxml_strdupf(const char *, ...);
+extern char *_mxml_vstrdupf(const char *, va_list);
+
+# ifndef HAVE_SNPRINTF
+extern int _mxml_snprintf(char *, size_t, const char *, ...);
+# define snprintf _mxml_snprintf
+# endif /* !HAVE_SNPRINTF */
+
+# ifndef HAVE_VSNPRINTF
+extern int _mxml_vsnprintf(char *, size_t, const char *, va_list);
+# define vsnprintf _mxml_vsnprintf
+# endif /* !HAVE_VSNPRINTF */
+
+/*
+ * End of "$Id: config.h.in 387 2009-04-18 17:05:52Z mike $".
+ */
diff -Naur mxml-2.6/configure mxml-2.6-haiku/configure
--- mxml-2.6/configure 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/configure 2009-04-18 17:05:52.000000000 +0000
@@ -0,0 +1,5974 @@
+#! /bin/sh
+# Guess values for system-dependent variables and create Makefiles.
+# Generated by GNU Autoconf 2.61.
+#
+# Copyright (C) 1992, 1993, 1994, 1995, 1996, 1998, 1999, 2000, 2001,
+# 2002, 2003, 2004, 2005, 2006 Free Software Foundation, Inc.
+# This configure script is free software; the Free Software Foundation
+# gives unlimited permission to copy, distribute and modify it.
+## --------------------- ##
+## M4sh Initialization. ##
+## --------------------- ##
+
+# Be more Bourne compatible
+DUALCASE=1; export DUALCASE # for MKS sh
+if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then
+ emulate sh
+ NULLCMD=:
+ # Zsh 3.x and 4.x performs word splitting on ${1+"$@"}, which
+ # is contrary to our usage. Disable this feature.
+ alias -g '${1+"$@"}'='"$@"'
+ setopt NO_GLOB_SUBST
+else
+ case `(set -o) 2>/dev/null` in
+ *posix*) set -o posix ;;
+esac
+
+fi
+
+
+
+
+# PATH needs CR
+# Avoid depending upon Character Ranges.
+as_cr_letters='abcdefghijklmnopqrstuvwxyz'
+as_cr_LETTERS='ABCDEFGHIJKLMNOPQRSTUVWXYZ'
+as_cr_Letters=$as_cr_letters$as_cr_LETTERS
+as_cr_digits='0123456789'
+as_cr_alnum=$as_cr_Letters$as_cr_digits
+
+# The user is always right.
+if test "${PATH_SEPARATOR+set}" != set; then
+ echo "#! /bin/sh" >conf$$.sh
+ echo "exit 0" >>conf$$.sh
+ chmod +x conf$$.sh
+ if (PATH="/nonexistent;."; conf$$.sh) >/dev/null 2>&1; then
+ PATH_SEPARATOR=';'
+ else
+ PATH_SEPARATOR=:
+ fi
+ rm -f conf$$.sh
+fi
+
+# Support unset when possible.
+if ( (MAIL=60; unset MAIL) || exit) >/dev/null 2>&1; then
+ as_unset=unset
+else
+ as_unset=false
+fi
+
+
+# IFS
+# We need space, tab and new line, in precisely that order. Quoting is
+# there to prevent editors from complaining about space-tab.
+# (If _AS_PATH_WALK were called with IFS unset, it would disable word
+# splitting by setting IFS to empty value.)
+as_nl='
+'
+IFS=" "" $as_nl"
+
+# Find who we are. Look in the path if we contain no directory separator.
+case $0 in
+ *[\\/]* ) as_myself=$0 ;;
+ *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break
+done
+IFS=$as_save_IFS
+
+ ;;
+esac
+# We did not find ourselves, most probably we were run as `sh COMMAND'
+# in which case we are not to be found in the path.
+if test "x$as_myself" = x; then
+ as_myself=$0
+fi
+if test ! -f "$as_myself"; then
+ echo "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2
+ { (exit 1); exit 1; }
+fi
+
+# Work around bugs in pre-3.0 UWIN ksh.
+for as_var in ENV MAIL MAILPATH
+do ($as_unset $as_var) >/dev/null 2>&1 && $as_unset $as_var
+done
+PS1='$ '
+PS2='> '
+PS4='+ '
+
+# NLS nuisances.
+for as_var in \
+ LANG LANGUAGE LC_ADDRESS LC_ALL LC_COLLATE LC_CTYPE LC_IDENTIFICATION \
+ LC_MEASUREMENT LC_MESSAGES LC_MONETARY LC_NAME LC_NUMERIC LC_PAPER \
+ LC_TELEPHONE LC_TIME
+do
+ if (set +x; test -z "`(eval $as_var=C; export $as_var) 2>&1`"); then
+ eval $as_var=C; export $as_var
+ else
+ ($as_unset $as_var) >/dev/null 2>&1 && $as_unset $as_var
+ fi
+done
+
+# Required to use basename.
+if expr a : '\(a\)' >/dev/null 2>&1 &&
+ test "X`expr 00001 : '.*\(...\)'`" = X001; then
+ as_expr=expr
+else
+ as_expr=false
+fi
+
+if (basename -- /) >/dev/null 2>&1 && test "X`basename -- / 2>&1`" = "X/"; then
+ as_basename=basename
+else
+ as_basename=false
+fi
+
+
+# Name of the executable.
+as_me=`$as_basename -- "$0" ||
+$as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \
+ X"$0" : 'X\(//\)$' \| \
+ X"$0" : 'X\(/\)' \| . 2>/dev/null ||
+echo X/"$0" |
+ sed '/^.*\/\([^/][^/]*\)\/*$/{
+ s//\1/
+ q
+ }
+ /^X\/\(\/\/\)$/{
+ s//\1/
+ q
+ }
+ /^X\/\(\/\).*/{
+ s//\1/
+ q
+ }
+ s/.*/./; q'`
+
+# CDPATH.
+$as_unset CDPATH
+
+
+if test "x$CONFIG_SHELL" = x; then
+ if (eval ":") 2>/dev/null; then
+ as_have_required=yes
+else
+ as_have_required=no
+fi
+
+ if test $as_have_required = yes && (eval ":
+(as_func_return () {
+ (exit \$1)
+}
+as_func_success () {
+ as_func_return 0
+}
+as_func_failure () {
+ as_func_return 1
+}
+as_func_ret_success () {
+ return 0
+}
+as_func_ret_failure () {
+ return 1
+}
+
+exitcode=0
+if as_func_success; then
+ :
+else
+ exitcode=1
+ echo as_func_success failed.
+fi
+
+if as_func_failure; then
+ exitcode=1
+ echo as_func_failure succeeded.
+fi
+
+if as_func_ret_success; then
+ :
+else
+ exitcode=1
+ echo as_func_ret_success failed.
+fi
+
+if as_func_ret_failure; then
+ exitcode=1
+ echo as_func_ret_failure succeeded.
+fi
+
+if ( set x; as_func_ret_success y && test x = \"\$1\" ); then
+ :
+else
+ exitcode=1
+ echo positional parameters were not saved.
+fi
+
+test \$exitcode = 0) || { (exit 1); exit 1; }
+
+(
+ as_lineno_1=\$LINENO
+ as_lineno_2=\$LINENO
+ test \"x\$as_lineno_1\" != \"x\$as_lineno_2\" &&
+ test \"x\`expr \$as_lineno_1 + 1\`\" = \"x\$as_lineno_2\") || { (exit 1); exit 1; }
+") 2> /dev/null; then
+ :
+else
+ as_candidate_shells=
+ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in /bin$PATH_SEPARATOR/usr/bin$PATH_SEPARATOR$PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ case $as_dir in
+ /*)
+ for as_base in sh bash ksh sh5; do
+ as_candidate_shells="$as_candidate_shells $as_dir/$as_base"
+ done;;
+ esac
+done
+IFS=$as_save_IFS
+
+
+ for as_shell in $as_candidate_shells $SHELL; do
+ # Try only shells that exist, to save several forks.
+ if { test -f "$as_shell" || test -f "$as_shell.exe"; } &&
+ { ("$as_shell") 2> /dev/null <<\_ASEOF
+if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then
+ emulate sh
+ NULLCMD=:
+ # Zsh 3.x and 4.x performs word splitting on ${1+"$@"}, which
+ # is contrary to our usage. Disable this feature.
+ alias -g '${1+"$@"}'='"$@"'
+ setopt NO_GLOB_SUBST
+else
+ case `(set -o) 2>/dev/null` in
+ *posix*) set -o posix ;;
+esac
+
+fi
+
+
+:
+_ASEOF
+}; then
+ CONFIG_SHELL=$as_shell
+ as_have_required=yes
+ if { "$as_shell" 2> /dev/null <<\_ASEOF
+if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then
+ emulate sh
+ NULLCMD=:
+ # Zsh 3.x and 4.x performs word splitting on ${1+"$@"}, which
+ # is contrary to our usage. Disable this feature.
+ alias -g '${1+"$@"}'='"$@"'
+ setopt NO_GLOB_SUBST
+else
+ case `(set -o) 2>/dev/null` in
+ *posix*) set -o posix ;;
+esac
+
+fi
+
+
+:
+(as_func_return () {
+ (exit $1)
+}
+as_func_success () {
+ as_func_return 0
+}
+as_func_failure () {
+ as_func_return 1
+}
+as_func_ret_success () {
+ return 0
+}
+as_func_ret_failure () {
+ return 1
+}
+
+exitcode=0
+if as_func_success; then
+ :
+else
+ exitcode=1
+ echo as_func_success failed.
+fi
+
+if as_func_failure; then
+ exitcode=1
+ echo as_func_failure succeeded.
+fi
+
+if as_func_ret_success; then
+ :
+else
+ exitcode=1
+ echo as_func_ret_success failed.
+fi
+
+if as_func_ret_failure; then
+ exitcode=1
+ echo as_func_ret_failure succeeded.
+fi
+
+if ( set x; as_func_ret_success y && test x = "$1" ); then
+ :
+else
+ exitcode=1
+ echo positional parameters were not saved.
+fi
+
+test $exitcode = 0) || { (exit 1); exit 1; }
+
+(
+ as_lineno_1=$LINENO
+ as_lineno_2=$LINENO
+ test "x$as_lineno_1" != "x$as_lineno_2" &&
+ test "x`expr $as_lineno_1 + 1`" = "x$as_lineno_2") || { (exit 1); exit 1; }
+
+_ASEOF
+}; then
+ break
+fi
+
+fi
+
+ done
+
+ if test "x$CONFIG_SHELL" != x; then
+ for as_var in BASH_ENV ENV
+ do ($as_unset $as_var) >/dev/null 2>&1 && $as_unset $as_var
+ done
+ export CONFIG_SHELL
+ exec "$CONFIG_SHELL" "$as_myself" ${1+"$@"}
+fi
+
+
+ if test $as_have_required = no; then
+ echo This script requires a shell more modern than all the
+ echo shells that I found on your system. Please install a
+ echo modern shell, or manually run the script under such a
+ echo shell if you do have one.
+ { (exit 1); exit 1; }
+fi
+
+
+fi
+
+fi
+
+
+
+(eval "as_func_return () {
+ (exit \$1)
+}
+as_func_success () {
+ as_func_return 0
+}
+as_func_failure () {
+ as_func_return 1
+}
+as_func_ret_success () {
+ return 0
+}
+as_func_ret_failure () {
+ return 1
+}
+
+exitcode=0
+if as_func_success; then
+ :
+else
+ exitcode=1
+ echo as_func_success failed.
+fi
+
+if as_func_failure; then
+ exitcode=1
+ echo as_func_failure succeeded.
+fi
+
+if as_func_ret_success; then
+ :
+else
+ exitcode=1
+ echo as_func_ret_success failed.
+fi
+
+if as_func_ret_failure; then
+ exitcode=1
+ echo as_func_ret_failure succeeded.
+fi
+
+if ( set x; as_func_ret_success y && test x = \"\$1\" ); then
+ :
+else
+ exitcode=1
+ echo positional parameters were not saved.
+fi
+
+test \$exitcode = 0") || {
+ echo No shell found that supports shell functions.
+ echo Please tell autoconf@gnu.org about your system,
+ echo including any error possibly output before this
+ echo message
+}
+
+
+
+ as_lineno_1=$LINENO
+ as_lineno_2=$LINENO
+ test "x$as_lineno_1" != "x$as_lineno_2" &&
+ test "x`expr $as_lineno_1 + 1`" = "x$as_lineno_2" || {
+
+ # Create $as_me.lineno as a copy of $as_myself, but with $LINENO
+ # uniformly replaced by the line number. The first 'sed' inserts a
+ # line-number line after each line using $LINENO; the second 'sed'
+ # does the real work. The second script uses 'N' to pair each
+ # line-number line with the line containing $LINENO, and appends
+ # trailing '-' during substitution so that $LINENO is not a special
+ # case at line end.
+ # (Raja R Harinath suggested sed '=', and Paul Eggert wrote the
+ # scripts with optimization help from Paolo Bonzini. Blame Lee
+ # E. McMahon (1931-1989) for sed's syntax. :-)
+ sed -n '
+ p
+ /[$]LINENO/=
+ ' <$as_myself |
+ sed '
+ s/[$]LINENO.*/&-/
+ t lineno
+ b
+ :lineno
+ N
+ :loop
+ s/[$]LINENO\([^'$as_cr_alnum'_].*\n\)\(.*\)/\2\1\2/
+ t loop
+ s/-\n.*//
+ ' >$as_me.lineno &&
+ chmod +x "$as_me.lineno" ||
+ { echo "$as_me: error: cannot create $as_me.lineno; rerun with a POSIX shell" >&2
+ { (exit 1); exit 1; }; }
+
+ # Don't try to exec as it changes $[0], causing all sort of problems
+ # (the dirname of $[0] is not the place where we might find the
+ # original and so on. Autoconf is especially sensitive to this).
+ . "./$as_me.lineno"
+ # Exit status is that of the last command.
+ exit
+}
+
+
+if (as_dir=`dirname -- /` && test "X$as_dir" = X/) >/dev/null 2>&1; then
+ as_dirname=dirname
+else
+ as_dirname=false
+fi
+
+ECHO_C= ECHO_N= ECHO_T=
+case `echo -n x` in
+-n*)
+ case `echo 'x\c'` in
+ *c*) ECHO_T=' ';; # ECHO_T is single tab character.
+ *) ECHO_C='\c';;
+ esac;;
+*)
+ ECHO_N='-n';;
+esac
+
+if expr a : '\(a\)' >/dev/null 2>&1 &&
+ test "X`expr 00001 : '.*\(...\)'`" = X001; then
+ as_expr=expr
+else
+ as_expr=false
+fi
+
+rm -f conf$$ conf$$.exe conf$$.file
+if test -d conf$$.dir; then
+ rm -f conf$$.dir/conf$$.file
+else
+ rm -f conf$$.dir
+ mkdir conf$$.dir
+fi
+echo >conf$$.file
+if ln -s conf$$.file conf$$ 2>/dev/null; then
+ as_ln_s='ln -s'
+ # ... but there are two gotchas:
+ # 1) On MSYS, both `ln -s file dir' and `ln file dir' fail.
+ # 2) DJGPP < 2.04 has no symlinks; `ln -s' creates a wrapper executable.
+ # In both cases, we have to default to `cp -p'.
+ ln -s conf$$.file conf$$.dir 2>/dev/null && test ! -f conf$$.exe ||
+ as_ln_s='cp -p'
+elif ln conf$$.file conf$$ 2>/dev/null; then
+ as_ln_s=ln
+else
+ as_ln_s='cp -p'
+fi
+rm -f conf$$ conf$$.exe conf$$.dir/conf$$.file conf$$.file
+rmdir conf$$.dir 2>/dev/null
+
+if mkdir -p . 2>/dev/null; then
+ as_mkdir_p=:
+else
+ test -d ./-p && rmdir ./-p
+ as_mkdir_p=false
+fi
+
+if test -x / >/dev/null 2>&1; then
+ as_test_x='test -x'
+else
+ if ls -dL / >/dev/null 2>&1; then
+ as_ls_L_option=L
+ else
+ as_ls_L_option=
+ fi
+ as_test_x='
+ eval sh -c '\''
+ if test -d "$1"; then
+ test -d "$1/.";
+ else
+ case $1 in
+ -*)set "./$1";;
+ esac;
+ case `ls -ld'$as_ls_L_option' "$1" 2>/dev/null` in
+ ???[sx]*):;;*)false;;esac;fi
+ '\'' sh
+ '
+fi
+as_executable_p=$as_test_x
+
+# Sed expression to map a string onto a valid CPP name.
+as_tr_cpp="eval sed 'y%*$as_cr_letters%P$as_cr_LETTERS%;s%[^_$as_cr_alnum]%_%g'"
+
+# Sed expression to map a string onto a valid variable name.
+as_tr_sh="eval sed 'y%*+%pp%;s%[^_$as_cr_alnum]%_%g'"
+
+
+
+exec 7<&0 </dev/null 6>&1
+
+# Name of the host.
+# hostname on some systems (SVR3.2, Linux) returns a bogus exit status,
+# so uname gets run too.
+ac_hostname=`(hostname || uname -n) 2>/dev/null | sed 1q`
+
+#
+# Initializations.
+#
+ac_default_prefix=/usr/local
+ac_clean_files=
+ac_config_libobj_dir=.
+LIBOBJS=
+cross_compiling=no
+subdirs=
+MFLAGS=
+MAKEFLAGS=
+SHELL=${CONFIG_SHELL-/bin/sh}
+
+# Identity of this package.
+PACKAGE_NAME=
+PACKAGE_TARNAME=
+PACKAGE_VERSION=
+PACKAGE_STRING=
+PACKAGE_BUGREPORT=
+
+ac_unique_file="mxml.h"
+# Factoring default headers for most tests.
+ac_includes_default="\
+#include <stdio.h>
+#ifdef HAVE_SYS_TYPES_H
+# include <sys/types.h>
+#endif
+#ifdef HAVE_SYS_STAT_H
+# include <sys/stat.h>
+#endif
+#ifdef STDC_HEADERS
+# include <stdlib.h>
+# include <stddef.h>
+#else
+# ifdef HAVE_STDLIB_H
+# include <stdlib.h>
+# endif
+#endif
+#ifdef HAVE_STRING_H
+# if !defined STDC_HEADERS && defined HAVE_MEMORY_H
+# include <memory.h>
+# endif
+# include <string.h>
+#endif
+#ifdef HAVE_STRINGS_H
+# include <strings.h>
+#endif
+#ifdef HAVE_INTTYPES_H
+# include <inttypes.h>
+#endif
+#ifdef HAVE_STDINT_H
+# include <stdint.h>
+#endif
+#ifdef HAVE_UNISTD_H
+# include <unistd.h>
+#endif"
+
+ac_subst_vars='SHELL
+PATH_SEPARATOR
+PACKAGE_NAME
+PACKAGE_TARNAME
+PACKAGE_VERSION
+PACKAGE_STRING
+PACKAGE_BUGREPORT
+exec_prefix
+prefix
+program_transform_name
+bindir
+sbindir
+libexecdir
+datarootdir
+datadir
+sysconfdir
+sharedstatedir
+localstatedir
+includedir
+oldincludedir
+docdir
+infodir
+htmldir
+dvidir
+pdfdir
+psdir
+libdir
+localedir
+mandir
+DEFS
+ECHO_C
+ECHO_N
+ECHO_T
+LIBS
+build_alias
+host_alias
+target_alias
+VERSION
+LDFLAGS
+OPTIM
+ARCHFLAGS
+CC
+CFLAGS
+CPPFLAGS
+ac_ct_CC
+EXEEXT
+OBJEXT
+CXX
+CXXFLAGS
+ac_ct_CXX
+INSTALL_PROGRAM
+INSTALL_SCRIPT
+INSTALL_DATA
+RANLIB
+AR
+CP
+LN
+MKDIR
+RM
+ARFLAGS
+CPP
+GREP
+EGREP
+PTHREAD_FLAGS
+PTHREAD_LIBS
+DSO
+DSOFLAGS
+LIBMXML
+PICFLAG
+PC_CFLAGS
+PC_LIBS
+LIBOBJS
+LTLIBOBJS'
+ac_subst_files=''
+ ac_precious_vars='build_alias
+host_alias
+target_alias
+CC
+CFLAGS
+LDFLAGS
+LIBS
+CPPFLAGS
+CXX
+CXXFLAGS
+CCC
+CPP'
+
+
+# Initialize some variables set by options.
+ac_init_help=
+ac_init_version=false
+# The variables have the same names as the options, with
+# dashes changed to underlines.
+cache_file=/dev/null
+exec_prefix=NONE
+no_create=
+no_recursion=
+prefix=NONE
+program_prefix=NONE
+program_suffix=NONE
+program_transform_name=s,x,x,
+silent=
+site=
+srcdir=
+verbose=
+x_includes=NONE
+x_libraries=NONE
+
+# Installation directory options.
+# These are left unexpanded so users can "make install exec_prefix=/foo"
+# and all the variables that are supposed to be based on exec_prefix
+# by default will actually change.
+# Use braces instead of parens because sh, perl, etc. also accept them.
+# (The list follows the same order as the GNU Coding Standards.)
+bindir='${exec_prefix}/bin'
+sbindir='${exec_prefix}/sbin'
+libexecdir='${exec_prefix}/libexec'
+datarootdir='${prefix}/share'
+datadir='${datarootdir}'
+sysconfdir='${prefix}/etc'
+sharedstatedir='${prefix}/com'
+localstatedir='${prefix}/var'
+includedir='${prefix}/include'
+oldincludedir='/usr/include'
+docdir='${datarootdir}/doc/${PACKAGE}'
+infodir='${datarootdir}/info'
+htmldir='${docdir}'
+dvidir='${docdir}'
+pdfdir='${docdir}'
+psdir='${docdir}'
+libdir='${exec_prefix}/lib'
+localedir='${datarootdir}/locale'
+mandir='${datarootdir}/man'
+
+ac_prev=
+ac_dashdash=
+for ac_option
+do
+ # If the previous option needs an argument, assign it.
+ if test -n "$ac_prev"; then
+ eval $ac_prev=\$ac_option
+ ac_prev=
+ continue
+ fi
+
+ case $ac_option in
+ *=*) ac_optarg=`expr "X$ac_option" : '[^=]*=\(.*\)'` ;;
+ *) ac_optarg=yes ;;
+ esac
+
+ # Accept the important Cygnus configure options, so we can diagnose typos.
+
+ case $ac_dashdash$ac_option in
+ --)
+ ac_dashdash=yes ;;
+
+ -bindir | --bindir | --bindi | --bind | --bin | --bi)
+ ac_prev=bindir ;;
+ -bindir=* | --bindir=* | --bindi=* | --bind=* | --bin=* | --bi=*)
+ bindir=$ac_optarg ;;
+
+ -build | --build | --buil | --bui | --bu)
+ ac_prev=build_alias ;;
+ -build=* | --build=* | --buil=* | --bui=* | --bu=*)
+ build_alias=$ac_optarg ;;
+
+ -cache-file | --cache-file | --cache-fil | --cache-fi \
+ | --cache-f | --cache- | --cache | --cach | --cac | --ca | --c)
+ ac_prev=cache_file ;;
+ -cache-file=* | --cache-file=* | --cache-fil=* | --cache-fi=* \
+ | --cache-f=* | --cache-=* | --cache=* | --cach=* | --cac=* | --ca=* | --c=*)
+ cache_file=$ac_optarg ;;
+
+ --config-cache | -C)
+ cache_file=config.cache ;;
+
+ -datadir | --datadir | --datadi | --datad)
+ ac_prev=datadir ;;
+ -datadir=* | --datadir=* | --datadi=* | --datad=*)
+ datadir=$ac_optarg ;;
+
+ -datarootdir | --datarootdir | --datarootdi | --datarootd | --dataroot \
+ | --dataroo | --dataro | --datar)
+ ac_prev=datarootdir ;;
+ -datarootdir=* | --datarootdir=* | --datarootdi=* | --datarootd=* \
+ | --dataroot=* | --dataroo=* | --dataro=* | --datar=*)
+ datarootdir=$ac_optarg ;;
+
+ -disable-* | --disable-*)
+ ac_feature=`expr "x$ac_option" : 'x-*disable-\(.*\)'`
+ # Reject names that are not valid shell variable names.
+ expr "x$ac_feature" : ".*[^-._$as_cr_alnum]" >/dev/null &&
+ { echo "$as_me: error: invalid feature name: $ac_feature" >&2
+ { (exit 1); exit 1; }; }
+ ac_feature=`echo $ac_feature | sed 's/[-.]/_/g'`
+ eval enable_$ac_feature=no ;;
+
+ -docdir | --docdir | --docdi | --doc | --do)
+ ac_prev=docdir ;;
+ -docdir=* | --docdir=* | --docdi=* | --doc=* | --do=*)
+ docdir=$ac_optarg ;;
+
+ -dvidir | --dvidir | --dvidi | --dvid | --dvi | --dv)
+ ac_prev=dvidir ;;
+ -dvidir=* | --dvidir=* | --dvidi=* | --dvid=* | --dvi=* | --dv=*)
+ dvidir=$ac_optarg ;;
+
+ -enable-* | --enable-*)
+ ac_feature=`expr "x$ac_option" : 'x-*enable-\([^=]*\)'`
+ # Reject names that are not valid shell variable names.
+ expr "x$ac_feature" : ".*[^-._$as_cr_alnum]" >/dev/null &&
+ { echo "$as_me: error: invalid feature name: $ac_feature" >&2
+ { (exit 1); exit 1; }; }
+ ac_feature=`echo $ac_feature | sed 's/[-.]/_/g'`
+ eval enable_$ac_feature=\$ac_optarg ;;
+
+ -exec-prefix | --exec_prefix | --exec-prefix | --exec-prefi \
+ | --exec-pref | --exec-pre | --exec-pr | --exec-p | --exec- \
+ | --exec | --exe | --ex)
+ ac_prev=exec_prefix ;;
+ -exec-prefix=* | --exec_prefix=* | --exec-prefix=* | --exec-prefi=* \
+ | --exec-pref=* | --exec-pre=* | --exec-pr=* | --exec-p=* | --exec-=* \
+ | --exec=* | --exe=* | --ex=*)
+ exec_prefix=$ac_optarg ;;
+
+ -gas | --gas | --ga | --g)
+ # Obsolete; use --with-gas.
+ with_gas=yes ;;
+
+ -help | --help | --hel | --he | -h)
+ ac_init_help=long ;;
+ -help=r* | --help=r* | --hel=r* | --he=r* | -hr*)
+ ac_init_help=recursive ;;
+ -help=s* | --help=s* | --hel=s* | --he=s* | -hs*)
+ ac_init_help=short ;;
+
+ -host | --host | --hos | --ho)
+ ac_prev=host_alias ;;
+ -host=* | --host=* | --hos=* | --ho=*)
+ host_alias=$ac_optarg ;;
+
+ -htmldir | --htmldir | --htmldi | --htmld | --html | --htm | --ht)
+ ac_prev=htmldir ;;
+ -htmldir=* | --htmldir=* | --htmldi=* | --htmld=* | --html=* | --htm=* \
+ | --ht=*)
+ htmldir=$ac_optarg ;;
+
+ -includedir | --includedir | --includedi | --included | --include \
+ | --includ | --inclu | --incl | --inc)
+ ac_prev=includedir ;;
+ -includedir=* | --includedir=* | --includedi=* | --included=* | --include=* \
+ | --includ=* | --inclu=* | --incl=* | --inc=*)
+ includedir=$ac_optarg ;;
+
+ -infodir | --infodir | --infodi | --infod | --info | --inf)
+ ac_prev=infodir ;;
+ -infodir=* | --infodir=* | --infodi=* | --infod=* | --info=* | --inf=*)
+ infodir=$ac_optarg ;;
+
+ -libdir | --libdir | --libdi | --libd)
+ ac_prev=libdir ;;
+ -libdir=* | --libdir=* | --libdi=* | --libd=*)
+ libdir=$ac_optarg ;;
+
+ -libexecdir | --libexecdir | --libexecdi | --libexecd | --libexec \
+ | --libexe | --libex | --libe)
+ ac_prev=libexecdir ;;
+ -libexecdir=* | --libexecdir=* | --libexecdi=* | --libexecd=* | --libexec=* \
+ | --libexe=* | --libex=* | --libe=*)
+ libexecdir=$ac_optarg ;;
+
+ -localedir | --localedir | --localedi | --localed | --locale)
+ ac_prev=localedir ;;
+ -localedir=* | --localedir=* | --localedi=* | --localed=* | --locale=*)
+ localedir=$ac_optarg ;;
+
+ -localstatedir | --localstatedir | --localstatedi | --localstated \
+ | --localstate | --localstat | --localsta | --localst | --locals)
+ ac_prev=localstatedir ;;
+ -localstatedir=* | --localstatedir=* | --localstatedi=* | --localstated=* \
+ | --localstate=* | --localstat=* | --localsta=* | --localst=* | --locals=*)
+ localstatedir=$ac_optarg ;;
+
+ -mandir | --mandir | --mandi | --mand | --man | --ma | --m)
+ ac_prev=mandir ;;
+ -mandir=* | --mandir=* | --mandi=* | --mand=* | --man=* | --ma=* | --m=*)
+ mandir=$ac_optarg ;;
+
+ -nfp | --nfp | --nf)
+ # Obsolete; use --without-fp.
+ with_fp=no ;;
+
+ -no-create | --no-create | --no-creat | --no-crea | --no-cre \
+ | --no-cr | --no-c | -n)
+ no_create=yes ;;
+
+ -no-recursion | --no-recursion | --no-recursio | --no-recursi \
+ | --no-recurs | --no-recur | --no-recu | --no-rec | --no-re | --no-r)
+ no_recursion=yes ;;
+
+ -oldincludedir | --oldincludedir | --oldincludedi | --oldincluded \
+ | --oldinclude | --oldinclud | --oldinclu | --oldincl | --oldinc \
+ | --oldin | --oldi | --old | --ol | --o)
+ ac_prev=oldincludedir ;;
+ -oldincludedir=* | --oldincludedir=* | --oldincludedi=* | --oldincluded=* \
+ | --oldinclude=* | --oldinclud=* | --oldinclu=* | --oldincl=* | --oldinc=* \
+ | --oldin=* | --oldi=* | --old=* | --ol=* | --o=*)
+ oldincludedir=$ac_optarg ;;
+
+ -prefix | --prefix | --prefi | --pref | --pre | --pr | --p)
+ ac_prev=prefix ;;
+ -prefix=* | --prefix=* | --prefi=* | --pref=* | --pre=* | --pr=* | --p=*)
+ prefix=$ac_optarg ;;
+
+ -program-prefix | --program-prefix | --program-prefi | --program-pref \
+ | --program-pre | --program-pr | --program-p)
+ ac_prev=program_prefix ;;
+ -program-prefix=* | --program-prefix=* | --program-prefi=* \
+ | --program-pref=* | --program-pre=* | --program-pr=* | --program-p=*)
+ program_prefix=$ac_optarg ;;
+
+ -program-suffix | --program-suffix | --program-suffi | --program-suff \
+ | --program-suf | --program-su | --program-s)
+ ac_prev=program_suffix ;;
+ -program-suffix=* | --program-suffix=* | --program-suffi=* \
+ | --program-suff=* | --program-suf=* | --program-su=* | --program-s=*)
+ program_suffix=$ac_optarg ;;
+
+ -program-transform-name | --program-transform-name \
+ | --program-transform-nam | --program-transform-na \
+ | --program-transform-n | --program-transform- \
+ | --program-transform | --program-transfor \
+ | --program-transfo | --program-transf \
+ | --program-trans | --program-tran \
+ | --progr-tra | --program-tr | --program-t)
+ ac_prev=program_transform_name ;;
+ -program-transform-name=* | --program-transform-name=* \
+ | --program-transform-nam=* | --program-transform-na=* \
+ | --program-transform-n=* | --program-transform-=* \
+ | --program-transform=* | --program-transfor=* \
+ | --program-transfo=* | --program-transf=* \
+ | --program-trans=* | --program-tran=* \
+ | --progr-tra=* | --program-tr=* | --program-t=*)
+ program_transform_name=$ac_optarg ;;
+
+ -pdfdir | --pdfdir | --pdfdi | --pdfd | --pdf | --pd)
+ ac_prev=pdfdir ;;
+ -pdfdir=* | --pdfdir=* | --pdfdi=* | --pdfd=* | --pdf=* | --pd=*)
+ pdfdir=$ac_optarg ;;
+
+ -psdir | --psdir | --psdi | --psd | --ps)
+ ac_prev=psdir ;;
+ -psdir=* | --psdir=* | --psdi=* | --psd=* | --ps=*)
+ psdir=$ac_optarg ;;
+
+ -q | -quiet | --quiet | --quie | --qui | --qu | --q \
+ | -silent | --silent | --silen | --sile | --sil)
+ silent=yes ;;
+
+ -sbindir | --sbindir | --sbindi | --sbind | --sbin | --sbi | --sb)
+ ac_prev=sbindir ;;
+ -sbindir=* | --sbindir=* | --sbindi=* | --sbind=* | --sbin=* \
+ | --sbi=* | --sb=*)
+ sbindir=$ac_optarg ;;
+
+ -sharedstatedir | --sharedstatedir | --sharedstatedi \
+ | --sharedstated | --sharedstate | --sharedstat | --sharedsta \
+ | --sharedst | --shareds | --shared | --share | --shar \
+ | --sha | --sh)
+ ac_prev=sharedstatedir ;;
+ -sharedstatedir=* | --sharedstatedir=* | --sharedstatedi=* \
+ | --sharedstated=* | --sharedstate=* | --sharedstat=* | --sharedsta=* \
+ | --sharedst=* | --shareds=* | --shared=* | --share=* | --shar=* \
+ | --sha=* | --sh=*)
+ sharedstatedir=$ac_optarg ;;
+
+ -site | --site | --sit)
+ ac_prev=site ;;
+ -site=* | --site=* | --sit=*)
+ site=$ac_optarg ;;
+
+ -srcdir | --srcdir | --srcdi | --srcd | --src | --sr)
+ ac_prev=srcdir ;;
+ -srcdir=* | --srcdir=* | --srcdi=* | --srcd=* | --src=* | --sr=*)
+ srcdir=$ac_optarg ;;
+
+ -sysconfdir | --sysconfdir | --sysconfdi | --sysconfd | --sysconf \
+ | --syscon | --sysco | --sysc | --sys | --sy)
+ ac_prev=sysconfdir ;;
+ -sysconfdir=* | --sysconfdir=* | --sysconfdi=* | --sysconfd=* | --sysconf=* \
+ | --syscon=* | --sysco=* | --sysc=* | --sys=* | --sy=*)
+ sysconfdir=$ac_optarg ;;
+
+ -target | --target | --targe | --targ | --tar | --ta | --t)
+ ac_prev=target_alias ;;
+ -target=* | --target=* | --targe=* | --targ=* | --tar=* | --ta=* | --t=*)
+ target_alias=$ac_optarg ;;
+
+ -v | -verbose | --verbose | --verbos | --verbo | --verb)
+ verbose=yes ;;
+
+ -version | --version | --versio | --versi | --vers | -V)
+ ac_init_version=: ;;
+
+ -with-* | --with-*)
+ ac_package=`expr "x$ac_option" : 'x-*with-\([^=]*\)'`
+ # Reject names that are not valid shell variable names.
+ expr "x$ac_package" : ".*[^-._$as_cr_alnum]" >/dev/null &&
+ { echo "$as_me: error: invalid package name: $ac_package" >&2
+ { (exit 1); exit 1; }; }
+ ac_package=`echo $ac_package | sed 's/[-.]/_/g'`
+ eval with_$ac_package=\$ac_optarg ;;
+
+ -without-* | --without-*)
+ ac_package=`expr "x$ac_option" : 'x-*without-\(.*\)'`
+ # Reject names that are not valid shell variable names.
+ expr "x$ac_package" : ".*[^-._$as_cr_alnum]" >/dev/null &&
+ { echo "$as_me: error: invalid package name: $ac_package" >&2
+ { (exit 1); exit 1; }; }
+ ac_package=`echo $ac_package | sed 's/[-.]/_/g'`
+ eval with_$ac_package=no ;;
+
+ --x)
+ # Obsolete; use --with-x.
+ with_x=yes ;;
+
+ -x-includes | --x-includes | --x-include | --x-includ | --x-inclu \
+ | --x-incl | --x-inc | --x-in | --x-i)
+ ac_prev=x_includes ;;
+ -x-includes=* | --x-includes=* | --x-include=* | --x-includ=* | --x-inclu=* \
+ | --x-incl=* | --x-inc=* | --x-in=* | --x-i=*)
+ x_includes=$ac_optarg ;;
+
+ -x-libraries | --x-libraries | --x-librarie | --x-librari \
+ | --x-librar | --x-libra | --x-libr | --x-lib | --x-li | --x-l)
+ ac_prev=x_libraries ;;
+ -x-libraries=* | --x-libraries=* | --x-librarie=* | --x-librari=* \
+ | --x-librar=* | --x-libra=* | --x-libr=* | --x-lib=* | --x-li=* | --x-l=*)
+ x_libraries=$ac_optarg ;;
+
+ -*) { echo "$as_me: error: unrecognized option: $ac_option
+Try \`$0 --help' for more information." >&2
+ { (exit 1); exit 1; }; }
+ ;;
+
+ *=*)
+ ac_envvar=`expr "x$ac_option" : 'x\([^=]*\)='`
+ # Reject names that are not valid shell variable names.
+ expr "x$ac_envvar" : ".*[^_$as_cr_alnum]" >/dev/null &&
+ { echo "$as_me: error: invalid variable name: $ac_envvar" >&2
+ { (exit 1); exit 1; }; }
+ eval $ac_envvar=\$ac_optarg
+ export $ac_envvar ;;
+
+ *)
+ # FIXME: should be removed in autoconf 3.0.
+ echo "$as_me: WARNING: you should use --build, --host, --target" >&2
+ expr "x$ac_option" : ".*[^-._$as_cr_alnum]" >/dev/null &&
+ echo "$as_me: WARNING: invalid host type: $ac_option" >&2
+ : ${build_alias=$ac_option} ${host_alias=$ac_option} ${target_alias=$ac_option}
+ ;;
+
+ esac
+done
+
+if test -n "$ac_prev"; then
+ ac_option=--`echo $ac_prev | sed 's/_/-/g'`
+ { echo "$as_me: error: missing argument to $ac_option" >&2
+ { (exit 1); exit 1; }; }
+fi
+
+# Be sure to have absolute directory names.
+for ac_var in exec_prefix prefix bindir sbindir libexecdir datarootdir \
+ datadir sysconfdir sharedstatedir localstatedir includedir \
+ oldincludedir docdir infodir htmldir dvidir pdfdir psdir \
+ libdir localedir mandir
+do
+ eval ac_val=\$$ac_var
+ case $ac_val in
+ [\\/$]* | ?:[\\/]* ) continue;;
+ NONE | '' ) case $ac_var in *prefix ) continue;; esac;;
+ esac
+ { echo "$as_me: error: expected an absolute directory name for --$ac_var: $ac_val" >&2
+ { (exit 1); exit 1; }; }
+done
+
+# There might be people who depend on the old broken behavior: `$host'
+# used to hold the argument of --host etc.
+# FIXME: To remove some day.
+build=$build_alias
+host=$host_alias
+target=$target_alias
+
+# FIXME: To remove some day.
+if test "x$host_alias" != x; then
+ if test "x$build_alias" = x; then
+ cross_compiling=maybe
+ echo "$as_me: WARNING: If you wanted to set the --build type, don't use --host.
+ If a cross compiler is detected then cross compile mode will be used." >&2
+ elif test "x$build_alias" != "x$host_alias"; then
+ cross_compiling=yes
+ fi
+fi
+
+ac_tool_prefix=
+test -n "$host_alias" && ac_tool_prefix=$host_alias-
+
+test "$silent" = yes && exec 6>/dev/null
+
+
+ac_pwd=`pwd` && test -n "$ac_pwd" &&
+ac_ls_di=`ls -di .` &&
+ac_pwd_ls_di=`cd "$ac_pwd" && ls -di .` ||
+ { echo "$as_me: error: Working directory cannot be determined" >&2
+ { (exit 1); exit 1; }; }
+test "X$ac_ls_di" = "X$ac_pwd_ls_di" ||
+ { echo "$as_me: error: pwd does not report name of working directory" >&2
+ { (exit 1); exit 1; }; }
+
+
+# Find the source files, if location was not specified.
+if test -z "$srcdir"; then
+ ac_srcdir_defaulted=yes
+ # Try the directory containing this script, then the parent directory.
+ ac_confdir=`$as_dirname -- "$0" ||
+$as_expr X"$0" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
+ X"$0" : 'X\(//\)[^/]' \| \
+ X"$0" : 'X\(//\)$' \| \
+ X"$0" : 'X\(/\)' \| . 2>/dev/null ||
+echo X"$0" |
+ sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{
+ s//\1/
+ q
+ }
+ /^X\(\/\/\)[^/].*/{
+ s//\1/
+ q
+ }
+ /^X\(\/\/\)$/{
+ s//\1/
+ q
+ }
+ /^X\(\/\).*/{
+ s//\1/
+ q
+ }
+ s/.*/./; q'`
+ srcdir=$ac_confdir
+ if test ! -r "$srcdir/$ac_unique_file"; then
+ srcdir=..
+ fi
+else
+ ac_srcdir_defaulted=no
+fi
+if test ! -r "$srcdir/$ac_unique_file"; then
+ test "$ac_srcdir_defaulted" = yes && srcdir="$ac_confdir or .."
+ { echo "$as_me: error: cannot find sources ($ac_unique_file) in $srcdir" >&2
+ { (exit 1); exit 1; }; }
+fi
+ac_msg="sources are in $srcdir, but \`cd $srcdir' does not work"
+ac_abs_confdir=`(
+ cd "$srcdir" && test -r "./$ac_unique_file" || { echo "$as_me: error: $ac_msg" >&2
+ { (exit 1); exit 1; }; }
+ pwd)`
+# When building in place, set srcdir=.
+if test "$ac_abs_confdir" = "$ac_pwd"; then
+ srcdir=.
+fi
+# Remove unnecessary trailing slashes from srcdir.
+# Double slashes in file names in object file debugging info
+# mess up M-x gdb in Emacs.
+case $srcdir in
+*/) srcdir=`expr "X$srcdir" : 'X\(.*[^/]\)' \| "X$srcdir" : 'X\(.*\)'`;;
+esac
+for ac_var in $ac_precious_vars; do
+ eval ac_env_${ac_var}_set=\${${ac_var}+set}
+ eval ac_env_${ac_var}_value=\$${ac_var}
+ eval ac_cv_env_${ac_var}_set=\${${ac_var}+set}
+ eval ac_cv_env_${ac_var}_value=\$${ac_var}
+done
+
+#
+# Report the --help message.
+#
+if test "$ac_init_help" = "long"; then
+ # Omit some internal or obsolete options to make the list less imposing.
+ # This message is too long to be a string in the A/UX 3.1 sh.
+ cat <<_ACEOF
+\`configure' configures this package to adapt to many kinds of systems.
+
+Usage: $0 [OPTION]... [VAR=VALUE]...
+
+To assign environment variables (e.g., CC, CFLAGS...), specify them as
+VAR=VALUE. See below for descriptions of some of the useful variables.
+
+Defaults for the options are specified in brackets.
+
+Configuration:
+ -h, --help display this help and exit
+ --help=short display options specific to this package
+ --help=recursive display the short help of all the included packages
+ -V, --version display version information and exit
+ -q, --quiet, --silent do not print \`checking...' messages
+ --cache-file=FILE cache test results in FILE [disabled]
+ -C, --config-cache alias for \`--cache-file=config.cache'
+ -n, --no-create do not create output files
+ --srcdir=DIR find the sources in DIR [configure dir or \`..']
+
+Installation directories:
+ --prefix=PREFIX install architecture-independent files in PREFIX
+ [$ac_default_prefix]
+ --exec-prefix=EPREFIX install architecture-dependent files in EPREFIX
+ [PREFIX]
+
+By default, \`make install' will install all the files in
+\`$ac_default_prefix/bin', \`$ac_default_prefix/lib' etc. You can specify
+an installation prefix other than \`$ac_default_prefix' using \`--prefix',
+for instance \`--prefix=\$HOME'.
+
+For better control, use the options below.
+
+Fine tuning of the installation directories:
+ --bindir=DIR user executables [EPREFIX/bin]
+ --sbindir=DIR system admin executables [EPREFIX/sbin]
+ --libexecdir=DIR program executables [EPREFIX/libexec]
+ --sysconfdir=DIR read-only single-machine data [PREFIX/etc]
+ --sharedstatedir=DIR modifiable architecture-independent data [PREFIX/com]
+ --localstatedir=DIR modifiable single-machine data [PREFIX/var]
+ --libdir=DIR object code libraries [EPREFIX/lib]
+ --includedir=DIR C header files [PREFIX/include]
+ --oldincludedir=DIR C header files for non-gcc [/usr/include]
+ --datarootdir=DIR read-only arch.-independent data root [PREFIX/share]
+ --datadir=DIR read-only architecture-independent data [DATAROOTDIR]
+ --infodir=DIR info documentation [DATAROOTDIR/info]
+ --localedir=DIR locale-dependent data [DATAROOTDIR/locale]
+ --mandir=DIR man documentation [DATAROOTDIR/man]
+ --docdir=DIR documentation root [DATAROOTDIR/doc/PACKAGE]
+ --htmldir=DIR html documentation [DOCDIR]
+ --dvidir=DIR dvi documentation [DOCDIR]
+ --pdfdir=DIR pdf documentation [DOCDIR]
+ --psdir=DIR ps documentation [DOCDIR]
+_ACEOF
+
+ cat <<\_ACEOF
+_ACEOF
+fi
+
+if test -n "$ac_init_help"; then
+
+ cat <<\_ACEOF
+
+Optional Features:
+ --disable-FEATURE do not include FEATURE (same as --enable-FEATURE=no)
+ --enable-FEATURE[=ARG] include FEATURE [ARG=yes]
+ --enable-debug turn on debugging, default=no
+ --enable-threads enable multi-threading support
+ --enable-shared turn on shared libraries, default=no
+
+Optional Packages:
+ --with-PACKAGE[=ARG] use PACKAGE [ARG=yes]
+ --without-PACKAGE do not use PACKAGE (same as --with-PACKAGE=no)
+ --with-ansi set full ANSI C mode, default=no
+ --with-archflags set additional architecture flags, default=none
+ --with-docdir set directory for documentation, default=${prefix}/share/doc/mxml
+ --with-vsnprintf use vsnprintf emulation functions, default=auto
+
+Some influential environment variables:
+ CC C compiler command
+ CFLAGS C compiler flags
+ LDFLAGS linker flags, e.g. -L<lib dir> if you have libraries in a
+ nonstandard directory <lib dir>
+ LIBS libraries to pass to the linker, e.g. -l<library>
+ CPPFLAGS C/C++/Objective C preprocessor flags, e.g. -I<include dir> if
+ you have headers in a nonstandard directory <include dir>
+ CXX C++ compiler command
+ CXXFLAGS C++ compiler flags
+ CPP C preprocessor
+
+Use these variables to override the choices made by `configure' or to help
+it to find libraries and programs with nonstandard names/locations.
+
+_ACEOF
+ac_status=$?
+fi
+
+if test "$ac_init_help" = "recursive"; then
+ # If there are subdirs, report their specific --help.
+ for ac_dir in : $ac_subdirs_all; do test "x$ac_dir" = x: && continue
+ test -d "$ac_dir" || continue
+ ac_builddir=.
+
+case "$ac_dir" in
+.) ac_dir_suffix= ac_top_builddir_sub=. ac_top_build_prefix= ;;
+*)
+ ac_dir_suffix=/`echo "$ac_dir" | sed 's,^\.[\\/],,'`
+ # A ".." for each directory in $ac_dir_suffix.
+ ac_top_builddir_sub=`echo "$ac_dir_suffix" | sed 's,/[^\\/]*,/..,g;s,/,,'`
+ case $ac_top_builddir_sub in
+ "") ac_top_builddir_sub=. ac_top_build_prefix= ;;
+ *) ac_top_build_prefix=$ac_top_builddir_sub/ ;;
+ esac ;;
+esac
+ac_abs_top_builddir=$ac_pwd
+ac_abs_builddir=$ac_pwd$ac_dir_suffix
+# for backward compatibility:
+ac_top_builddir=$ac_top_build_prefix
+
+case $srcdir in
+ .) # We are building in place.
+ ac_srcdir=.
+ ac_top_srcdir=$ac_top_builddir_sub
+ ac_abs_top_srcdir=$ac_pwd ;;
+ [\\/]* | ?:[\\/]* ) # Absolute name.
+ ac_srcdir=$srcdir$ac_dir_suffix;
+ ac_top_srcdir=$srcdir
+ ac_abs_top_srcdir=$srcdir ;;
+ *) # Relative name.
+ ac_srcdir=$ac_top_build_prefix$srcdir$ac_dir_suffix
+ ac_top_srcdir=$ac_top_build_prefix$srcdir
+ ac_abs_top_srcdir=$ac_pwd/$srcdir ;;
+esac
+ac_abs_srcdir=$ac_abs_top_srcdir$ac_dir_suffix
+
+ cd "$ac_dir" || { ac_status=$?; continue; }
+ # Check for guested configure.
+ if test -f "$ac_srcdir/configure.gnu"; then
+ echo &&
+ $SHELL "$ac_srcdir/configure.gnu" --help=recursive
+ elif test -f "$ac_srcdir/configure"; then
+ echo &&
+ $SHELL "$ac_srcdir/configure" --help=recursive
+ else
+ echo "$as_me: WARNING: no configuration information is in $ac_dir" >&2
+ fi || ac_status=$?
+ cd "$ac_pwd" || { ac_status=$?; break; }
+ done
+fi
+
+test -n "$ac_init_help" && exit $ac_status
+if $ac_init_version; then
+ cat <<\_ACEOF
+configure
+generated by GNU Autoconf 2.61
+
+Copyright (C) 1992, 1993, 1994, 1995, 1996, 1998, 1999, 2000, 2001,
+2002, 2003, 2004, 2005, 2006 Free Software Foundation, Inc.
+This configure script is free software; the Free Software Foundation
+gives unlimited permission to copy, distribute and modify it.
+_ACEOF
+ exit
+fi
+cat >config.log <<_ACEOF
+This file contains any messages produced by compilers while
+running configure, to aid debugging if configure makes a mistake.
+
+It was created by $as_me, which was
+generated by GNU Autoconf 2.61. Invocation command line was
+
+ $ $0 $@
+
+_ACEOF
+exec 5>>config.log
+{
+cat <<_ASUNAME
+## --------- ##
+## Platform. ##
+## --------- ##
+
+hostname = `(hostname || uname -n) 2>/dev/null | sed 1q`
+uname -m = `(uname -m) 2>/dev/null || echo unknown`
+uname -r = `(uname -r) 2>/dev/null || echo unknown`
+uname -s = `(uname -s) 2>/dev/null || echo unknown`
+uname -v = `(uname -v) 2>/dev/null || echo unknown`
+
+/usr/bin/uname -p = `(/usr/bin/uname -p) 2>/dev/null || echo unknown`
+/bin/uname -X = `(/bin/uname -X) 2>/dev/null || echo unknown`
+
+/bin/arch = `(/bin/arch) 2>/dev/null || echo unknown`
+/usr/bin/arch -k = `(/usr/bin/arch -k) 2>/dev/null || echo unknown`
+/usr/convex/getsysinfo = `(/usr/convex/getsysinfo) 2>/dev/null || echo unknown`
+/usr/bin/hostinfo = `(/usr/bin/hostinfo) 2>/dev/null || echo unknown`
+/bin/machine = `(/bin/machine) 2>/dev/null || echo unknown`
+/usr/bin/oslevel = `(/usr/bin/oslevel) 2>/dev/null || echo unknown`
+/bin/universe = `(/bin/universe) 2>/dev/null || echo unknown`
+
+_ASUNAME
+
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ echo "PATH: $as_dir"
+done
+IFS=$as_save_IFS
+
+} >&5
+
+cat >&5 <<_ACEOF
+
+
+## ----------- ##
+## Core tests. ##
+## ----------- ##
+
+_ACEOF
+
+
+# Keep a trace of the command line.
+# Strip out --no-create and --no-recursion so they do not pile up.
+# Strip out --silent because we don't want to record it for future runs.
+# Also quote any args containing shell meta-characters.
+# Make two passes to allow for proper duplicate-argument suppression.
+ac_configure_args=
+ac_configure_args0=
+ac_configure_args1=
+ac_must_keep_next=false
+for ac_pass in 1 2
+do
+ for ac_arg
+ do
+ case $ac_arg in
+ -no-create | --no-c* | -n | -no-recursion | --no-r*) continue ;;
+ -q | -quiet | --quiet | --quie | --qui | --qu | --q \
+ | -silent | --silent | --silen | --sile | --sil)
+ continue ;;
+ *\'*)
+ ac_arg=`echo "$ac_arg" | sed "s/'/'\\\\\\\\''/g"` ;;
+ esac
+ case $ac_pass in
+ 1) ac_configure_args0="$ac_configure_args0 '$ac_arg'" ;;
+ 2)
+ ac_configure_args1="$ac_configure_args1 '$ac_arg'"
+ if test $ac_must_keep_next = true; then
+ ac_must_keep_next=false # Got value, back to normal.
+ else
+ case $ac_arg in
+ *=* | --config-cache | -C | -disable-* | --disable-* \
+ | -enable-* | --enable-* | -gas | --g* | -nfp | --nf* \
+ | -q | -quiet | --q* | -silent | --sil* | -v | -verb* \
+ | -with-* | --with-* | -without-* | --without-* | --x)
+ case "$ac_configure_args0 " in
+ "$ac_configure_args1"*" '$ac_arg' "* ) continue ;;
+ esac
+ ;;
+ -* ) ac_must_keep_next=true ;;
+ esac
+ fi
+ ac_configure_args="$ac_configure_args '$ac_arg'"
+ ;;
+ esac
+ done
+done
+$as_unset ac_configure_args0 || test "${ac_configure_args0+set}" != set || { ac_configure_args0=; export ac_configure_args0; }
+$as_unset ac_configure_args1 || test "${ac_configure_args1+set}" != set || { ac_configure_args1=; export ac_configure_args1; }
+
+# When interrupted or exit'd, cleanup temporary files, and complete
+# config.log. We remove comments because anyway the quotes in there
+# would cause problems or look ugly.
+# WARNING: Use '\'' to represent an apostrophe within the trap.
+# WARNING: Do not start the trap code with a newline, due to a FreeBSD 4.0 bug.
+trap 'exit_status=$?
+ # Save into config.log some information that might help in debugging.
+ {
+ echo
+
+ cat <<\_ASBOX
+## ---------------- ##
+## Cache variables. ##
+## ---------------- ##
+_ASBOX
+ echo
+ # The following way of writing the cache mishandles newlines in values,
+(
+ for ac_var in `(set) 2>&1 | sed -n '\''s/^\([a-zA-Z_][a-zA-Z0-9_]*\)=.*/\1/p'\''`; do
+ eval ac_val=\$$ac_var
+ case $ac_val in #(
+ *${as_nl}*)
+ case $ac_var in #(
+ *_cv_*) { echo "$as_me:$LINENO: WARNING: Cache variable $ac_var contains a newline." >&5
+echo "$as_me: WARNING: Cache variable $ac_var contains a newline." >&2;} ;;
+ esac
+ case $ac_var in #(
+ _ | IFS | as_nl) ;; #(
+ *) $as_unset $ac_var ;;
+ esac ;;
+ esac
+ done
+ (set) 2>&1 |
+ case $as_nl`(ac_space='\'' '\''; set) 2>&1` in #(
+ *${as_nl}ac_space=\ *)
+ sed -n \
+ "s/'\''/'\''\\\\'\'''\''/g;
+ s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1='\''\\2'\''/p"
+ ;; #(
+ *)
+ sed -n "/^[_$as_cr_alnum]*_cv_[_$as_cr_alnum]*=/p"
+ ;;
+ esac |
+ sort
+)
+ echo
+
+ cat <<\_ASBOX
+## ----------------- ##
+## Output variables. ##
+## ----------------- ##
+_ASBOX
+ echo
+ for ac_var in $ac_subst_vars
+ do
+ eval ac_val=\$$ac_var
+ case $ac_val in
+ *\'\''*) ac_val=`echo "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;;
+ esac
+ echo "$ac_var='\''$ac_val'\''"
+ done | sort
+ echo
+
+ if test -n "$ac_subst_files"; then
+ cat <<\_ASBOX
+## ------------------- ##
+## File substitutions. ##
+## ------------------- ##
+_ASBOX
+ echo
+ for ac_var in $ac_subst_files
+ do
+ eval ac_val=\$$ac_var
+ case $ac_val in
+ *\'\''*) ac_val=`echo "$ac_val" | sed "s/'\''/'\''\\\\\\\\'\'''\''/g"`;;
+ esac
+ echo "$ac_var='\''$ac_val'\''"
+ done | sort
+ echo
+ fi
+
+ if test -s confdefs.h; then
+ cat <<\_ASBOX
+## ----------- ##
+## confdefs.h. ##
+## ----------- ##
+_ASBOX
+ echo
+ cat confdefs.h
+ echo
+ fi
+ test "$ac_signal" != 0 &&
+ echo "$as_me: caught signal $ac_signal"
+ echo "$as_me: exit $exit_status"
+ } >&5
+ rm -f core *.core core.conftest.* &&
+ rm -f -r conftest* confdefs* conf$$* $ac_clean_files &&
+ exit $exit_status
+' 0
+for ac_signal in 1 2 13 15; do
+ trap 'ac_signal='$ac_signal'; { (exit 1); exit 1; }' $ac_signal
+done
+ac_signal=0
+
+# confdefs.h avoids OS command line length limits that DEFS can exceed.
+rm -f -r conftest* confdefs.h
+
+# Predefined preprocessor variables.
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE_NAME "$PACKAGE_NAME"
+_ACEOF
+
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE_TARNAME "$PACKAGE_TARNAME"
+_ACEOF
+
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE_VERSION "$PACKAGE_VERSION"
+_ACEOF
+
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE_STRING "$PACKAGE_STRING"
+_ACEOF
+
+
+cat >>confdefs.h <<_ACEOF
+#define PACKAGE_BUGREPORT "$PACKAGE_BUGREPORT"
+_ACEOF
+
+
+# Let the site file select an alternate cache file if it wants to.
+# Prefer explicitly selected file to automatically selected ones.
+if test -n "$CONFIG_SITE"; then
+ set x "$CONFIG_SITE"
+elif test "x$prefix" != xNONE; then
+ set x "$prefix/share/config.site" "$prefix/etc/config.site"
+else
+ set x "$ac_default_prefix/share/config.site" \
+ "$ac_default_prefix/etc/config.site"
+fi
+shift
+for ac_site_file
+do
+ if test -r "$ac_site_file"; then
+ { echo "$as_me:$LINENO: loading site script $ac_site_file" >&5
+echo "$as_me: loading site script $ac_site_file" >&6;}
+ sed 's/^/| /' "$ac_site_file" >&5
+ . "$ac_site_file"
+ fi
+done
+
+if test -r "$cache_file"; then
+ # Some versions of bash will fail to source /dev/null (special
+ # files actually), so we avoid doing that.
+ if test -f "$cache_file"; then
+ { echo "$as_me:$LINENO: loading cache $cache_file" >&5
+echo "$as_me: loading cache $cache_file" >&6;}
+ case $cache_file in
+ [\\/]* | ?:[\\/]* ) . "$cache_file";;
+ *) . "./$cache_file";;
+ esac
+ fi
+else
+ { echo "$as_me:$LINENO: creating cache $cache_file" >&5
+echo "$as_me: creating cache $cache_file" >&6;}
+ >$cache_file
+fi
+
+# Check that the precious variables saved in the cache have kept the same
+# value.
+ac_cache_corrupted=false
+for ac_var in $ac_precious_vars; do
+ eval ac_old_set=\$ac_cv_env_${ac_var}_set
+ eval ac_new_set=\$ac_env_${ac_var}_set
+ eval ac_old_val=\$ac_cv_env_${ac_var}_value
+ eval ac_new_val=\$ac_env_${ac_var}_value
+ case $ac_old_set,$ac_new_set in
+ set,)
+ { echo "$as_me:$LINENO: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&5
+echo "$as_me: error: \`$ac_var' was set to \`$ac_old_val' in the previous run" >&2;}
+ ac_cache_corrupted=: ;;
+ ,set)
+ { echo "$as_me:$LINENO: error: \`$ac_var' was not set in the previous run" >&5
+echo "$as_me: error: \`$ac_var' was not set in the previous run" >&2;}
+ ac_cache_corrupted=: ;;
+ ,);;
+ *)
+ if test "x$ac_old_val" != "x$ac_new_val"; then
+ { echo "$as_me:$LINENO: error: \`$ac_var' has changed since the previous run:" >&5
+echo "$as_me: error: \`$ac_var' has changed since the previous run:" >&2;}
+ { echo "$as_me:$LINENO: former value: $ac_old_val" >&5
+echo "$as_me: former value: $ac_old_val" >&2;}
+ { echo "$as_me:$LINENO: current value: $ac_new_val" >&5
+echo "$as_me: current value: $ac_new_val" >&2;}
+ ac_cache_corrupted=:
+ fi;;
+ esac
+ # Pass precious variables to config.status.
+ if test "$ac_new_set" = set; then
+ case $ac_new_val in
+ *\'*) ac_arg=$ac_var=`echo "$ac_new_val" | sed "s/'/'\\\\\\\\''/g"` ;;
+ *) ac_arg=$ac_var=$ac_new_val ;;
+ esac
+ case " $ac_configure_args " in
+ *" '$ac_arg' "*) ;; # Avoid dups. Use of quotes ensures accuracy.
+ *) ac_configure_args="$ac_configure_args '$ac_arg'" ;;
+ esac
+ fi
+done
+if $ac_cache_corrupted; then
+ { echo "$as_me:$LINENO: error: changes in the environment can compromise the build" >&5
+echo "$as_me: error: changes in the environment can compromise the build" >&2;}
+ { { echo "$as_me:$LINENO: error: run \`make distclean' and/or \`rm $cache_file' and start over" >&5
+echo "$as_me: error: run \`make distclean' and/or \`rm $cache_file' and start over" >&2;}
+ { (exit 1); exit 1; }; }
+fi
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+ac_ext=c
+ac_cpp='$CPP $CPPFLAGS'
+ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5'
+ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5'
+ac_compiler_gnu=$ac_cv_c_compiler_gnu
+
+
+
+ac_config_headers="$ac_config_headers config.h"
+
+
+VERSION=2.6
+
+cat >>confdefs.h <<_ACEOF
+#define MXML_VERSION "Mini-XML v$VERSION"
+_ACEOF
+
+
+CFLAGS="${CFLAGS:=}"
+CXXFLAGS="${CXXFLAGS:=}"
+LDFLAGS="${LDFLAGS:=}"
+
+OPTIM=""
+
+
+
+# Check whether --with-ansi was given.
+if test "${with_ansi+set}" = set; then
+ withval=$with_ansi; use_ansi="$withval"
+else
+ use_ansi="no"
+fi
+
+
+
+# Check whether --with-archflags was given.
+if test "${with_archflags+set}" = set; then
+ withval=$with_archflags; ARCHFLAGS="$withval"
+else
+ ARCHFLAGS=""
+fi
+
+
+
+# Check whether --enable-debug was given.
+if test "${enable_debug+set}" = set; then
+ enableval=$enable_debug; if eval "test x$enable_debug = xyes"; then
+ OPTIM="-g"
+fi
+fi
+
+
+
+# Check whether --with-docdir was given.
+if test "${with_docdir+set}" = set; then
+ withval=$with_docdir; docdir="$withval"
+else
+ docdir="NONE"
+fi
+
+
+
+
+
+# Check whether --with-vsnprintf was given.
+if test "${with_vsnprintf+set}" = set; then
+ withval=$with_vsnprintf; use_vsnprintf="$withval"
+else
+ use_vsnprintf="no"
+fi
+
+
+uname=`uname`
+uversion=`uname -r | sed -e '1,$s/[^0-9]//g'`
+if test x$uname = xIRIX64; then
+ uname="IRIX"
+fi
+
+ac_ext=c
+ac_cpp='$CPP $CPPFLAGS'
+ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5'
+ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5'
+ac_compiler_gnu=$ac_cv_c_compiler_gnu
+if test -n "$ac_tool_prefix"; then
+ # Extract the first word of "${ac_tool_prefix}gcc", so it can be a program name with args.
+set dummy ${ac_tool_prefix}gcc; ac_word=$2
+{ echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; }
+if test "${ac_cv_prog_CC+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ if test -n "$CC"; then
+ ac_cv_prog_CC="$CC" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then
+ ac_cv_prog_CC="${ac_tool_prefix}gcc"
+ echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+ break 2
+ fi
+done
+done
+IFS=$as_save_IFS
+
+fi
+fi
+CC=$ac_cv_prog_CC
+if test -n "$CC"; then
+ { echo "$as_me:$LINENO: result: $CC" >&5
+echo "${ECHO_T}$CC" >&6; }
+else
+ { echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6; }
+fi
+
+
+fi
+if test -z "$ac_cv_prog_CC"; then
+ ac_ct_CC=$CC
+ # Extract the first word of "gcc", so it can be a program name with args.
+set dummy gcc; ac_word=$2
+{ echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; }
+if test "${ac_cv_prog_ac_ct_CC+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ if test -n "$ac_ct_CC"; then
+ ac_cv_prog_ac_ct_CC="$ac_ct_CC" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then
+ ac_cv_prog_ac_ct_CC="gcc"
+ echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+ break 2
+ fi
+done
+done
+IFS=$as_save_IFS
+
+fi
+fi
+ac_ct_CC=$ac_cv_prog_ac_ct_CC
+if test -n "$ac_ct_CC"; then
+ { echo "$as_me:$LINENO: result: $ac_ct_CC" >&5
+echo "${ECHO_T}$ac_ct_CC" >&6; }
+else
+ { echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6; }
+fi
+
+ if test "x$ac_ct_CC" = x; then
+ CC=""
+ else
+ case $cross_compiling:$ac_tool_warned in
+yes:)
+{ echo "$as_me:$LINENO: WARNING: In the future, Autoconf will not detect cross-tools
+whose name does not start with the host triplet. If you think this
+configuration is useful to you, please write to autoconf@gnu.org." >&5
+echo "$as_me: WARNING: In the future, Autoconf will not detect cross-tools
+whose name does not start with the host triplet. If you think this
+configuration is useful to you, please write to autoconf@gnu.org." >&2;}
+ac_tool_warned=yes ;;
+esac
+ CC=$ac_ct_CC
+ fi
+else
+ CC="$ac_cv_prog_CC"
+fi
+
+if test -z "$CC"; then
+ if test -n "$ac_tool_prefix"; then
+ # Extract the first word of "${ac_tool_prefix}cc", so it can be a program name with args.
+set dummy ${ac_tool_prefix}cc; ac_word=$2
+{ echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; }
+if test "${ac_cv_prog_CC+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ if test -n "$CC"; then
+ ac_cv_prog_CC="$CC" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then
+ ac_cv_prog_CC="${ac_tool_prefix}cc"
+ echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+ break 2
+ fi
+done
+done
+IFS=$as_save_IFS
+
+fi
+fi
+CC=$ac_cv_prog_CC
+if test -n "$CC"; then
+ { echo "$as_me:$LINENO: result: $CC" >&5
+echo "${ECHO_T}$CC" >&6; }
+else
+ { echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6; }
+fi
+
+
+ fi
+fi
+if test -z "$CC"; then
+ # Extract the first word of "cc", so it can be a program name with args.
+set dummy cc; ac_word=$2
+{ echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; }
+if test "${ac_cv_prog_CC+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ if test -n "$CC"; then
+ ac_cv_prog_CC="$CC" # Let the user override the test.
+else
+ ac_prog_rejected=no
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then
+ if test "$as_dir/$ac_word$ac_exec_ext" = "/usr/ucb/cc"; then
+ ac_prog_rejected=yes
+ continue
+ fi
+ ac_cv_prog_CC="cc"
+ echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+ break 2
+ fi
+done
+done
+IFS=$as_save_IFS
+
+if test $ac_prog_rejected = yes; then
+ # We found a bogon in the path, so make sure we never use it.
+ set dummy $ac_cv_prog_CC
+ shift
+ if test $# != 0; then
+ # We chose a different compiler from the bogus one.
+ # However, it has the same basename, so the bogon will be chosen
+ # first if we set CC to just the basename; use the full file name.
+ shift
+ ac_cv_prog_CC="$as_dir/$ac_word${1+' '}$@"
+ fi
+fi
+fi
+fi
+CC=$ac_cv_prog_CC
+if test -n "$CC"; then
+ { echo "$as_me:$LINENO: result: $CC" >&5
+echo "${ECHO_T}$CC" >&6; }
+else
+ { echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6; }
+fi
+
+
+fi
+if test -z "$CC"; then
+ if test -n "$ac_tool_prefix"; then
+ for ac_prog in cl.exe
+ do
+ # Extract the first word of "$ac_tool_prefix$ac_prog", so it can be a program name with args.
+set dummy $ac_tool_prefix$ac_prog; ac_word=$2
+{ echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; }
+if test "${ac_cv_prog_CC+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ if test -n "$CC"; then
+ ac_cv_prog_CC="$CC" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then
+ ac_cv_prog_CC="$ac_tool_prefix$ac_prog"
+ echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+ break 2
+ fi
+done
+done
+IFS=$as_save_IFS
+
+fi
+fi
+CC=$ac_cv_prog_CC
+if test -n "$CC"; then
+ { echo "$as_me:$LINENO: result: $CC" >&5
+echo "${ECHO_T}$CC" >&6; }
+else
+ { echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6; }
+fi
+
+
+ test -n "$CC" && break
+ done
+fi
+if test -z "$CC"; then
+ ac_ct_CC=$CC
+ for ac_prog in cl.exe
+do
+ # Extract the first word of "$ac_prog", so it can be a program name with args.
+set dummy $ac_prog; ac_word=$2
+{ echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; }
+if test "${ac_cv_prog_ac_ct_CC+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ if test -n "$ac_ct_CC"; then
+ ac_cv_prog_ac_ct_CC="$ac_ct_CC" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then
+ ac_cv_prog_ac_ct_CC="$ac_prog"
+ echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+ break 2
+ fi
+done
+done
+IFS=$as_save_IFS
+
+fi
+fi
+ac_ct_CC=$ac_cv_prog_ac_ct_CC
+if test -n "$ac_ct_CC"; then
+ { echo "$as_me:$LINENO: result: $ac_ct_CC" >&5
+echo "${ECHO_T}$ac_ct_CC" >&6; }
+else
+ { echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6; }
+fi
+
+
+ test -n "$ac_ct_CC" && break
+done
+
+ if test "x$ac_ct_CC" = x; then
+ CC=""
+ else
+ case $cross_compiling:$ac_tool_warned in
+yes:)
+{ echo "$as_me:$LINENO: WARNING: In the future, Autoconf will not detect cross-tools
+whose name does not start with the host triplet. If you think this
+configuration is useful to you, please write to autoconf@gnu.org." >&5
+echo "$as_me: WARNING: In the future, Autoconf will not detect cross-tools
+whose name does not start with the host triplet. If you think this
+configuration is useful to you, please write to autoconf@gnu.org." >&2;}
+ac_tool_warned=yes ;;
+esac
+ CC=$ac_ct_CC
+ fi
+fi
+
+fi
+
+
+test -z "$CC" && { { echo "$as_me:$LINENO: error: no acceptable C compiler found in \$PATH
+See \`config.log' for more details." >&5
+echo "$as_me: error: no acceptable C compiler found in \$PATH
+See \`config.log' for more details." >&2;}
+ { (exit 1); exit 1; }; }
+
+# Provide some information about the compiler.
+echo "$as_me:$LINENO: checking for C compiler version" >&5
+ac_compiler=`set X $ac_compile; echo $2`
+{ (ac_try="$ac_compiler --version >&5"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_compiler --version >&5") 2>&5
+ ac_status=$?
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); }
+{ (ac_try="$ac_compiler -v >&5"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_compiler -v >&5") 2>&5
+ ac_status=$?
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); }
+{ (ac_try="$ac_compiler -V >&5"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_compiler -V >&5") 2>&5
+ ac_status=$?
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); }
+
+cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+
+int
+main ()
+{
+
+ ;
+ return 0;
+}
+_ACEOF
+ac_clean_files_save=$ac_clean_files
+ac_clean_files="$ac_clean_files a.out a.exe b.out"
+# Try to create an executable without -o first, disregard a.out.
+# It will help us diagnose broken compilers, and finding out an intuition
+# of exeext.
+{ echo "$as_me:$LINENO: checking for C compiler default output file name" >&5
+echo $ECHO_N "checking for C compiler default output file name... $ECHO_C" >&6; }
+ac_link_default=`echo "$ac_link" | sed 's/ -o *conftest[^ ]*//'`
+#
+# List of possible output files, starting from the most likely.
+# The algorithm is not robust to junk in `.', hence go to wildcards (a.*)
+# only as a last resort. b.out is created by i960 compilers.
+ac_files='a_out.exe a.exe conftest.exe a.out conftest a.* conftest.* b.out'
+#
+# The IRIX 6 linker writes into existing files which may not be
+# executable, retaining their permissions. Remove them first so a
+# subsequent execution test works.
+ac_rmfiles=
+for ac_file in $ac_files
+do
+ case $ac_file in
+ *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.map | *.inf | *.o | *.obj ) ;;
+ * ) ac_rmfiles="$ac_rmfiles $ac_file";;
+ esac
+done
+rm -f $ac_rmfiles
+
+if { (ac_try="$ac_link_default"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_link_default") 2>&5
+ ac_status=$?
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); }; then
+ # Autoconf-2.13 could set the ac_cv_exeext variable to `no'.
+# So ignore a value of `no', otherwise this would lead to `EXEEXT = no'
+# in a Makefile. We should not override ac_cv_exeext if it was cached,
+# so that the user can short-circuit this test for compilers unknown to
+# Autoconf.
+for ac_file in $ac_files ''
+do
+ test -f "$ac_file" || continue
+ case $ac_file in
+ *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.map | *.inf | *.o | *.obj )
+ ;;
+ [ab].out )
+ # We found the default executable, but exeext='' is most
+ # certainly right.
+ break;;
+ *.* )
+ if test "${ac_cv_exeext+set}" = set && test "$ac_cv_exeext" != no;
+ then :; else
+ ac_cv_exeext=`expr "$ac_file" : '[^.]*\(\..*\)'`
+ fi
+ # We set ac_cv_exeext here because the later test for it is not
+ # safe: cross compilers may not add the suffix if given an `-o'
+ # argument, so we may need to know it at that point already.
+ # Even if this section looks crufty: it has the advantage of
+ # actually working.
+ break;;
+ * )
+ break;;
+ esac
+done
+test "$ac_cv_exeext" = no && ac_cv_exeext=
+
+else
+ ac_file=''
+fi
+
+{ echo "$as_me:$LINENO: result: $ac_file" >&5
+echo "${ECHO_T}$ac_file" >&6; }
+if test -z "$ac_file"; then
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+{ { echo "$as_me:$LINENO: error: C compiler cannot create executables
+See \`config.log' for more details." >&5
+echo "$as_me: error: C compiler cannot create executables
+See \`config.log' for more details." >&2;}
+ { (exit 77); exit 77; }; }
+fi
+
+ac_exeext=$ac_cv_exeext
+
+# Check that the compiler produces executables we can run. If not, either
+# the compiler is broken, or we cross compile.
+{ echo "$as_me:$LINENO: checking whether the C compiler works" >&5
+echo $ECHO_N "checking whether the C compiler works... $ECHO_C" >&6; }
+# FIXME: These cross compiler hacks should be removed for Autoconf 3.0
+# If not cross compiling, check that we can run a simple program.
+if test "$cross_compiling" != yes; then
+ if { ac_try='./$ac_file'
+ { (case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_try") 2>&5
+ ac_status=$?
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); }; }; then
+ cross_compiling=no
+ else
+ if test "$cross_compiling" = maybe; then
+ cross_compiling=yes
+ else
+ { { echo "$as_me:$LINENO: error: cannot run C compiled programs.
+If you meant to cross compile, use \`--host'.
+See \`config.log' for more details." >&5
+echo "$as_me: error: cannot run C compiled programs.
+If you meant to cross compile, use \`--host'.
+See \`config.log' for more details." >&2;}
+ { (exit 1); exit 1; }; }
+ fi
+ fi
+fi
+{ echo "$as_me:$LINENO: result: yes" >&5
+echo "${ECHO_T}yes" >&6; }
+
+rm -f a.out a.exe conftest$ac_cv_exeext b.out
+ac_clean_files=$ac_clean_files_save
+# Check that the compiler produces executables we can run. If not, either
+# the compiler is broken, or we cross compile.
+{ echo "$as_me:$LINENO: checking whether we are cross compiling" >&5
+echo $ECHO_N "checking whether we are cross compiling... $ECHO_C" >&6; }
+{ echo "$as_me:$LINENO: result: $cross_compiling" >&5
+echo "${ECHO_T}$cross_compiling" >&6; }
+
+{ echo "$as_me:$LINENO: checking for suffix of executables" >&5
+echo $ECHO_N "checking for suffix of executables... $ECHO_C" >&6; }
+if { (ac_try="$ac_link"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_link") 2>&5
+ ac_status=$?
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); }; then
+ # If both `conftest.exe' and `conftest' are `present' (well, observable)
+# catch `conftest.exe'. For instance with Cygwin, `ls conftest' will
+# work properly (i.e., refer to `conftest.exe'), while it won't with
+# `rm'.
+for ac_file in conftest.exe conftest conftest.*; do
+ test -f "$ac_file" || continue
+ case $ac_file in
+ *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.map | *.inf | *.o | *.obj ) ;;
+ *.* ) ac_cv_exeext=`expr "$ac_file" : '[^.]*\(\..*\)'`
+ break;;
+ * ) break;;
+ esac
+done
+else
+ { { echo "$as_me:$LINENO: error: cannot compute suffix of executables: cannot compile and link
+See \`config.log' for more details." >&5
+echo "$as_me: error: cannot compute suffix of executables: cannot compile and link
+See \`config.log' for more details." >&2;}
+ { (exit 1); exit 1; }; }
+fi
+
+rm -f conftest$ac_cv_exeext
+{ echo "$as_me:$LINENO: result: $ac_cv_exeext" >&5
+echo "${ECHO_T}$ac_cv_exeext" >&6; }
+
+rm -f conftest.$ac_ext
+EXEEXT=$ac_cv_exeext
+ac_exeext=$EXEEXT
+{ echo "$as_me:$LINENO: checking for suffix of object files" >&5
+echo $ECHO_N "checking for suffix of object files... $ECHO_C" >&6; }
+if test "${ac_cv_objext+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+
+int
+main ()
+{
+
+ ;
+ return 0;
+}
+_ACEOF
+rm -f conftest.o conftest.obj
+if { (ac_try="$ac_compile"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_compile") 2>&5
+ ac_status=$?
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); }; then
+ for ac_file in conftest.o conftest.obj conftest.*; do
+ test -f "$ac_file" || continue;
+ case $ac_file in
+ *.$ac_ext | *.xcoff | *.tds | *.d | *.pdb | *.xSYM | *.bb | *.bbg | *.map | *.inf ) ;;
+ *) ac_cv_objext=`expr "$ac_file" : '.*\.\(.*\)'`
+ break;;
+ esac
+done
+else
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+{ { echo "$as_me:$LINENO: error: cannot compute suffix of object files: cannot compile
+See \`config.log' for more details." >&5
+echo "$as_me: error: cannot compute suffix of object files: cannot compile
+See \`config.log' for more details." >&2;}
+ { (exit 1); exit 1; }; }
+fi
+
+rm -f conftest.$ac_cv_objext conftest.$ac_ext
+fi
+{ echo "$as_me:$LINENO: result: $ac_cv_objext" >&5
+echo "${ECHO_T}$ac_cv_objext" >&6; }
+OBJEXT=$ac_cv_objext
+ac_objext=$OBJEXT
+{ echo "$as_me:$LINENO: checking whether we are using the GNU C compiler" >&5
+echo $ECHO_N "checking whether we are using the GNU C compiler... $ECHO_C" >&6; }
+if test "${ac_cv_c_compiler_gnu+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+
+int
+main ()
+{
+#ifndef __GNUC__
+ choke me
+#endif
+
+ ;
+ return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext
+if { (ac_try="$ac_compile"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_compile") 2>conftest.er1
+ ac_status=$?
+ grep -v '^ *+' conftest.er1 >conftest.err
+ rm -f conftest.er1
+ cat conftest.err >&5
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); } && {
+ test -z "$ac_c_werror_flag" ||
+ test ! -s conftest.err
+ } && test -s conftest.$ac_objext; then
+ ac_compiler_gnu=yes
+else
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ ac_compiler_gnu=no
+fi
+
+rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+ac_cv_c_compiler_gnu=$ac_compiler_gnu
+
+fi
+{ echo "$as_me:$LINENO: result: $ac_cv_c_compiler_gnu" >&5
+echo "${ECHO_T}$ac_cv_c_compiler_gnu" >&6; }
+GCC=`test $ac_compiler_gnu = yes && echo yes`
+ac_test_CFLAGS=${CFLAGS+set}
+ac_save_CFLAGS=$CFLAGS
+{ echo "$as_me:$LINENO: checking whether $CC accepts -g" >&5
+echo $ECHO_N "checking whether $CC accepts -g... $ECHO_C" >&6; }
+if test "${ac_cv_prog_cc_g+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ ac_save_c_werror_flag=$ac_c_werror_flag
+ ac_c_werror_flag=yes
+ ac_cv_prog_cc_g=no
+ CFLAGS="-g"
+ cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+
+int
+main ()
+{
+
+ ;
+ return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext
+if { (ac_try="$ac_compile"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_compile") 2>conftest.er1
+ ac_status=$?
+ grep -v '^ *+' conftest.er1 >conftest.err
+ rm -f conftest.er1
+ cat conftest.err >&5
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); } && {
+ test -z "$ac_c_werror_flag" ||
+ test ! -s conftest.err
+ } && test -s conftest.$ac_objext; then
+ ac_cv_prog_cc_g=yes
+else
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ CFLAGS=""
+ cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+
+int
+main ()
+{
+
+ ;
+ return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext
+if { (ac_try="$ac_compile"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_compile") 2>conftest.er1
+ ac_status=$?
+ grep -v '^ *+' conftest.er1 >conftest.err
+ rm -f conftest.er1
+ cat conftest.err >&5
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); } && {
+ test -z "$ac_c_werror_flag" ||
+ test ! -s conftest.err
+ } && test -s conftest.$ac_objext; then
+ :
+else
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ ac_c_werror_flag=$ac_save_c_werror_flag
+ CFLAGS="-g"
+ cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+
+int
+main ()
+{
+
+ ;
+ return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext
+if { (ac_try="$ac_compile"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_compile") 2>conftest.er1
+ ac_status=$?
+ grep -v '^ *+' conftest.er1 >conftest.err
+ rm -f conftest.er1
+ cat conftest.err >&5
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); } && {
+ test -z "$ac_c_werror_flag" ||
+ test ! -s conftest.err
+ } && test -s conftest.$ac_objext; then
+ ac_cv_prog_cc_g=yes
+else
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+
+fi
+
+rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+fi
+
+rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+fi
+
+rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+ ac_c_werror_flag=$ac_save_c_werror_flag
+fi
+{ echo "$as_me:$LINENO: result: $ac_cv_prog_cc_g" >&5
+echo "${ECHO_T}$ac_cv_prog_cc_g" >&6; }
+if test "$ac_test_CFLAGS" = set; then
+ CFLAGS=$ac_save_CFLAGS
+elif test $ac_cv_prog_cc_g = yes; then
+ if test "$GCC" = yes; then
+ CFLAGS="-g -O2"
+ else
+ CFLAGS="-g"
+ fi
+else
+ if test "$GCC" = yes; then
+ CFLAGS="-O2"
+ else
+ CFLAGS=
+ fi
+fi
+{ echo "$as_me:$LINENO: checking for $CC option to accept ISO C89" >&5
+echo $ECHO_N "checking for $CC option to accept ISO C89... $ECHO_C" >&6; }
+if test "${ac_cv_prog_cc_c89+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ ac_cv_prog_cc_c89=no
+ac_save_CC=$CC
+cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+#include <stdarg.h>
+#include <stdio.h>
+#include <sys/types.h>
+#include <sys/stat.h>
+/* Most of the following tests are stolen from RCS 5.7's src/conf.sh. */
+struct buf { int x; };
+FILE * (*rcsopen) (struct buf *, struct stat *, int);
+static char *e (p, i)
+ char **p;
+ int i;
+{
+ return p[i];
+}
+static char *f (char * (*g) (char **, int), char **p, ...)
+{
+ char *s;
+ va_list v;
+ va_start (v,p);
+ s = g (p, va_arg (v,int));
+ va_end (v);
+ return s;
+}
+
+/* OSF 4.0 Compaq cc is some sort of almost-ANSI by default. It has
+ function prototypes and stuff, but not '\xHH' hex character constants.
+ These don't provoke an error unfortunately, instead are silently treated
+ as 'x'. The following induces an error, until -std is added to get
+ proper ANSI mode. Curiously '\x00'!='x' always comes out true, for an
+ array size at least. It's necessary to write '\x00'==0 to get something
+ that's true only with -std. */
+int osf4_cc_array ['\x00' == 0 ? 1 : -1];
+
+/* IBM C 6 for AIX is almost-ANSI by default, but it replaces macro parameters
+ inside strings and character constants. */
+#define FOO(x) 'x'
+int xlc6_cc_array[FOO(a) == 'x' ? 1 : -1];
+
+int test (int i, double x);
+struct s1 {int (*f) (int a);};
+struct s2 {int (*f) (double a);};
+int pairnames (int, char **, FILE *(*)(struct buf *, struct stat *, int), int, int);
+int argc;
+char **argv;
+int
+main ()
+{
+return f (e, argv, 0) != argv[0] || f (e, argv, 1) != argv[1];
+ ;
+ return 0;
+}
+_ACEOF
+for ac_arg in '' -qlanglvl=extc89 -qlanglvl=ansi -std \
+ -Ae "-Aa -D_HPUX_SOURCE" "-Xc -D__EXTENSIONS__"
+do
+ CC="$ac_save_CC $ac_arg"
+ rm -f conftest.$ac_objext
+if { (ac_try="$ac_compile"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_compile") 2>conftest.er1
+ ac_status=$?
+ grep -v '^ *+' conftest.er1 >conftest.err
+ rm -f conftest.er1
+ cat conftest.err >&5
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); } && {
+ test -z "$ac_c_werror_flag" ||
+ test ! -s conftest.err
+ } && test -s conftest.$ac_objext; then
+ ac_cv_prog_cc_c89=$ac_arg
+else
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+
+fi
+
+rm -f core conftest.err conftest.$ac_objext
+ test "x$ac_cv_prog_cc_c89" != "xno" && break
+done
+rm -f conftest.$ac_ext
+CC=$ac_save_CC
+
+fi
+# AC_CACHE_VAL
+case "x$ac_cv_prog_cc_c89" in
+ x)
+ { echo "$as_me:$LINENO: result: none needed" >&5
+echo "${ECHO_T}none needed" >&6; } ;;
+ xno)
+ { echo "$as_me:$LINENO: result: unsupported" >&5
+echo "${ECHO_T}unsupported" >&6; } ;;
+ *)
+ CC="$CC $ac_cv_prog_cc_c89"
+ { echo "$as_me:$LINENO: result: $ac_cv_prog_cc_c89" >&5
+echo "${ECHO_T}$ac_cv_prog_cc_c89" >&6; } ;;
+esac
+
+
+ac_ext=c
+ac_cpp='$CPP $CPPFLAGS'
+ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5'
+ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5'
+ac_compiler_gnu=$ac_cv_c_compiler_gnu
+
+ac_ext=cpp
+ac_cpp='$CXXCPP $CPPFLAGS'
+ac_compile='$CXX -c $CXXFLAGS $CPPFLAGS conftest.$ac_ext >&5'
+ac_link='$CXX -o conftest$ac_exeext $CXXFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5'
+ac_compiler_gnu=$ac_cv_cxx_compiler_gnu
+if test -z "$CXX"; then
+ if test -n "$CCC"; then
+ CXX=$CCC
+ else
+ if test -n "$ac_tool_prefix"; then
+ for ac_prog in g++ c++ gpp aCC CC cxx cc++ cl.exe FCC KCC RCC xlC_r xlC
+ do
+ # Extract the first word of "$ac_tool_prefix$ac_prog", so it can be a program name with args.
+set dummy $ac_tool_prefix$ac_prog; ac_word=$2
+{ echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; }
+if test "${ac_cv_prog_CXX+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ if test -n "$CXX"; then
+ ac_cv_prog_CXX="$CXX" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then
+ ac_cv_prog_CXX="$ac_tool_prefix$ac_prog"
+ echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+ break 2
+ fi
+done
+done
+IFS=$as_save_IFS
+
+fi
+fi
+CXX=$ac_cv_prog_CXX
+if test -n "$CXX"; then
+ { echo "$as_me:$LINENO: result: $CXX" >&5
+echo "${ECHO_T}$CXX" >&6; }
+else
+ { echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6; }
+fi
+
+
+ test -n "$CXX" && break
+ done
+fi
+if test -z "$CXX"; then
+ ac_ct_CXX=$CXX
+ for ac_prog in g++ c++ gpp aCC CC cxx cc++ cl.exe FCC KCC RCC xlC_r xlC
+do
+ # Extract the first word of "$ac_prog", so it can be a program name with args.
+set dummy $ac_prog; ac_word=$2
+{ echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; }
+if test "${ac_cv_prog_ac_ct_CXX+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ if test -n "$ac_ct_CXX"; then
+ ac_cv_prog_ac_ct_CXX="$ac_ct_CXX" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then
+ ac_cv_prog_ac_ct_CXX="$ac_prog"
+ echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+ break 2
+ fi
+done
+done
+IFS=$as_save_IFS
+
+fi
+fi
+ac_ct_CXX=$ac_cv_prog_ac_ct_CXX
+if test -n "$ac_ct_CXX"; then
+ { echo "$as_me:$LINENO: result: $ac_ct_CXX" >&5
+echo "${ECHO_T}$ac_ct_CXX" >&6; }
+else
+ { echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6; }
+fi
+
+
+ test -n "$ac_ct_CXX" && break
+done
+
+ if test "x$ac_ct_CXX" = x; then
+ CXX="g++"
+ else
+ case $cross_compiling:$ac_tool_warned in
+yes:)
+{ echo "$as_me:$LINENO: WARNING: In the future, Autoconf will not detect cross-tools
+whose name does not start with the host triplet. If you think this
+configuration is useful to you, please write to autoconf@gnu.org." >&5
+echo "$as_me: WARNING: In the future, Autoconf will not detect cross-tools
+whose name does not start with the host triplet. If you think this
+configuration is useful to you, please write to autoconf@gnu.org." >&2;}
+ac_tool_warned=yes ;;
+esac
+ CXX=$ac_ct_CXX
+ fi
+fi
+
+ fi
+fi
+# Provide some information about the compiler.
+echo "$as_me:$LINENO: checking for C++ compiler version" >&5
+ac_compiler=`set X $ac_compile; echo $2`
+{ (ac_try="$ac_compiler --version >&5"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_compiler --version >&5") 2>&5
+ ac_status=$?
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); }
+{ (ac_try="$ac_compiler -v >&5"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_compiler -v >&5") 2>&5
+ ac_status=$?
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); }
+{ (ac_try="$ac_compiler -V >&5"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_compiler -V >&5") 2>&5
+ ac_status=$?
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); }
+
+{ echo "$as_me:$LINENO: checking whether we are using the GNU C++ compiler" >&5
+echo $ECHO_N "checking whether we are using the GNU C++ compiler... $ECHO_C" >&6; }
+if test "${ac_cv_cxx_compiler_gnu+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+
+int
+main ()
+{
+#ifndef __GNUC__
+ choke me
+#endif
+
+ ;
+ return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext
+if { (ac_try="$ac_compile"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_compile") 2>conftest.er1
+ ac_status=$?
+ grep -v '^ *+' conftest.er1 >conftest.err
+ rm -f conftest.er1
+ cat conftest.err >&5
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); } && {
+ test -z "$ac_cxx_werror_flag" ||
+ test ! -s conftest.err
+ } && test -s conftest.$ac_objext; then
+ ac_compiler_gnu=yes
+else
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ ac_compiler_gnu=no
+fi
+
+rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+ac_cv_cxx_compiler_gnu=$ac_compiler_gnu
+
+fi
+{ echo "$as_me:$LINENO: result: $ac_cv_cxx_compiler_gnu" >&5
+echo "${ECHO_T}$ac_cv_cxx_compiler_gnu" >&6; }
+GXX=`test $ac_compiler_gnu = yes && echo yes`
+ac_test_CXXFLAGS=${CXXFLAGS+set}
+ac_save_CXXFLAGS=$CXXFLAGS
+{ echo "$as_me:$LINENO: checking whether $CXX accepts -g" >&5
+echo $ECHO_N "checking whether $CXX accepts -g... $ECHO_C" >&6; }
+if test "${ac_cv_prog_cxx_g+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ ac_save_cxx_werror_flag=$ac_cxx_werror_flag
+ ac_cxx_werror_flag=yes
+ ac_cv_prog_cxx_g=no
+ CXXFLAGS="-g"
+ cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+
+int
+main ()
+{
+
+ ;
+ return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext
+if { (ac_try="$ac_compile"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_compile") 2>conftest.er1
+ ac_status=$?
+ grep -v '^ *+' conftest.er1 >conftest.err
+ rm -f conftest.er1
+ cat conftest.err >&5
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); } && {
+ test -z "$ac_cxx_werror_flag" ||
+ test ! -s conftest.err
+ } && test -s conftest.$ac_objext; then
+ ac_cv_prog_cxx_g=yes
+else
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ CXXFLAGS=""
+ cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+
+int
+main ()
+{
+
+ ;
+ return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext
+if { (ac_try="$ac_compile"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_compile") 2>conftest.er1
+ ac_status=$?
+ grep -v '^ *+' conftest.er1 >conftest.err
+ rm -f conftest.er1
+ cat conftest.err >&5
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); } && {
+ test -z "$ac_cxx_werror_flag" ||
+ test ! -s conftest.err
+ } && test -s conftest.$ac_objext; then
+ :
+else
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ ac_cxx_werror_flag=$ac_save_cxx_werror_flag
+ CXXFLAGS="-g"
+ cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+
+int
+main ()
+{
+
+ ;
+ return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext
+if { (ac_try="$ac_compile"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_compile") 2>conftest.er1
+ ac_status=$?
+ grep -v '^ *+' conftest.er1 >conftest.err
+ rm -f conftest.er1
+ cat conftest.err >&5
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); } && {
+ test -z "$ac_cxx_werror_flag" ||
+ test ! -s conftest.err
+ } && test -s conftest.$ac_objext; then
+ ac_cv_prog_cxx_g=yes
+else
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+
+fi
+
+rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+fi
+
+rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+fi
+
+rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+ ac_cxx_werror_flag=$ac_save_cxx_werror_flag
+fi
+{ echo "$as_me:$LINENO: result: $ac_cv_prog_cxx_g" >&5
+echo "${ECHO_T}$ac_cv_prog_cxx_g" >&6; }
+if test "$ac_test_CXXFLAGS" = set; then
+ CXXFLAGS=$ac_save_CXXFLAGS
+elif test $ac_cv_prog_cxx_g = yes; then
+ if test "$GXX" = yes; then
+ CXXFLAGS="-g -O2"
+ else
+ CXXFLAGS="-g"
+ fi
+else
+ if test "$GXX" = yes; then
+ CXXFLAGS="-O2"
+ else
+ CXXFLAGS=
+ fi
+fi
+ac_ext=c
+ac_cpp='$CPP $CPPFLAGS'
+ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5'
+ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5'
+ac_compiler_gnu=$ac_cv_c_compiler_gnu
+
+ac_aux_dir=
+for ac_dir in "$srcdir" "$srcdir/.." "$srcdir/../.."; do
+ if test -f "$ac_dir/install-sh"; then
+ ac_aux_dir=$ac_dir
+ ac_install_sh="$ac_aux_dir/install-sh -c"
+ break
+ elif test -f "$ac_dir/install.sh"; then
+ ac_aux_dir=$ac_dir
+ ac_install_sh="$ac_aux_dir/install.sh -c"
+ break
+ elif test -f "$ac_dir/shtool"; then
+ ac_aux_dir=$ac_dir
+ ac_install_sh="$ac_aux_dir/shtool install -c"
+ break
+ fi
+done
+if test -z "$ac_aux_dir"; then
+ { { echo "$as_me:$LINENO: error: cannot find install-sh or install.sh in \"$srcdir\" \"$srcdir/..\" \"$srcdir/../..\"" >&5
+echo "$as_me: error: cannot find install-sh or install.sh in \"$srcdir\" \"$srcdir/..\" \"$srcdir/../..\"" >&2;}
+ { (exit 1); exit 1; }; }
+fi
+
+# These three variables are undocumented and unsupported,
+# and are intended to be withdrawn in a future Autoconf release.
+# They can cause serious problems if a builder's source tree is in a directory
+# whose full name contains unusual characters.
+ac_config_guess="$SHELL $ac_aux_dir/config.guess" # Please don't use this var.
+ac_config_sub="$SHELL $ac_aux_dir/config.sub" # Please don't use this var.
+ac_configure="$SHELL $ac_aux_dir/configure" # Please don't use this var.
+
+
+# Find a good install program. We prefer a C program (faster),
+# so one script is as good as another. But avoid the broken or
+# incompatible versions:
+# SysV /etc/install, /usr/sbin/install
+# SunOS /usr/etc/install
+# IRIX /sbin/install
+# AIX /bin/install
+# AmigaOS /C/install, which installs bootblocks on floppy discs
+# AIX 4 /usr/bin/installbsd, which doesn't work without a -g flag
+# AFS /usr/afsws/bin/install, which mishandles nonexistent args
+# SVR4 /usr/ucb/install, which tries to use the nonexistent group "staff"
+# OS/2's system install, which has a completely different semantic
+# ./install, which can be erroneously created by make from ./install.sh.
+{ echo "$as_me:$LINENO: checking for a BSD-compatible install" >&5
+echo $ECHO_N "checking for a BSD-compatible install... $ECHO_C" >&6; }
+if test -z "$INSTALL"; then
+if test "${ac_cv_path_install+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ # Account for people who put trailing slashes in PATH elements.
+case $as_dir/ in
+ ./ | .// | /cC/* | \
+ /etc/* | /usr/sbin/* | /usr/etc/* | /sbin/* | /usr/afsws/bin/* | \
+ ?:\\/os2\\/install\\/* | ?:\\/OS2\\/INSTALL\\/* | \
+ /usr/ucb/* ) ;;
+ *)
+ # OSF1 and SCO ODT 3.0 have their own names for install.
+ # Don't use installbsd from OSF since it installs stuff as root
+ # by default.
+ for ac_prog in ginstall scoinst install; do
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ if { test -f "$as_dir/$ac_prog$ac_exec_ext" && $as_test_x "$as_dir/$ac_prog$ac_exec_ext"; }; then
+ if test $ac_prog = install &&
+ grep dspmsg "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then
+ # AIX install. It has an incompatible calling convention.
+ :
+ elif test $ac_prog = install &&
+ grep pwplus "$as_dir/$ac_prog$ac_exec_ext" >/dev/null 2>&1; then
+ # program-specific install script used by HP pwplus--don't use.
+ :
+ else
+ ac_cv_path_install="$as_dir/$ac_prog$ac_exec_ext -c"
+ break 3
+ fi
+ fi
+ done
+ done
+ ;;
+esac
+done
+IFS=$as_save_IFS
+
+
+fi
+ if test "${ac_cv_path_install+set}" = set; then
+ INSTALL=$ac_cv_path_install
+ else
+ # As a last resort, use the slow shell script. Don't cache a
+ # value for INSTALL within a source directory, because that will
+ # break other packages using the cache if that directory is
+ # removed, or if the value is a relative name.
+ INSTALL=$ac_install_sh
+ fi
+fi
+{ echo "$as_me:$LINENO: result: $INSTALL" >&5
+echo "${ECHO_T}$INSTALL" >&6; }
+
+# Use test -z because SunOS4 sh mishandles braces in ${var-val}.
+# It thinks the first close brace ends the variable substitution.
+test -z "$INSTALL_PROGRAM" && INSTALL_PROGRAM='${INSTALL}'
+
+test -z "$INSTALL_SCRIPT" && INSTALL_SCRIPT='${INSTALL}'
+
+test -z "$INSTALL_DATA" && INSTALL_DATA='${INSTALL} -m 644'
+
+if test "$INSTALL" = "$ac_install_sh"; then
+ # Use full path to install-sh script...
+ INSTALL="`pwd`/install-sh -c"
+fi
+if test -n "$ac_tool_prefix"; then
+ # Extract the first word of "${ac_tool_prefix}ranlib", so it can be a program name with args.
+set dummy ${ac_tool_prefix}ranlib; ac_word=$2
+{ echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; }
+if test "${ac_cv_prog_RANLIB+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ if test -n "$RANLIB"; then
+ ac_cv_prog_RANLIB="$RANLIB" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then
+ ac_cv_prog_RANLIB="${ac_tool_prefix}ranlib"
+ echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+ break 2
+ fi
+done
+done
+IFS=$as_save_IFS
+
+fi
+fi
+RANLIB=$ac_cv_prog_RANLIB
+if test -n "$RANLIB"; then
+ { echo "$as_me:$LINENO: result: $RANLIB" >&5
+echo "${ECHO_T}$RANLIB" >&6; }
+else
+ { echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6; }
+fi
+
+
+fi
+if test -z "$ac_cv_prog_RANLIB"; then
+ ac_ct_RANLIB=$RANLIB
+ # Extract the first word of "ranlib", so it can be a program name with args.
+set dummy ranlib; ac_word=$2
+{ echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; }
+if test "${ac_cv_prog_ac_ct_RANLIB+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ if test -n "$ac_ct_RANLIB"; then
+ ac_cv_prog_ac_ct_RANLIB="$ac_ct_RANLIB" # Let the user override the test.
+else
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then
+ ac_cv_prog_ac_ct_RANLIB="ranlib"
+ echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+ break 2
+ fi
+done
+done
+IFS=$as_save_IFS
+
+fi
+fi
+ac_ct_RANLIB=$ac_cv_prog_ac_ct_RANLIB
+if test -n "$ac_ct_RANLIB"; then
+ { echo "$as_me:$LINENO: result: $ac_ct_RANLIB" >&5
+echo "${ECHO_T}$ac_ct_RANLIB" >&6; }
+else
+ { echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6; }
+fi
+
+ if test "x$ac_ct_RANLIB" = x; then
+ RANLIB=":"
+ else
+ case $cross_compiling:$ac_tool_warned in
+yes:)
+{ echo "$as_me:$LINENO: WARNING: In the future, Autoconf will not detect cross-tools
+whose name does not start with the host triplet. If you think this
+configuration is useful to you, please write to autoconf@gnu.org." >&5
+echo "$as_me: WARNING: In the future, Autoconf will not detect cross-tools
+whose name does not start with the host triplet. If you think this
+configuration is useful to you, please write to autoconf@gnu.org." >&2;}
+ac_tool_warned=yes ;;
+esac
+ RANLIB=$ac_ct_RANLIB
+ fi
+else
+ RANLIB="$ac_cv_prog_RANLIB"
+fi
+
+# Extract the first word of "ar", so it can be a program name with args.
+set dummy ar; ac_word=$2
+{ echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; }
+if test "${ac_cv_path_AR+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ case $AR in
+ [\\/]* | ?:[\\/]*)
+ ac_cv_path_AR="$AR" # Let the user override the test with a path.
+ ;;
+ *)
+ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then
+ ac_cv_path_AR="$as_dir/$ac_word$ac_exec_ext"
+ echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+ break 2
+ fi
+done
+done
+IFS=$as_save_IFS
+
+ ;;
+esac
+fi
+AR=$ac_cv_path_AR
+if test -n "$AR"; then
+ { echo "$as_me:$LINENO: result: $AR" >&5
+echo "${ECHO_T}$AR" >&6; }
+else
+ { echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6; }
+fi
+
+
+# Extract the first word of "cp", so it can be a program name with args.
+set dummy cp; ac_word=$2
+{ echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; }
+if test "${ac_cv_path_CP+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ case $CP in
+ [\\/]* | ?:[\\/]*)
+ ac_cv_path_CP="$CP" # Let the user override the test with a path.
+ ;;
+ *)
+ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then
+ ac_cv_path_CP="$as_dir/$ac_word$ac_exec_ext"
+ echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+ break 2
+ fi
+done
+done
+IFS=$as_save_IFS
+
+ ;;
+esac
+fi
+CP=$ac_cv_path_CP
+if test -n "$CP"; then
+ { echo "$as_me:$LINENO: result: $CP" >&5
+echo "${ECHO_T}$CP" >&6; }
+else
+ { echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6; }
+fi
+
+
+# Extract the first word of "ln", so it can be a program name with args.
+set dummy ln; ac_word=$2
+{ echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; }
+if test "${ac_cv_path_LN+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ case $LN in
+ [\\/]* | ?:[\\/]*)
+ ac_cv_path_LN="$LN" # Let the user override the test with a path.
+ ;;
+ *)
+ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then
+ ac_cv_path_LN="$as_dir/$ac_word$ac_exec_ext"
+ echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+ break 2
+ fi
+done
+done
+IFS=$as_save_IFS
+
+ ;;
+esac
+fi
+LN=$ac_cv_path_LN
+if test -n "$LN"; then
+ { echo "$as_me:$LINENO: result: $LN" >&5
+echo "${ECHO_T}$LN" >&6; }
+else
+ { echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6; }
+fi
+
+
+# Extract the first word of "mkdir", so it can be a program name with args.
+set dummy mkdir; ac_word=$2
+{ echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; }
+if test "${ac_cv_path_MKDIR+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ case $MKDIR in
+ [\\/]* | ?:[\\/]*)
+ ac_cv_path_MKDIR="$MKDIR" # Let the user override the test with a path.
+ ;;
+ *)
+ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then
+ ac_cv_path_MKDIR="$as_dir/$ac_word$ac_exec_ext"
+ echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+ break 2
+ fi
+done
+done
+IFS=$as_save_IFS
+
+ ;;
+esac
+fi
+MKDIR=$ac_cv_path_MKDIR
+if test -n "$MKDIR"; then
+ { echo "$as_me:$LINENO: result: $MKDIR" >&5
+echo "${ECHO_T}$MKDIR" >&6; }
+else
+ { echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6; }
+fi
+
+
+# Extract the first word of "rm", so it can be a program name with args.
+set dummy rm; ac_word=$2
+{ echo "$as_me:$LINENO: checking for $ac_word" >&5
+echo $ECHO_N "checking for $ac_word... $ECHO_C" >&6; }
+if test "${ac_cv_path_RM+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ case $RM in
+ [\\/]* | ?:[\\/]*)
+ ac_cv_path_RM="$RM" # Let the user override the test with a path.
+ ;;
+ *)
+ as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ if { test -f "$as_dir/$ac_word$ac_exec_ext" && $as_test_x "$as_dir/$ac_word$ac_exec_ext"; }; then
+ ac_cv_path_RM="$as_dir/$ac_word$ac_exec_ext"
+ echo "$as_me:$LINENO: found $as_dir/$ac_word$ac_exec_ext" >&5
+ break 2
+ fi
+done
+done
+IFS=$as_save_IFS
+
+ ;;
+esac
+fi
+RM=$ac_cv_path_RM
+if test -n "$RM"; then
+ { echo "$as_me:$LINENO: result: $RM" >&5
+echo "${ECHO_T}$RM" >&6; }
+else
+ { echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6; }
+fi
+
+
+
+case "$uname" in
+ Darwin* | *BSD*)
+ ARFLAGS="-rcv"
+ ;;
+ *)
+ ARFLAGS="crvs"
+ ;;
+esac
+
+
+
+
+{ echo "$as_me:$LINENO: checking for inline" >&5
+echo $ECHO_N "checking for inline... $ECHO_C" >&6; }
+if test "${ac_cv_c_inline+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ ac_cv_c_inline=no
+for ac_kw in inline __inline__ __inline; do
+ cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+#ifndef __cplusplus
+typedef int foo_t;
+static $ac_kw foo_t static_foo () {return 0; }
+$ac_kw foo_t foo () {return 0; }
+#endif
+
+_ACEOF
+rm -f conftest.$ac_objext
+if { (ac_try="$ac_compile"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_compile") 2>conftest.er1
+ ac_status=$?
+ grep -v '^ *+' conftest.er1 >conftest.err
+ rm -f conftest.er1
+ cat conftest.err >&5
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); } && {
+ test -z "$ac_c_werror_flag" ||
+ test ! -s conftest.err
+ } && test -s conftest.$ac_objext; then
+ ac_cv_c_inline=$ac_kw
+else
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+
+fi
+
+rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+ test "$ac_cv_c_inline" != no && break
+done
+
+fi
+{ echo "$as_me:$LINENO: result: $ac_cv_c_inline" >&5
+echo "${ECHO_T}$ac_cv_c_inline" >&6; }
+
+
+case $ac_cv_c_inline in
+ inline | yes) ;;
+ *)
+ case $ac_cv_c_inline in
+ no) ac_val=;;
+ *) ac_val=$ac_cv_c_inline;;
+ esac
+ cat >>confdefs.h <<_ACEOF
+#ifndef __cplusplus
+#define inline $ac_val
+#endif
+_ACEOF
+ ;;
+esac
+
+
+if test "x$use_ansi" != xyes; then
+
+for ac_func in strdup
+do
+as_ac_var=`echo "ac_cv_func_$ac_func" | $as_tr_sh`
+{ echo "$as_me:$LINENO: checking for $ac_func" >&5
+echo $ECHO_N "checking for $ac_func... $ECHO_C" >&6; }
+if { as_var=$as_ac_var; eval "test \"\${$as_var+set}\" = set"; }; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+/* Define $ac_func to an innocuous variant, in case <limits.h> declares $ac_func.
+ For example, HP-UX 11i <limits.h> declares gettimeofday. */
+#define $ac_func innocuous_$ac_func
+
+/* System header to define __stub macros and hopefully few prototypes,
+ which can conflict with char $ac_func (); below.
+ Prefer <limits.h> to <assert.h> if __STDC__ is defined, since
+ <limits.h> exists even on freestanding compilers. */
+
+#ifdef __STDC__
+# include <limits.h>
+#else
+# include <assert.h>
+#endif
+
+#undef $ac_func
+
+/* Override any GCC internal prototype to avoid an error.
+ Use char because int might match the return type of a GCC
+ builtin and then its argument prototype would still apply. */
+#ifdef __cplusplus
+extern "C"
+#endif
+char $ac_func ();
+/* The GNU C library defines this for functions which it implements
+ to always fail with ENOSYS. Some functions are actually named
+ something starting with __ and the normal name is an alias. */
+#if defined __stub_$ac_func || defined __stub___$ac_func
+choke me
+#endif
+
+int
+main ()
+{
+return $ac_func ();
+ ;
+ return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext conftest$ac_exeext
+if { (ac_try="$ac_link"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_link") 2>conftest.er1
+ ac_status=$?
+ grep -v '^ *+' conftest.er1 >conftest.err
+ rm -f conftest.er1
+ cat conftest.err >&5
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); } && {
+ test -z "$ac_c_werror_flag" ||
+ test ! -s conftest.err
+ } && test -s conftest$ac_exeext &&
+ $as_test_x conftest$ac_exeext; then
+ eval "$as_ac_var=yes"
+else
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ eval "$as_ac_var=no"
+fi
+
+rm -f core conftest.err conftest.$ac_objext conftest_ipa8_conftest.oo \
+ conftest$ac_exeext conftest.$ac_ext
+fi
+ac_res=`eval echo '${'$as_ac_var'}'`
+ { echo "$as_me:$LINENO: result: $ac_res" >&5
+echo "${ECHO_T}$ac_res" >&6; }
+if test `eval echo '${'$as_ac_var'}'` = yes; then
+ cat >>confdefs.h <<_ACEOF
+#define `echo "HAVE_$ac_func" | $as_tr_cpp` 1
+_ACEOF
+
+fi
+done
+
+fi
+
+if test "x$use_vsnprintf" != xyes; then
+
+
+for ac_func in snprintf vsnprintf
+do
+as_ac_var=`echo "ac_cv_func_$ac_func" | $as_tr_sh`
+{ echo "$as_me:$LINENO: checking for $ac_func" >&5
+echo $ECHO_N "checking for $ac_func... $ECHO_C" >&6; }
+if { as_var=$as_ac_var; eval "test \"\${$as_var+set}\" = set"; }; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+/* Define $ac_func to an innocuous variant, in case <limits.h> declares $ac_func.
+ For example, HP-UX 11i <limits.h> declares gettimeofday. */
+#define $ac_func innocuous_$ac_func
+
+/* System header to define __stub macros and hopefully few prototypes,
+ which can conflict with char $ac_func (); below.
+ Prefer <limits.h> to <assert.h> if __STDC__ is defined, since
+ <limits.h> exists even on freestanding compilers. */
+
+#ifdef __STDC__
+# include <limits.h>
+#else
+# include <assert.h>
+#endif
+
+#undef $ac_func
+
+/* Override any GCC internal prototype to avoid an error.
+ Use char because int might match the return type of a GCC
+ builtin and then its argument prototype would still apply. */
+#ifdef __cplusplus
+extern "C"
+#endif
+char $ac_func ();
+/* The GNU C library defines this for functions which it implements
+ to always fail with ENOSYS. Some functions are actually named
+ something starting with __ and the normal name is an alias. */
+#if defined __stub_$ac_func || defined __stub___$ac_func
+choke me
+#endif
+
+int
+main ()
+{
+return $ac_func ();
+ ;
+ return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext conftest$ac_exeext
+if { (ac_try="$ac_link"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_link") 2>conftest.er1
+ ac_status=$?
+ grep -v '^ *+' conftest.er1 >conftest.err
+ rm -f conftest.er1
+ cat conftest.err >&5
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); } && {
+ test -z "$ac_c_werror_flag" ||
+ test ! -s conftest.err
+ } && test -s conftest$ac_exeext &&
+ $as_test_x conftest$ac_exeext; then
+ eval "$as_ac_var=yes"
+else
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ eval "$as_ac_var=no"
+fi
+
+rm -f core conftest.err conftest.$ac_objext conftest_ipa8_conftest.oo \
+ conftest$ac_exeext conftest.$ac_ext
+fi
+ac_res=`eval echo '${'$as_ac_var'}'`
+ { echo "$as_me:$LINENO: result: $ac_res" >&5
+echo "${ECHO_T}$ac_res" >&6; }
+if test `eval echo '${'$as_ac_var'}'` = yes; then
+ cat >>confdefs.h <<_ACEOF
+#define `echo "HAVE_$ac_func" | $as_tr_cpp` 1
+_ACEOF
+
+fi
+done
+
+fi
+
+{ echo "$as_me:$LINENO: checking for long long int" >&5
+echo $ECHO_N "checking for long long int... $ECHO_C" >&6; }
+if test "${ac_cv_c_long_long+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ if test "$GCC" = yes; then
+ ac_cv_c_long_long=yes
+ else
+ cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+
+int
+main ()
+{
+long long int i;
+ ;
+ return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext
+if { (ac_try="$ac_compile"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_compile") 2>conftest.er1
+ ac_status=$?
+ grep -v '^ *+' conftest.er1 >conftest.err
+ rm -f conftest.er1
+ cat conftest.err >&5
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); } && {
+ test -z "$ac_c_werror_flag" ||
+ test ! -s conftest.err
+ } && test -s conftest.$ac_objext; then
+ ac_cv_c_long_long=yes
+else
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ ac_cv_c_long_long=no
+fi
+
+rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+ fi
+fi
+{ echo "$as_me:$LINENO: result: $ac_cv_c_long_long" >&5
+echo "${ECHO_T}$ac_cv_c_long_long" >&6; }
+
+if test $ac_cv_c_long_long = yes; then
+ cat >>confdefs.h <<\_ACEOF
+#define HAVE_LONG_LONG 1
+_ACEOF
+
+fi
+
+# Check whether --enable-threads was given.
+if test "${enable_threads+set}" = set; then
+ enableval=$enable_threads;
+fi
+
+
+have_pthread=no
+PTHREAD_FLAGS=""
+PTHREAD_LIBS=""
+
+if test "x$enable_threads" != xno; then
+ ac_ext=c
+ac_cpp='$CPP $CPPFLAGS'
+ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5'
+ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5'
+ac_compiler_gnu=$ac_cv_c_compiler_gnu
+{ echo "$as_me:$LINENO: checking how to run the C preprocessor" >&5
+echo $ECHO_N "checking how to run the C preprocessor... $ECHO_C" >&6; }
+# On Suns, sometimes $CPP names a directory.
+if test -n "$CPP" && test -d "$CPP"; then
+ CPP=
+fi
+if test -z "$CPP"; then
+ if test "${ac_cv_prog_CPP+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ # Double quotes because CPP needs to be expanded
+ for CPP in "$CC -E" "$CC -E -traditional-cpp" "/lib/cpp"
+ do
+ ac_preproc_ok=false
+for ac_c_preproc_warn_flag in '' yes
+do
+ # Use a header file that comes with gcc, so configuring glibc
+ # with a fresh cross-compiler works.
+ # Prefer <limits.h> to <assert.h> if __STDC__ is defined, since
+ # <limits.h> exists even on freestanding compilers.
+ # On the NeXT, cc -E runs the code through the compiler's parser,
+ # not just through cpp. "Syntax error" is here to catch this case.
+ cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+#ifdef __STDC__
+# include <limits.h>
+#else
+# include <assert.h>
+#endif
+ Syntax error
+_ACEOF
+if { (ac_try="$ac_cpp conftest.$ac_ext"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_cpp conftest.$ac_ext") 2>conftest.er1
+ ac_status=$?
+ grep -v '^ *+' conftest.er1 >conftest.err
+ rm -f conftest.er1
+ cat conftest.err >&5
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); } >/dev/null && {
+ test -z "$ac_c_preproc_warn_flag$ac_c_werror_flag" ||
+ test ! -s conftest.err
+ }; then
+ :
+else
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ # Broken: fails on valid input.
+continue
+fi
+
+rm -f conftest.err conftest.$ac_ext
+
+ # OK, works on sane cases. Now check whether nonexistent headers
+ # can be detected and how.
+ cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+#include <ac_nonexistent.h>
+_ACEOF
+if { (ac_try="$ac_cpp conftest.$ac_ext"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_cpp conftest.$ac_ext") 2>conftest.er1
+ ac_status=$?
+ grep -v '^ *+' conftest.er1 >conftest.err
+ rm -f conftest.er1
+ cat conftest.err >&5
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); } >/dev/null && {
+ test -z "$ac_c_preproc_warn_flag$ac_c_werror_flag" ||
+ test ! -s conftest.err
+ }; then
+ # Broken: success on invalid input.
+continue
+else
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ # Passes both tests.
+ac_preproc_ok=:
+break
+fi
+
+rm -f conftest.err conftest.$ac_ext
+
+done
+# Because of `break', _AC_PREPROC_IFELSE's cleaning code was skipped.
+rm -f conftest.err conftest.$ac_ext
+if $ac_preproc_ok; then
+ break
+fi
+
+ done
+ ac_cv_prog_CPP=$CPP
+
+fi
+ CPP=$ac_cv_prog_CPP
+else
+ ac_cv_prog_CPP=$CPP
+fi
+{ echo "$as_me:$LINENO: result: $CPP" >&5
+echo "${ECHO_T}$CPP" >&6; }
+ac_preproc_ok=false
+for ac_c_preproc_warn_flag in '' yes
+do
+ # Use a header file that comes with gcc, so configuring glibc
+ # with a fresh cross-compiler works.
+ # Prefer <limits.h> to <assert.h> if __STDC__ is defined, since
+ # <limits.h> exists even on freestanding compilers.
+ # On the NeXT, cc -E runs the code through the compiler's parser,
+ # not just through cpp. "Syntax error" is here to catch this case.
+ cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+#ifdef __STDC__
+# include <limits.h>
+#else
+# include <assert.h>
+#endif
+ Syntax error
+_ACEOF
+if { (ac_try="$ac_cpp conftest.$ac_ext"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_cpp conftest.$ac_ext") 2>conftest.er1
+ ac_status=$?
+ grep -v '^ *+' conftest.er1 >conftest.err
+ rm -f conftest.er1
+ cat conftest.err >&5
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); } >/dev/null && {
+ test -z "$ac_c_preproc_warn_flag$ac_c_werror_flag" ||
+ test ! -s conftest.err
+ }; then
+ :
+else
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ # Broken: fails on valid input.
+continue
+fi
+
+rm -f conftest.err conftest.$ac_ext
+
+ # OK, works on sane cases. Now check whether nonexistent headers
+ # can be detected and how.
+ cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+#include <ac_nonexistent.h>
+_ACEOF
+if { (ac_try="$ac_cpp conftest.$ac_ext"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_cpp conftest.$ac_ext") 2>conftest.er1
+ ac_status=$?
+ grep -v '^ *+' conftest.er1 >conftest.err
+ rm -f conftest.er1
+ cat conftest.err >&5
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); } >/dev/null && {
+ test -z "$ac_c_preproc_warn_flag$ac_c_werror_flag" ||
+ test ! -s conftest.err
+ }; then
+ # Broken: success on invalid input.
+continue
+else
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ # Passes both tests.
+ac_preproc_ok=:
+break
+fi
+
+rm -f conftest.err conftest.$ac_ext
+
+done
+# Because of `break', _AC_PREPROC_IFELSE's cleaning code was skipped.
+rm -f conftest.err conftest.$ac_ext
+if $ac_preproc_ok; then
+ :
+else
+ { { echo "$as_me:$LINENO: error: C preprocessor \"$CPP\" fails sanity check
+See \`config.log' for more details." >&5
+echo "$as_me: error: C preprocessor \"$CPP\" fails sanity check
+See \`config.log' for more details." >&2;}
+ { (exit 1); exit 1; }; }
+fi
+
+ac_ext=c
+ac_cpp='$CPP $CPPFLAGS'
+ac_compile='$CC -c $CFLAGS $CPPFLAGS conftest.$ac_ext >&5'
+ac_link='$CC -o conftest$ac_exeext $CFLAGS $CPPFLAGS $LDFLAGS conftest.$ac_ext $LIBS >&5'
+ac_compiler_gnu=$ac_cv_c_compiler_gnu
+
+
+{ echo "$as_me:$LINENO: checking for grep that handles long lines and -e" >&5
+echo $ECHO_N "checking for grep that handles long lines and -e... $ECHO_C" >&6; }
+if test "${ac_cv_path_GREP+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ # Extract the first word of "grep ggrep" to use in msg output
+if test -z "$GREP"; then
+set dummy grep ggrep; ac_prog_name=$2
+if test "${ac_cv_path_GREP+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ ac_path_GREP_found=false
+# Loop through the user's path and test for each of PROGNAME-LIST
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH$PATH_SEPARATOR/usr/xpg4/bin
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ for ac_prog in grep ggrep; do
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ ac_path_GREP="$as_dir/$ac_prog$ac_exec_ext"
+ { test -f "$ac_path_GREP" && $as_test_x "$ac_path_GREP"; } || continue
+ # Check for GNU ac_path_GREP and select it if it is found.
+ # Check for GNU $ac_path_GREP
+case `"$ac_path_GREP" --version 2>&1` in
+*GNU*)
+ ac_cv_path_GREP="$ac_path_GREP" ac_path_GREP_found=:;;
+*)
+ ac_count=0
+ echo $ECHO_N "0123456789$ECHO_C" >"conftest.in"
+ while :
+ do
+ cat "conftest.in" "conftest.in" >"conftest.tmp"
+ mv "conftest.tmp" "conftest.in"
+ cp "conftest.in" "conftest.nl"
+ echo 'GREP' >> "conftest.nl"
+ "$ac_path_GREP" -e 'GREP$' -e '-(cannot match)-' < "conftest.nl" >"conftest.out" 2>/dev/null || break
+ diff "conftest.out" "conftest.nl" >/dev/null 2>&1 || break
+ ac_count=`expr $ac_count + 1`
+ if test $ac_count -gt ${ac_path_GREP_max-0}; then
+ # Best one so far, save it but keep looking for a better one
+ ac_cv_path_GREP="$ac_path_GREP"
+ ac_path_GREP_max=$ac_count
+ fi
+ # 10*(2^10) chars as input seems more than enough
+ test $ac_count -gt 10 && break
+ done
+ rm -f conftest.in conftest.tmp conftest.nl conftest.out;;
+esac
+
+
+ $ac_path_GREP_found && break 3
+ done
+done
+
+done
+IFS=$as_save_IFS
+
+
+fi
+
+GREP="$ac_cv_path_GREP"
+if test -z "$GREP"; then
+ { { echo "$as_me:$LINENO: error: no acceptable $ac_prog_name could be found in $PATH$PATH_SEPARATOR/usr/xpg4/bin" >&5
+echo "$as_me: error: no acceptable $ac_prog_name could be found in $PATH$PATH_SEPARATOR/usr/xpg4/bin" >&2;}
+ { (exit 1); exit 1; }; }
+fi
+
+else
+ ac_cv_path_GREP=$GREP
+fi
+
+
+fi
+{ echo "$as_me:$LINENO: result: $ac_cv_path_GREP" >&5
+echo "${ECHO_T}$ac_cv_path_GREP" >&6; }
+ GREP="$ac_cv_path_GREP"
+
+
+{ echo "$as_me:$LINENO: checking for egrep" >&5
+echo $ECHO_N "checking for egrep... $ECHO_C" >&6; }
+if test "${ac_cv_path_EGREP+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ if echo a | $GREP -E '(a|b)' >/dev/null 2>&1
+ then ac_cv_path_EGREP="$GREP -E"
+ else
+ # Extract the first word of "egrep" to use in msg output
+if test -z "$EGREP"; then
+set dummy egrep; ac_prog_name=$2
+if test "${ac_cv_path_EGREP+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ ac_path_EGREP_found=false
+# Loop through the user's path and test for each of PROGNAME-LIST
+as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH$PATH_SEPARATOR/usr/xpg4/bin
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ for ac_prog in egrep; do
+ for ac_exec_ext in '' $ac_executable_extensions; do
+ ac_path_EGREP="$as_dir/$ac_prog$ac_exec_ext"
+ { test -f "$ac_path_EGREP" && $as_test_x "$ac_path_EGREP"; } || continue
+ # Check for GNU ac_path_EGREP and select it if it is found.
+ # Check for GNU $ac_path_EGREP
+case `"$ac_path_EGREP" --version 2>&1` in
+*GNU*)
+ ac_cv_path_EGREP="$ac_path_EGREP" ac_path_EGREP_found=:;;
+*)
+ ac_count=0
+ echo $ECHO_N "0123456789$ECHO_C" >"conftest.in"
+ while :
+ do
+ cat "conftest.in" "conftest.in" >"conftest.tmp"
+ mv "conftest.tmp" "conftest.in"
+ cp "conftest.in" "conftest.nl"
+ echo 'EGREP' >> "conftest.nl"
+ "$ac_path_EGREP" 'EGREP$' < "conftest.nl" >"conftest.out" 2>/dev/null || break
+ diff "conftest.out" "conftest.nl" >/dev/null 2>&1 || break
+ ac_count=`expr $ac_count + 1`
+ if test $ac_count -gt ${ac_path_EGREP_max-0}; then
+ # Best one so far, save it but keep looking for a better one
+ ac_cv_path_EGREP="$ac_path_EGREP"
+ ac_path_EGREP_max=$ac_count
+ fi
+ # 10*(2^10) chars as input seems more than enough
+ test $ac_count -gt 10 && break
+ done
+ rm -f conftest.in conftest.tmp conftest.nl conftest.out;;
+esac
+
+
+ $ac_path_EGREP_found && break 3
+ done
+done
+
+done
+IFS=$as_save_IFS
+
+
+fi
+
+EGREP="$ac_cv_path_EGREP"
+if test -z "$EGREP"; then
+ { { echo "$as_me:$LINENO: error: no acceptable $ac_prog_name could be found in $PATH$PATH_SEPARATOR/usr/xpg4/bin" >&5
+echo "$as_me: error: no acceptable $ac_prog_name could be found in $PATH$PATH_SEPARATOR/usr/xpg4/bin" >&2;}
+ { (exit 1); exit 1; }; }
+fi
+
+else
+ ac_cv_path_EGREP=$EGREP
+fi
+
+
+ fi
+fi
+{ echo "$as_me:$LINENO: result: $ac_cv_path_EGREP" >&5
+echo "${ECHO_T}$ac_cv_path_EGREP" >&6; }
+ EGREP="$ac_cv_path_EGREP"
+
+
+{ echo "$as_me:$LINENO: checking for ANSI C header files" >&5
+echo $ECHO_N "checking for ANSI C header files... $ECHO_C" >&6; }
+if test "${ac_cv_header_stdc+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+#include <stdlib.h>
+#include <stdarg.h>
+#include <string.h>
+#include <float.h>
+
+int
+main ()
+{
+
+ ;
+ return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext
+if { (ac_try="$ac_compile"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_compile") 2>conftest.er1
+ ac_status=$?
+ grep -v '^ *+' conftest.er1 >conftest.err
+ rm -f conftest.er1
+ cat conftest.err >&5
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); } && {
+ test -z "$ac_c_werror_flag" ||
+ test ! -s conftest.err
+ } && test -s conftest.$ac_objext; then
+ ac_cv_header_stdc=yes
+else
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ ac_cv_header_stdc=no
+fi
+
+rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+
+if test $ac_cv_header_stdc = yes; then
+ # SunOS 4.x string.h does not declare mem*, contrary to ANSI.
+ cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+#include <string.h>
+
+_ACEOF
+if (eval "$ac_cpp conftest.$ac_ext") 2>&5 |
+ $EGREP "memchr" >/dev/null 2>&1; then
+ :
+else
+ ac_cv_header_stdc=no
+fi
+rm -f conftest*
+
+fi
+
+if test $ac_cv_header_stdc = yes; then
+ # ISC 2.0.2 stdlib.h does not declare free, contrary to ANSI.
+ cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+#include <stdlib.h>
+
+_ACEOF
+if (eval "$ac_cpp conftest.$ac_ext") 2>&5 |
+ $EGREP "free" >/dev/null 2>&1; then
+ :
+else
+ ac_cv_header_stdc=no
+fi
+rm -f conftest*
+
+fi
+
+if test $ac_cv_header_stdc = yes; then
+ # /bin/cc in Irix-4.0.5 gets non-ANSI ctype macros unless using -ansi.
+ if test "$cross_compiling" = yes; then
+ :
+else
+ cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+#include <ctype.h>
+#include <stdlib.h>
+#if ((' ' & 0x0FF) == 0x020)
+# define ISLOWER(c) ('a' <= (c) && (c) <= 'z')
+# define TOUPPER(c) (ISLOWER(c) ? 'A' + ((c) - 'a') : (c))
+#else
+# define ISLOWER(c) \
+ (('a' <= (c) && (c) <= 'i') \
+ || ('j' <= (c) && (c) <= 'r') \
+ || ('s' <= (c) && (c) <= 'z'))
+# define TOUPPER(c) (ISLOWER(c) ? ((c) | 0x40) : (c))
+#endif
+
+#define XOR(e, f) (((e) && !(f)) || (!(e) && (f)))
+int
+main ()
+{
+ int i;
+ for (i = 0; i < 256; i++)
+ if (XOR (islower (i), ISLOWER (i))
+ || toupper (i) != TOUPPER (i))
+ return 2;
+ return 0;
+}
+_ACEOF
+rm -f conftest$ac_exeext
+if { (ac_try="$ac_link"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_link") 2>&5
+ ac_status=$?
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); } && { ac_try='./conftest$ac_exeext'
+ { (case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_try") 2>&5
+ ac_status=$?
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); }; }; then
+ :
+else
+ echo "$as_me: program exited with status $ac_status" >&5
+echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+( exit $ac_status )
+ac_cv_header_stdc=no
+fi
+rm -f core *.core core.conftest.* gmon.out bb.out conftest$ac_exeext conftest.$ac_objext conftest.$ac_ext
+fi
+
+
+fi
+fi
+{ echo "$as_me:$LINENO: result: $ac_cv_header_stdc" >&5
+echo "${ECHO_T}$ac_cv_header_stdc" >&6; }
+if test $ac_cv_header_stdc = yes; then
+
+cat >>confdefs.h <<\_ACEOF
+#define STDC_HEADERS 1
+_ACEOF
+
+fi
+
+# On IRIX 5.3, sys/types and inttypes.h are conflicting.
+
+
+
+
+
+
+
+
+
+for ac_header in sys/types.h sys/stat.h stdlib.h string.h memory.h strings.h \
+ inttypes.h stdint.h unistd.h
+do
+as_ac_Header=`echo "ac_cv_header_$ac_header" | $as_tr_sh`
+{ echo "$as_me:$LINENO: checking for $ac_header" >&5
+echo $ECHO_N "checking for $ac_header... $ECHO_C" >&6; }
+if { as_var=$as_ac_Header; eval "test \"\${$as_var+set}\" = set"; }; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+$ac_includes_default
+
+#include <$ac_header>
+_ACEOF
+rm -f conftest.$ac_objext
+if { (ac_try="$ac_compile"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_compile") 2>conftest.er1
+ ac_status=$?
+ grep -v '^ *+' conftest.er1 >conftest.err
+ rm -f conftest.er1
+ cat conftest.err >&5
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); } && {
+ test -z "$ac_c_werror_flag" ||
+ test ! -s conftest.err
+ } && test -s conftest.$ac_objext; then
+ eval "$as_ac_Header=yes"
+else
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ eval "$as_ac_Header=no"
+fi
+
+rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+fi
+ac_res=`eval echo '${'$as_ac_Header'}'`
+ { echo "$as_me:$LINENO: result: $ac_res" >&5
+echo "${ECHO_T}$ac_res" >&6; }
+if test `eval echo '${'$as_ac_Header'}'` = yes; then
+ cat >>confdefs.h <<_ACEOF
+#define `echo "HAVE_$ac_header" | $as_tr_cpp` 1
+_ACEOF
+
+fi
+
+done
+
+
+if test "${ac_cv_header_pthread_h+set}" = set; then
+ { echo "$as_me:$LINENO: checking for pthread.h" >&5
+echo $ECHO_N "checking for pthread.h... $ECHO_C" >&6; }
+if test "${ac_cv_header_pthread_h+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+fi
+{ echo "$as_me:$LINENO: result: $ac_cv_header_pthread_h" >&5
+echo "${ECHO_T}$ac_cv_header_pthread_h" >&6; }
+else
+ # Is the header compilable?
+{ echo "$as_me:$LINENO: checking pthread.h usability" >&5
+echo $ECHO_N "checking pthread.h usability... $ECHO_C" >&6; }
+cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+$ac_includes_default
+#include <pthread.h>
+_ACEOF
+rm -f conftest.$ac_objext
+if { (ac_try="$ac_compile"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_compile") 2>conftest.er1
+ ac_status=$?
+ grep -v '^ *+' conftest.er1 >conftest.err
+ rm -f conftest.er1
+ cat conftest.err >&5
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); } && {
+ test -z "$ac_c_werror_flag" ||
+ test ! -s conftest.err
+ } && test -s conftest.$ac_objext; then
+ ac_header_compiler=yes
+else
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ ac_header_compiler=no
+fi
+
+rm -f core conftest.err conftest.$ac_objext conftest.$ac_ext
+{ echo "$as_me:$LINENO: result: $ac_header_compiler" >&5
+echo "${ECHO_T}$ac_header_compiler" >&6; }
+
+# Is the header present?
+{ echo "$as_me:$LINENO: checking pthread.h presence" >&5
+echo $ECHO_N "checking pthread.h presence... $ECHO_C" >&6; }
+cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+#include <pthread.h>
+_ACEOF
+if { (ac_try="$ac_cpp conftest.$ac_ext"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_cpp conftest.$ac_ext") 2>conftest.er1
+ ac_status=$?
+ grep -v '^ *+' conftest.er1 >conftest.err
+ rm -f conftest.er1
+ cat conftest.err >&5
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); } >/dev/null && {
+ test -z "$ac_c_preproc_warn_flag$ac_c_werror_flag" ||
+ test ! -s conftest.err
+ }; then
+ ac_header_preproc=yes
+else
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+ ac_header_preproc=no
+fi
+
+rm -f conftest.err conftest.$ac_ext
+{ echo "$as_me:$LINENO: result: $ac_header_preproc" >&5
+echo "${ECHO_T}$ac_header_preproc" >&6; }
+
+# So? What about this header?
+case $ac_header_compiler:$ac_header_preproc:$ac_c_preproc_warn_flag in
+ yes:no: )
+ { echo "$as_me:$LINENO: WARNING: pthread.h: accepted by the compiler, rejected by the preprocessor!" >&5
+echo "$as_me: WARNING: pthread.h: accepted by the compiler, rejected by the preprocessor!" >&2;}
+ { echo "$as_me:$LINENO: WARNING: pthread.h: proceeding with the compiler's result" >&5
+echo "$as_me: WARNING: pthread.h: proceeding with the compiler's result" >&2;}
+ ac_header_preproc=yes
+ ;;
+ no:yes:* )
+ { echo "$as_me:$LINENO: WARNING: pthread.h: present but cannot be compiled" >&5
+echo "$as_me: WARNING: pthread.h: present but cannot be compiled" >&2;}
+ { echo "$as_me:$LINENO: WARNING: pthread.h: check for missing prerequisite headers?" >&5
+echo "$as_me: WARNING: pthread.h: check for missing prerequisite headers?" >&2;}
+ { echo "$as_me:$LINENO: WARNING: pthread.h: see the Autoconf documentation" >&5
+echo "$as_me: WARNING: pthread.h: see the Autoconf documentation" >&2;}
+ { echo "$as_me:$LINENO: WARNING: pthread.h: section \"Present But Cannot Be Compiled\"" >&5
+echo "$as_me: WARNING: pthread.h: section \"Present But Cannot Be Compiled\"" >&2;}
+ { echo "$as_me:$LINENO: WARNING: pthread.h: proceeding with the preprocessor's result" >&5
+echo "$as_me: WARNING: pthread.h: proceeding with the preprocessor's result" >&2;}
+ { echo "$as_me:$LINENO: WARNING: pthread.h: in the future, the compiler will take precedence" >&5
+echo "$as_me: WARNING: pthread.h: in the future, the compiler will take precedence" >&2;}
+
+ ;;
+esac
+{ echo "$as_me:$LINENO: checking for pthread.h" >&5
+echo $ECHO_N "checking for pthread.h... $ECHO_C" >&6; }
+if test "${ac_cv_header_pthread_h+set}" = set; then
+ echo $ECHO_N "(cached) $ECHO_C" >&6
+else
+ ac_cv_header_pthread_h=$ac_header_preproc
+fi
+{ echo "$as_me:$LINENO: result: $ac_cv_header_pthread_h" >&5
+echo "${ECHO_T}$ac_cv_header_pthread_h" >&6; }
+
+fi
+if test $ac_cv_header_pthread_h = yes; then
+ cat >>confdefs.h <<\_ACEOF
+#define HAVE_PTHREAD_H 1
+_ACEOF
+
+fi
+
+
+
+ if test x$ac_cv_header_pthread_h = xyes; then
+ for flag in -lpthreads -lpthread -pthread; do
+ { echo "$as_me:$LINENO: checking for pthread_create using $flag" >&5
+echo $ECHO_N "checking for pthread_create using $flag... $ECHO_C" >&6; }
+ SAVELIBS="$LIBS"
+ LIBS="$flag $LIBS"
+ cat >conftest.$ac_ext <<_ACEOF
+/* confdefs.h. */
+_ACEOF
+cat confdefs.h >>conftest.$ac_ext
+cat >>conftest.$ac_ext <<_ACEOF
+/* end confdefs.h. */
+#include <pthread.h>
+int
+main ()
+{
+pthread_create(0, 0, 0, 0);
+ ;
+ return 0;
+}
+_ACEOF
+rm -f conftest.$ac_objext conftest$ac_exeext
+if { (ac_try="$ac_link"
+case "(($ac_try" in
+ *\"* | *\`* | *\\*) ac_try_echo=\$ac_try;;
+ *) ac_try_echo=$ac_try;;
+esac
+eval "echo \"\$as_me:$LINENO: $ac_try_echo\"") >&5
+ (eval "$ac_link") 2>conftest.er1
+ ac_status=$?
+ grep -v '^ *+' conftest.er1 >conftest.err
+ rm -f conftest.er1
+ cat conftest.err >&5
+ echo "$as_me:$LINENO: \$? = $ac_status" >&5
+ (exit $ac_status); } && {
+ test -z "$ac_c_werror_flag" ||
+ test ! -s conftest.err
+ } && test -s conftest$ac_exeext &&
+ $as_test_x conftest$ac_exeext; then
+ have_pthread=yes
+else
+ echo "$as_me: failed program was:" >&5
+sed 's/^/| /' conftest.$ac_ext >&5
+
+
+fi
+
+rm -f core conftest.err conftest.$ac_objext conftest_ipa8_conftest.oo \
+ conftest$ac_exeext conftest.$ac_ext
+ { echo "$as_me:$LINENO: result: $have_pthread" >&5
+echo "${ECHO_T}$have_pthread" >&6; }
+ LIBS="$SAVELIBS"
+
+ if test $have_pthread = yes; then
+ PTHREAD_FLAGS="-D_THREAD_SAFE -D_REENTRANT"
+ PTHREAD_LIBS="$flag"
+
+ # Solaris requires -D_POSIX_PTHREAD_SEMANTICS to
+ # be POSIX-compliant... :(
+ if test $uname = SunOS; then
+ PTHREAD_FLAGS="$PTHREAD_FLAGS -D_POSIX_PTHREAD_SEMANTICS"
+ fi
+ break
+ fi
+ done
+ fi
+fi
+
+
+
+
+DSO="${DSO:=:}"
+DSOFLAGS="${DSOFLAGS:=}"
+
+# Check whether --enable-shared was given.
+if test "${enable_shared+set}" = set; then
+ enableval=$enable_shared;
+fi
+
+
+if test x$enable_shared = xyes; then
+ { echo "$as_me:$LINENO: checking for shared library support" >&5
+echo $ECHO_N "checking for shared library support... $ECHO_C" >&6; }
+ PICFLAG=1
+
+ case "$uname" in
+ SunOS* | UNIX_S*)
+ { echo "$as_me:$LINENO: result: yes" >&5
+echo "${ECHO_T}yes" >&6; }
+ LIBMXML="libmxml.so.1.4"
+ DSO="\$(CC)"
+ DSOFLAGS="$DSOFLAGS -Wl,-h,libmxml.so.1 -G -R\$(libdir) \$(OPTIM)"
+ LDFLAGS="$LDFLAGS -R\$(libdir)"
+ ;;
+
+ HP-UX*)
+ { echo "$as_me:$LINENO: result: yes" >&5
+echo "${ECHO_T}yes" >&6; }
+ LIBMXML="libmxml.sl.1"
+ DSO="ld"
+ DSOFLAGS="$DSOFLAGS -b -z +h libmxml.sl.1 +s +b \$(libdir)"
+ LDFLAGS="$LDFLAGS -Wl,+s,+b,\$(libdir)"
+ ;;
+
+ IRIX)
+ { echo "$as_me:$LINENO: result: yes" >&5
+echo "${ECHO_T}yes" >&6; }
+ LIBMXML="libmxml.so.1.4"
+ DSO="\$(CC)"
+ DSOFLAGS="$DSOFLAGS -Wl,-rpath,\$(libdir),-set_version,sgi1.0,-soname,libmxml.so.1 -shared \$(OPTIM)"
+ ;;
+
+ OSF1* | Linux | GNU)
+ { echo "$as_me:$LINENO: result: yes" >&5
+echo "${ECHO_T}yes" >&6; }
+ LIBMXML="libmxml.so.1.4"
+ DSO="\$(CC)"
+ DSOFLAGS="$DSOFLAGS -Wl,-soname,libmxml.so.1,-rpath,\$(libdir) -shared \$(OPTIM)"
+ LDFLAGS="$LDFLAGS -Wl,-rpath,\$(libdir)"
+ ;;
+
+ *BSD*)
+ { echo "$as_me:$LINENO: result: yes" >&5
+echo "${ECHO_T}yes" >&6; }
+ LIBMXML="libmxml.so.1.4"
+ DSO="\$(CC)"
+ DSOFLAGS="$DSOFLAGS -Wl,-soname,libmxml.so.1,-R\$(libdir) -shared \$(OPTIM)"
+ LDFLAGS="$LDFLAGS -Wl,-R\$(libdir)"
+ ;;
+
+ Darwin*)
+ { echo "$as_me:$LINENO: result: yes" >&5
+echo "${ECHO_T}yes" >&6; }
+ LIBMXML="libmxml.1.dylib"
+ DSO="\$(CC)"
+ DSOFLAGS="$DSOFLAGS \$(RC_CFLAGS) -dynamiclib -lc"
+ ;;
+
+ *)
+ { echo "$as_me:$LINENO: result: no" >&5
+echo "${ECHO_T}no" >&6; }
+ { echo "$as_me:$LINENO: WARNING: shared libraries not supported on this platform." >&5
+echo "$as_me: WARNING: shared libraries not supported on this platform." >&2;}
+ PICFLAG=0
+ LIBMXML="libmxml.a"
+ ;;
+ esac
+else
+ PICFLAG=0
+ LIBMXML="libmxml.a"
+fi
+
+
+
+
+
+
+if test -n "$GCC"; then
+ CFLAGS="-Wall $CFLAGS"
+
+ if test "x$OPTIM" = x; then
+ OPTIM="-Os -g"
+ fi
+
+ if test "x$use_ansi" = xyes; then
+ CFLAGS="-ansi -pedantic $CFLAGS"
+ fi
+
+ if test $PICFLAG = 1 -a $uname != AIX; then
+ OPTIM="-fPIC $OPTIM"
+ fi
+else
+ case $uname in
+ HP-UX*)
+ CFLAGS="-Ae $CFLAGS"
+
+ if test "x$OPTIM" = x; then
+ OPTIM="-O"
+ fi
+
+ OPTIM="+DAportable $OPTIM"
+
+ if test $PICFLAG = 1; then
+ OPTIM="+z $OPTIM"
+ fi
+ ;;
+
+ UNIX_SVR* | SunOS*)
+ if test "x$OPTIM" = x; then
+ OPTIM="-O"
+ fi
+
+ if test $PICFLAG = 1; then
+ OPTIM="-KPIC $OPTIM"
+ fi
+ ;;
+
+ *)
+ if test "x$OPTIM" = x; then
+ OPTIM="-O"
+ fi
+ ;;
+ esac
+fi
+
+if test "$prefix" = "NONE"; then
+ prefix="/usr/local"
+fi
+
+if test "$exec_prefix" = "NONE"; then
+ exec_prefix="$prefix"
+fi
+
+if test "$docdir" = "NONE"; then
+ docdir="$datadir/doc/mxml"
+fi
+
+if test "$mandir" = "\${prefix}/man" -a "$prefix" = "/usr"; then
+ case "$uname" in
+ *BSD* | Darwin* | Linux*)
+ # BSD, Darwin (MacOS X), and Linux
+ mandir="/usr/share/man"
+ ;;
+ IRIX*)
+ # SGI IRIX
+ mandir="/usr/share/catman/u_man"
+ ;;
+ *)
+ # All others
+ mandir="/usr/man"
+ ;;
+ esac
+fi
+
+if test "$includedir" != /usr/include; then
+ PC_CFLAGS="-I$includedir"
+else
+ PC_CFLAGS=""
+fi
+
+if test "$libdir" != /usr/lib; then
+ PC_LIBS="-L$libdir -lmxml"
+else
+ PC_LIBS="-lmxml"
+fi
+
+
+
+
+ac_config_files="$ac_config_files Makefile mxml.list mxml.pc"
+
+cat >confcache <<\_ACEOF
+# This file is a shell script that caches the results of configure
+# tests run on this system so they can be shared between configure
+# scripts and configure runs, see configure's option --config-cache.
+# It is not useful on other systems. If it contains results you don't
+# want to keep, you may remove or edit it.
+#
+# config.status only pays attention to the cache file if you give it
+# the --recheck option to rerun configure.
+#
+# `ac_cv_env_foo' variables (set or unset) will be overridden when
+# loading this file, other *unset* `ac_cv_foo' will be assigned the
+# following values.
+
+_ACEOF
+
+# The following way of writing the cache mishandles newlines in values,
+# but we know of no workaround that is simple, portable, and efficient.
+# So, we kill variables containing newlines.
+# Ultrix sh set writes to stderr and can't be redirected directly,
+# and sets the high bit in the cache file unless we assign to the vars.
+(
+ for ac_var in `(set) 2>&1 | sed -n 's/^\([a-zA-Z_][a-zA-Z0-9_]*\)=.*/\1/p'`; do
+ eval ac_val=\$$ac_var
+ case $ac_val in #(
+ *${as_nl}*)
+ case $ac_var in #(
+ *_cv_*) { echo "$as_me:$LINENO: WARNING: Cache variable $ac_var contains a newline." >&5
+echo "$as_me: WARNING: Cache variable $ac_var contains a newline." >&2;} ;;
+ esac
+ case $ac_var in #(
+ _ | IFS | as_nl) ;; #(
+ *) $as_unset $ac_var ;;
+ esac ;;
+ esac
+ done
+
+ (set) 2>&1 |
+ case $as_nl`(ac_space=' '; set) 2>&1` in #(
+ *${as_nl}ac_space=\ *)
+ # `set' does not quote correctly, so add quotes (double-quote
+ # substitution turns \\\\ into \\, and sed turns \\ into \).
+ sed -n \
+ "s/'/'\\\\''/g;
+ s/^\\([_$as_cr_alnum]*_cv_[_$as_cr_alnum]*\\)=\\(.*\\)/\\1='\\2'/p"
+ ;; #(
+ *)
+ # `set' quotes correctly as required by POSIX, so do not add quotes.
+ sed -n "/^[_$as_cr_alnum]*_cv_[_$as_cr_alnum]*=/p"
+ ;;
+ esac |
+ sort
+) |
+ sed '
+ /^ac_cv_env_/b end
+ t clear
+ :clear
+ s/^\([^=]*\)=\(.*[{}].*\)$/test "${\1+set}" = set || &/
+ t end
+ s/^\([^=]*\)=\(.*\)$/\1=${\1=\2}/
+ :end' >>confcache
+if diff "$cache_file" confcache >/dev/null 2>&1; then :; else
+ if test -w "$cache_file"; then
+ test "x$cache_file" != "x/dev/null" &&
+ { echo "$as_me:$LINENO: updating cache $cache_file" >&5
+echo "$as_me: updating cache $cache_file" >&6;}
+ cat confcache >$cache_file
+ else
+ { echo "$as_me:$LINENO: not updating unwritable cache $cache_file" >&5
+echo "$as_me: not updating unwritable cache $cache_file" >&6;}
+ fi
+fi
+rm -f confcache
+
+test "x$prefix" = xNONE && prefix=$ac_default_prefix
+# Let make expand exec_prefix.
+test "x$exec_prefix" = xNONE && exec_prefix='${prefix}'
+
+DEFS=-DHAVE_CONFIG_H
+
+ac_libobjs=
+ac_ltlibobjs=
+for ac_i in : $LIBOBJS; do test "x$ac_i" = x: && continue
+ # 1. Remove the extension, and $U if already installed.
+ ac_script='s/\$U\././;s/\.o$//;s/\.obj$//'
+ ac_i=`echo "$ac_i" | sed "$ac_script"`
+ # 2. Prepend LIBOBJDIR. When used with automake>=1.10 LIBOBJDIR
+ # will be set to the directory where LIBOBJS objects are built.
+ ac_libobjs="$ac_libobjs \${LIBOBJDIR}$ac_i\$U.$ac_objext"
+ ac_ltlibobjs="$ac_ltlibobjs \${LIBOBJDIR}$ac_i"'$U.lo'
+done
+LIBOBJS=$ac_libobjs
+
+LTLIBOBJS=$ac_ltlibobjs
+
+
+
+: ${CONFIG_STATUS=./config.status}
+ac_clean_files_save=$ac_clean_files
+ac_clean_files="$ac_clean_files $CONFIG_STATUS"
+{ echo "$as_me:$LINENO: creating $CONFIG_STATUS" >&5
+echo "$as_me: creating $CONFIG_STATUS" >&6;}
+cat >$CONFIG_STATUS <<_ACEOF
+#! $SHELL
+# Generated by $as_me.
+# Run this file to recreate the current configuration.
+# Compiler output produced by configure, useful for debugging
+# configure, is in config.log if it exists.
+
+debug=false
+ac_cs_recheck=false
+ac_cs_silent=false
+SHELL=\${CONFIG_SHELL-$SHELL}
+_ACEOF
+
+cat >>$CONFIG_STATUS <<\_ACEOF
+## --------------------- ##
+## M4sh Initialization. ##
+## --------------------- ##
+
+# Be more Bourne compatible
+DUALCASE=1; export DUALCASE # for MKS sh
+if test -n "${ZSH_VERSION+set}" && (emulate sh) >/dev/null 2>&1; then
+ emulate sh
+ NULLCMD=:
+ # Zsh 3.x and 4.x performs word splitting on ${1+"$@"}, which
+ # is contrary to our usage. Disable this feature.
+ alias -g '${1+"$@"}'='"$@"'
+ setopt NO_GLOB_SUBST
+else
+ case `(set -o) 2>/dev/null` in
+ *posix*) set -o posix ;;
+esac
+
+fi
+
+
+
+
+# PATH needs CR
+# Avoid depending upon Character Ranges.
+as_cr_letters='abcdefghijklmnopqrstuvwxyz'
+as_cr_LETTERS='ABCDEFGHIJKLMNOPQRSTUVWXYZ'
+as_cr_Letters=$as_cr_letters$as_cr_LETTERS
+as_cr_digits='0123456789'
+as_cr_alnum=$as_cr_Letters$as_cr_digits
+
+# The user is always right.
+if test "${PATH_SEPARATOR+set}" != set; then
+ echo "#! /bin/sh" >conf$$.sh
+ echo "exit 0" >>conf$$.sh
+ chmod +x conf$$.sh
+ if (PATH="/nonexistent;."; conf$$.sh) >/dev/null 2>&1; then
+ PATH_SEPARATOR=';'
+ else
+ PATH_SEPARATOR=:
+ fi
+ rm -f conf$$.sh
+fi
+
+# Support unset when possible.
+if ( (MAIL=60; unset MAIL) || exit) >/dev/null 2>&1; then
+ as_unset=unset
+else
+ as_unset=false
+fi
+
+
+# IFS
+# We need space, tab and new line, in precisely that order. Quoting is
+# there to prevent editors from complaining about space-tab.
+# (If _AS_PATH_WALK were called with IFS unset, it would disable word
+# splitting by setting IFS to empty value.)
+as_nl='
+'
+IFS=" "" $as_nl"
+
+# Find who we are. Look in the path if we contain no directory separator.
+case $0 in
+ *[\\/]* ) as_myself=$0 ;;
+ *) as_save_IFS=$IFS; IFS=$PATH_SEPARATOR
+for as_dir in $PATH
+do
+ IFS=$as_save_IFS
+ test -z "$as_dir" && as_dir=.
+ test -r "$as_dir/$0" && as_myself=$as_dir/$0 && break
+done
+IFS=$as_save_IFS
+
+ ;;
+esac
+# We did not find ourselves, most probably we were run as `sh COMMAND'
+# in which case we are not to be found in the path.
+if test "x$as_myself" = x; then
+ as_myself=$0
+fi
+if test ! -f "$as_myself"; then
+ echo "$as_myself: error: cannot find myself; rerun with an absolute file name" >&2
+ { (exit 1); exit 1; }
+fi
+
+# Work around bugs in pre-3.0 UWIN ksh.
+for as_var in ENV MAIL MAILPATH
+do ($as_unset $as_var) >/dev/null 2>&1 && $as_unset $as_var
+done
+PS1='$ '
+PS2='> '
+PS4='+ '
+
+# NLS nuisances.
+for as_var in \
+ LANG LANGUAGE LC_ADDRESS LC_ALL LC_COLLATE LC_CTYPE LC_IDENTIFICATION \
+ LC_MEASUREMENT LC_MESSAGES LC_MONETARY LC_NAME LC_NUMERIC LC_PAPER \
+ LC_TELEPHONE LC_TIME
+do
+ if (set +x; test -z "`(eval $as_var=C; export $as_var) 2>&1`"); then
+ eval $as_var=C; export $as_var
+ else
+ ($as_unset $as_var) >/dev/null 2>&1 && $as_unset $as_var
+ fi
+done
+
+# Required to use basename.
+if expr a : '\(a\)' >/dev/null 2>&1 &&
+ test "X`expr 00001 : '.*\(...\)'`" = X001; then
+ as_expr=expr
+else
+ as_expr=false
+fi
+
+if (basename -- /) >/dev/null 2>&1 && test "X`basename -- / 2>&1`" = "X/"; then
+ as_basename=basename
+else
+ as_basename=false
+fi
+
+
+# Name of the executable.
+as_me=`$as_basename -- "$0" ||
+$as_expr X/"$0" : '.*/\([^/][^/]*\)/*$' \| \
+ X"$0" : 'X\(//\)$' \| \
+ X"$0" : 'X\(/\)' \| . 2>/dev/null ||
+echo X/"$0" |
+ sed '/^.*\/\([^/][^/]*\)\/*$/{
+ s//\1/
+ q
+ }
+ /^X\/\(\/\/\)$/{
+ s//\1/
+ q
+ }
+ /^X\/\(\/\).*/{
+ s//\1/
+ q
+ }
+ s/.*/./; q'`
+
+# CDPATH.
+$as_unset CDPATH
+
+
+
+ as_lineno_1=$LINENO
+ as_lineno_2=$LINENO
+ test "x$as_lineno_1" != "x$as_lineno_2" &&
+ test "x`expr $as_lineno_1 + 1`" = "x$as_lineno_2" || {
+
+ # Create $as_me.lineno as a copy of $as_myself, but with $LINENO
+ # uniformly replaced by the line number. The first 'sed' inserts a
+ # line-number line after each line using $LINENO; the second 'sed'
+ # does the real work. The second script uses 'N' to pair each
+ # line-number line with the line containing $LINENO, and appends
+ # trailing '-' during substitution so that $LINENO is not a special
+ # case at line end.
+ # (Raja R Harinath suggested sed '=', and Paul Eggert wrote the
+ # scripts with optimization help from Paolo Bonzini. Blame Lee
+ # E. McMahon (1931-1989) for sed's syntax. :-)
+ sed -n '
+ p
+ /[$]LINENO/=
+ ' <$as_myself |
+ sed '
+ s/[$]LINENO.*/&-/
+ t lineno
+ b
+ :lineno
+ N
+ :loop
+ s/[$]LINENO\([^'$as_cr_alnum'_].*\n\)\(.*\)/\2\1\2/
+ t loop
+ s/-\n.*//
+ ' >$as_me.lineno &&
+ chmod +x "$as_me.lineno" ||
+ { echo "$as_me: error: cannot create $as_me.lineno; rerun with a POSIX shell" >&2
+ { (exit 1); exit 1; }; }
+
+ # Don't try to exec as it changes $[0], causing all sort of problems
+ # (the dirname of $[0] is not the place where we might find the
+ # original and so on. Autoconf is especially sensitive to this).
+ . "./$as_me.lineno"
+ # Exit status is that of the last command.
+ exit
+}
+
+
+if (as_dir=`dirname -- /` && test "X$as_dir" = X/) >/dev/null 2>&1; then
+ as_dirname=dirname
+else
+ as_dirname=false
+fi
+
+ECHO_C= ECHO_N= ECHO_T=
+case `echo -n x` in
+-n*)
+ case `echo 'x\c'` in
+ *c*) ECHO_T=' ';; # ECHO_T is single tab character.
+ *) ECHO_C='\c';;
+ esac;;
+*)
+ ECHO_N='-n';;
+esac
+
+if expr a : '\(a\)' >/dev/null 2>&1 &&
+ test "X`expr 00001 : '.*\(...\)'`" = X001; then
+ as_expr=expr
+else
+ as_expr=false
+fi
+
+rm -f conf$$ conf$$.exe conf$$.file
+if test -d conf$$.dir; then
+ rm -f conf$$.dir/conf$$.file
+else
+ rm -f conf$$.dir
+ mkdir conf$$.dir
+fi
+echo >conf$$.file
+if ln -s conf$$.file conf$$ 2>/dev/null; then
+ as_ln_s='ln -s'
+ # ... but there are two gotchas:
+ # 1) On MSYS, both `ln -s file dir' and `ln file dir' fail.
+ # 2) DJGPP < 2.04 has no symlinks; `ln -s' creates a wrapper executable.
+ # In both cases, we have to default to `cp -p'.
+ ln -s conf$$.file conf$$.dir 2>/dev/null && test ! -f conf$$.exe ||
+ as_ln_s='cp -p'
+elif ln conf$$.file conf$$ 2>/dev/null; then
+ as_ln_s=ln
+else
+ as_ln_s='cp -p'
+fi
+rm -f conf$$ conf$$.exe conf$$.dir/conf$$.file conf$$.file
+rmdir conf$$.dir 2>/dev/null
+
+if mkdir -p . 2>/dev/null; then
+ as_mkdir_p=:
+else
+ test -d ./-p && rmdir ./-p
+ as_mkdir_p=false
+fi
+
+if test -x / >/dev/null 2>&1; then
+ as_test_x='test -x'
+else
+ if ls -dL / >/dev/null 2>&1; then
+ as_ls_L_option=L
+ else
+ as_ls_L_option=
+ fi
+ as_test_x='
+ eval sh -c '\''
+ if test -d "$1"; then
+ test -d "$1/.";
+ else
+ case $1 in
+ -*)set "./$1";;
+ esac;
+ case `ls -ld'$as_ls_L_option' "$1" 2>/dev/null` in
+ ???[sx]*):;;*)false;;esac;fi
+ '\'' sh
+ '
+fi
+as_executable_p=$as_test_x
+
+# Sed expression to map a string onto a valid CPP name.
+as_tr_cpp="eval sed 'y%*$as_cr_letters%P$as_cr_LETTERS%;s%[^_$as_cr_alnum]%_%g'"
+
+# Sed expression to map a string onto a valid variable name.
+as_tr_sh="eval sed 'y%*+%pp%;s%[^_$as_cr_alnum]%_%g'"
+
+
+exec 6>&1
+
+# Save the log message, to keep $[0] and so on meaningful, and to
+# report actual input values of CONFIG_FILES etc. instead of their
+# values after options handling.
+ac_log="
+This file was extended by $as_me, which was
+generated by GNU Autoconf 2.61. Invocation command line was
+
+ CONFIG_FILES = $CONFIG_FILES
+ CONFIG_HEADERS = $CONFIG_HEADERS
+ CONFIG_LINKS = $CONFIG_LINKS
+ CONFIG_COMMANDS = $CONFIG_COMMANDS
+ $ $0 $@
+
+on `(hostname || uname -n) 2>/dev/null | sed 1q`
+"
+
+_ACEOF
+
+cat >>$CONFIG_STATUS <<_ACEOF
+# Files that config.status was made for.
+config_files="$ac_config_files"
+config_headers="$ac_config_headers"
+
+_ACEOF
+
+cat >>$CONFIG_STATUS <<\_ACEOF
+ac_cs_usage="\
+\`$as_me' instantiates files from templates according to the
+current configuration.
+
+Usage: $0 [OPTIONS] [FILE]...
+
+ -h, --help print this help, then exit
+ -V, --version print version number and configuration settings, then exit
+ -q, --quiet do not print progress messages
+ -d, --debug don't remove temporary files
+ --recheck update $as_me by reconfiguring in the same conditions
+ --file=FILE[:TEMPLATE]
+ instantiate the configuration file FILE
+ --header=FILE[:TEMPLATE]
+ instantiate the configuration header FILE
+
+Configuration files:
+$config_files
+
+Configuration headers:
+$config_headers
+
+Report bugs to <bug-autoconf@gnu.org>."
+
+_ACEOF
+cat >>$CONFIG_STATUS <<_ACEOF
+ac_cs_version="\\
+config.status
+configured by $0, generated by GNU Autoconf 2.61,
+ with options \\"`echo "$ac_configure_args" | sed 's/^ //; s/[\\""\`\$]/\\\\&/g'`\\"
+
+Copyright (C) 2006 Free Software Foundation, Inc.
+This config.status script is free software; the Free Software Foundation
+gives unlimited permission to copy, distribute and modify it."
+
+ac_pwd='$ac_pwd'
+srcdir='$srcdir'
+INSTALL='$INSTALL'
+_ACEOF
+
+cat >>$CONFIG_STATUS <<\_ACEOF
+# If no file are specified by the user, then we need to provide default
+# value. By we need to know if files were specified by the user.
+ac_need_defaults=:
+while test $# != 0
+do
+ case $1 in
+ --*=*)
+ ac_option=`expr "X$1" : 'X\([^=]*\)='`
+ ac_optarg=`expr "X$1" : 'X[^=]*=\(.*\)'`
+ ac_shift=:
+ ;;
+ *)
+ ac_option=$1
+ ac_optarg=$2
+ ac_shift=shift
+ ;;
+ esac
+
+ case $ac_option in
+ # Handling of the options.
+ -recheck | --recheck | --rechec | --reche | --rech | --rec | --re | --r)
+ ac_cs_recheck=: ;;
+ --version | --versio | --versi | --vers | --ver | --ve | --v | -V )
+ echo "$ac_cs_version"; exit ;;
+ --debug | --debu | --deb | --de | --d | -d )
+ debug=: ;;
+ --file | --fil | --fi | --f )
+ $ac_shift
+ CONFIG_FILES="$CONFIG_FILES $ac_optarg"
+ ac_need_defaults=false;;
+ --header | --heade | --head | --hea )
+ $ac_shift
+ CONFIG_HEADERS="$CONFIG_HEADERS $ac_optarg"
+ ac_need_defaults=false;;
+ --he | --h)
+ # Conflict between --help and --header
+ { echo "$as_me: error: ambiguous option: $1
+Try \`$0 --help' for more information." >&2
+ { (exit 1); exit 1; }; };;
+ --help | --hel | -h )
+ echo "$ac_cs_usage"; exit ;;
+ -q | -quiet | --quiet | --quie | --qui | --qu | --q \
+ | -silent | --silent | --silen | --sile | --sil | --si | --s)
+ ac_cs_silent=: ;;
+
+ # This is an error.
+ -*) { echo "$as_me: error: unrecognized option: $1
+Try \`$0 --help' for more information." >&2
+ { (exit 1); exit 1; }; } ;;
+
+ *) ac_config_targets="$ac_config_targets $1"
+ ac_need_defaults=false ;;
+
+ esac
+ shift
+done
+
+ac_configure_extra_args=
+
+if $ac_cs_silent; then
+ exec 6>/dev/null
+ ac_configure_extra_args="$ac_configure_extra_args --silent"
+fi
+
+_ACEOF
+cat >>$CONFIG_STATUS <<_ACEOF
+if \$ac_cs_recheck; then
+ echo "running CONFIG_SHELL=$SHELL $SHELL $0 "$ac_configure_args \$ac_configure_extra_args " --no-create --no-recursion" >&6
+ CONFIG_SHELL=$SHELL
+ export CONFIG_SHELL
+ exec $SHELL "$0"$ac_configure_args \$ac_configure_extra_args --no-create --no-recursion
+fi
+
+_ACEOF
+cat >>$CONFIG_STATUS <<\_ACEOF
+exec 5>>config.log
+{
+ echo
+ sed 'h;s/./-/g;s/^.../## /;s/...$/ ##/;p;x;p;x' <<_ASBOX
+## Running $as_me. ##
+_ASBOX
+ echo "$ac_log"
+} >&5
+
+_ACEOF
+cat >>$CONFIG_STATUS <<_ACEOF
+_ACEOF
+
+cat >>$CONFIG_STATUS <<\_ACEOF
+
+# Handling of arguments.
+for ac_config_target in $ac_config_targets
+do
+ case $ac_config_target in
+ "config.h") CONFIG_HEADERS="$CONFIG_HEADERS config.h" ;;
+ "Makefile") CONFIG_FILES="$CONFIG_FILES Makefile" ;;
+ "mxml.list") CONFIG_FILES="$CONFIG_FILES mxml.list" ;;
+ "mxml.pc") CONFIG_FILES="$CONFIG_FILES mxml.pc" ;;
+
+ *) { { echo "$as_me:$LINENO: error: invalid argument: $ac_config_target" >&5
+echo "$as_me: error: invalid argument: $ac_config_target" >&2;}
+ { (exit 1); exit 1; }; };;
+ esac
+done
+
+
+# If the user did not use the arguments to specify the items to instantiate,
+# then the envvar interface is used. Set only those that are not.
+# We use the long form for the default assignment because of an extremely
+# bizarre bug on SunOS 4.1.3.
+if $ac_need_defaults; then
+ test "${CONFIG_FILES+set}" = set || CONFIG_FILES=$config_files
+ test "${CONFIG_HEADERS+set}" = set || CONFIG_HEADERS=$config_headers
+fi
+
+# Have a temporary directory for convenience. Make it in the build tree
+# simply because there is no reason against having it here, and in addition,
+# creating and moving files from /tmp can sometimes cause problems.
+# Hook for its removal unless debugging.
+# Note that there is a small window in which the directory will not be cleaned:
+# after its creation but before its name has been assigned to `$tmp'.
+$debug ||
+{
+ tmp=
+ trap 'exit_status=$?
+ { test -z "$tmp" || test ! -d "$tmp" || rm -fr "$tmp"; } && exit $exit_status
+' 0
+ trap '{ (exit 1); exit 1; }' 1 2 13 15
+}
+# Create a (secure) tmp directory for tmp files.
+
+{
+ tmp=`(umask 077 && mktemp -d "./confXXXXXX") 2>/dev/null` &&
+ test -n "$tmp" && test -d "$tmp"
+} ||
+{
+ tmp=./conf$$-$RANDOM
+ (umask 077 && mkdir "$tmp")
+} ||
+{
+ echo "$me: cannot create a temporary directory in ." >&2
+ { (exit 1); exit 1; }
+}
+
+#
+# Set up the sed scripts for CONFIG_FILES section.
+#
+
+# No need to generate the scripts if there are no CONFIG_FILES.
+# This happens for instance when ./config.status config.h
+if test -n "$CONFIG_FILES"; then
+
+_ACEOF
+
+
+
+ac_delim='%!_!# '
+for ac_last_try in false false false false false :; do
+ cat >conf$$subs.sed <<_ACEOF
+SHELL!$SHELL$ac_delim
+PATH_SEPARATOR!$PATH_SEPARATOR$ac_delim
+PACKAGE_NAME!$PACKAGE_NAME$ac_delim
+PACKAGE_TARNAME!$PACKAGE_TARNAME$ac_delim
+PACKAGE_VERSION!$PACKAGE_VERSION$ac_delim
+PACKAGE_STRING!$PACKAGE_STRING$ac_delim
+PACKAGE_BUGREPORT!$PACKAGE_BUGREPORT$ac_delim
+exec_prefix!$exec_prefix$ac_delim
+prefix!$prefix$ac_delim
+program_transform_name!$program_transform_name$ac_delim
+bindir!$bindir$ac_delim
+sbindir!$sbindir$ac_delim
+libexecdir!$libexecdir$ac_delim
+datarootdir!$datarootdir$ac_delim
+datadir!$datadir$ac_delim
+sysconfdir!$sysconfdir$ac_delim
+sharedstatedir!$sharedstatedir$ac_delim
+localstatedir!$localstatedir$ac_delim
+includedir!$includedir$ac_delim
+oldincludedir!$oldincludedir$ac_delim
+docdir!$docdir$ac_delim
+infodir!$infodir$ac_delim
+htmldir!$htmldir$ac_delim
+dvidir!$dvidir$ac_delim
+pdfdir!$pdfdir$ac_delim
+psdir!$psdir$ac_delim
+libdir!$libdir$ac_delim
+localedir!$localedir$ac_delim
+mandir!$mandir$ac_delim
+DEFS!$DEFS$ac_delim
+ECHO_C!$ECHO_C$ac_delim
+ECHO_N!$ECHO_N$ac_delim
+ECHO_T!$ECHO_T$ac_delim
+LIBS!$LIBS$ac_delim
+build_alias!$build_alias$ac_delim
+host_alias!$host_alias$ac_delim
+target_alias!$target_alias$ac_delim
+VERSION!$VERSION$ac_delim
+LDFLAGS!$LDFLAGS$ac_delim
+OPTIM!$OPTIM$ac_delim
+ARCHFLAGS!$ARCHFLAGS$ac_delim
+CC!$CC$ac_delim
+CFLAGS!$CFLAGS$ac_delim
+CPPFLAGS!$CPPFLAGS$ac_delim
+ac_ct_CC!$ac_ct_CC$ac_delim
+EXEEXT!$EXEEXT$ac_delim
+OBJEXT!$OBJEXT$ac_delim
+CXX!$CXX$ac_delim
+CXXFLAGS!$CXXFLAGS$ac_delim
+ac_ct_CXX!$ac_ct_CXX$ac_delim
+INSTALL_PROGRAM!$INSTALL_PROGRAM$ac_delim
+INSTALL_SCRIPT!$INSTALL_SCRIPT$ac_delim
+INSTALL_DATA!$INSTALL_DATA$ac_delim
+RANLIB!$RANLIB$ac_delim
+AR!$AR$ac_delim
+CP!$CP$ac_delim
+LN!$LN$ac_delim
+MKDIR!$MKDIR$ac_delim
+RM!$RM$ac_delim
+ARFLAGS!$ARFLAGS$ac_delim
+CPP!$CPP$ac_delim
+GREP!$GREP$ac_delim
+EGREP!$EGREP$ac_delim
+PTHREAD_FLAGS!$PTHREAD_FLAGS$ac_delim
+PTHREAD_LIBS!$PTHREAD_LIBS$ac_delim
+DSO!$DSO$ac_delim
+DSOFLAGS!$DSOFLAGS$ac_delim
+LIBMXML!$LIBMXML$ac_delim
+PICFLAG!$PICFLAG$ac_delim
+PC_CFLAGS!$PC_CFLAGS$ac_delim
+PC_LIBS!$PC_LIBS$ac_delim
+LIBOBJS!$LIBOBJS$ac_delim
+LTLIBOBJS!$LTLIBOBJS$ac_delim
+_ACEOF
+
+ if test `sed -n "s/.*$ac_delim\$/X/p" conf$$subs.sed | grep -c X` = 73; then
+ break
+ elif $ac_last_try; then
+ { { echo "$as_me:$LINENO: error: could not make $CONFIG_STATUS" >&5
+echo "$as_me: error: could not make $CONFIG_STATUS" >&2;}
+ { (exit 1); exit 1; }; }
+ else
+ ac_delim="$ac_delim!$ac_delim _$ac_delim!! "
+ fi
+done
+
+ac_eof=`sed -n '/^CEOF[0-9]*$/s/CEOF/0/p' conf$$subs.sed`
+if test -n "$ac_eof"; then
+ ac_eof=`echo "$ac_eof" | sort -nru | sed 1q`
+ ac_eof=`expr $ac_eof + 1`
+fi
+
+cat >>$CONFIG_STATUS <<_ACEOF
+cat >"\$tmp/subs-1.sed" <<\CEOF$ac_eof
+/@[a-zA-Z_][a-zA-Z_0-9]*@/!b end
+_ACEOF
+sed '
+s/[,\\&]/\\&/g; s/@/@|#_!!_#|/g
+s/^/s,@/; s/!/@,|#_!!_#|/
+:n
+t n
+s/'"$ac_delim"'$/,g/; t
+s/$/\\/; p
+N; s/^.*\n//; s/[,\\&]/\\&/g; s/@/@|#_!!_#|/g; b n
+' >>$CONFIG_STATUS <conf$$subs.sed
+rm -f conf$$subs.sed
+cat >>$CONFIG_STATUS <<_ACEOF
+:end
+s/|#_!!_#|//g
+CEOF$ac_eof
+_ACEOF
+
+
+# VPATH may cause trouble with some makes, so we remove $(srcdir),
+# ${srcdir} and @srcdir@ from VPATH if srcdir is ".", strip leading and
+# trailing colons and then remove the whole line if VPATH becomes empty
+# (actually we leave an empty line to preserve line numbers).
+if test "x$srcdir" = x.; then
+ ac_vpsub='/^[ ]*VPATH[ ]*=/{
+s/:*\$(srcdir):*/:/
+s/:*\${srcdir}:*/:/
+s/:*@srcdir@:*/:/
+s/^\([^=]*=[ ]*\):*/\1/
+s/:*$//
+s/^[^=]*=[ ]*$//
+}'
+fi
+
+cat >>$CONFIG_STATUS <<\_ACEOF
+fi # test -n "$CONFIG_FILES"
+
+
+for ac_tag in :F $CONFIG_FILES :H $CONFIG_HEADERS
+do
+ case $ac_tag in
+ :[FHLC]) ac_mode=$ac_tag; continue;;
+ esac
+ case $ac_mode$ac_tag in
+ :[FHL]*:*);;
+ :L* | :C*:*) { { echo "$as_me:$LINENO: error: Invalid tag $ac_tag." >&5
+echo "$as_me: error: Invalid tag $ac_tag." >&2;}
+ { (exit 1); exit 1; }; };;
+ :[FH]-) ac_tag=-:-;;
+ :[FH]*) ac_tag=$ac_tag:$ac_tag.in;;
+ esac
+ ac_save_IFS=$IFS
+ IFS=:
+ set x $ac_tag
+ IFS=$ac_save_IFS
+ shift
+ ac_file=$1
+ shift
+
+ case $ac_mode in
+ :L) ac_source=$1;;
+ :[FH])
+ ac_file_inputs=
+ for ac_f
+ do
+ case $ac_f in
+ -) ac_f="$tmp/stdin";;
+ *) # Look for the file first in the build tree, then in the source tree
+ # (if the path is not absolute). The absolute path cannot be DOS-style,
+ # because $ac_f cannot contain `:'.
+ test -f "$ac_f" ||
+ case $ac_f in
+ [\\/$]*) false;;
+ *) test -f "$srcdir/$ac_f" && ac_f="$srcdir/$ac_f";;
+ esac ||
+ { { echo "$as_me:$LINENO: error: cannot find input file: $ac_f" >&5
+echo "$as_me: error: cannot find input file: $ac_f" >&2;}
+ { (exit 1); exit 1; }; };;
+ esac
+ ac_file_inputs="$ac_file_inputs $ac_f"
+ done
+
+ # Let's still pretend it is `configure' which instantiates (i.e., don't
+ # use $as_me), people would be surprised to read:
+ # /* config.h. Generated by config.status. */
+ configure_input="Generated from "`IFS=:
+ echo $* | sed 's|^[^:]*/||;s|:[^:]*/|, |g'`" by configure."
+ if test x"$ac_file" != x-; then
+ configure_input="$ac_file. $configure_input"
+ { echo "$as_me:$LINENO: creating $ac_file" >&5
+echo "$as_me: creating $ac_file" >&6;}
+ fi
+
+ case $ac_tag in
+ *:-:* | *:-) cat >"$tmp/stdin";;
+ esac
+ ;;
+ esac
+
+ ac_dir=`$as_dirname -- "$ac_file" ||
+$as_expr X"$ac_file" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
+ X"$ac_file" : 'X\(//\)[^/]' \| \
+ X"$ac_file" : 'X\(//\)$' \| \
+ X"$ac_file" : 'X\(/\)' \| . 2>/dev/null ||
+echo X"$ac_file" |
+ sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{
+ s//\1/
+ q
+ }
+ /^X\(\/\/\)[^/].*/{
+ s//\1/
+ q
+ }
+ /^X\(\/\/\)$/{
+ s//\1/
+ q
+ }
+ /^X\(\/\).*/{
+ s//\1/
+ q
+ }
+ s/.*/./; q'`
+ { as_dir="$ac_dir"
+ case $as_dir in #(
+ -*) as_dir=./$as_dir;;
+ esac
+ test -d "$as_dir" || { $as_mkdir_p && mkdir -p "$as_dir"; } || {
+ as_dirs=
+ while :; do
+ case $as_dir in #(
+ *\'*) as_qdir=`echo "$as_dir" | sed "s/'/'\\\\\\\\''/g"`;; #(
+ *) as_qdir=$as_dir;;
+ esac
+ as_dirs="'$as_qdir' $as_dirs"
+ as_dir=`$as_dirname -- "$as_dir" ||
+$as_expr X"$as_dir" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \
+ X"$as_dir" : 'X\(//\)[^/]' \| \
+ X"$as_dir" : 'X\(//\)$' \| \
+ X"$as_dir" : 'X\(/\)' \| . 2>/dev/null ||
+echo X"$as_dir" |
+ sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{
+ s//\1/
+ q
+ }
+ /^X\(\/\/\)[^/].*/{
+ s//\1/
+ q
+ }
+ /^X\(\/\/\)$/{
+ s//\1/
+ q
+ }
+ /^X\(\/\).*/{
+ s//\1/
+ q
+ }
+ s/.*/./; q'`
+ test -d "$as_dir" && break
+ done
+ test -z "$as_dirs" || eval "mkdir $as_dirs"
+ } || test -d "$as_dir" || { { echo "$as_me:$LINENO: error: cannot create directory $as_dir" >&5
+echo "$as_me: error: cannot create directory $as_dir" >&2;}
+ { (exit 1); exit 1; }; }; }
+ ac_builddir=.
+
+case "$ac_dir" in
+.) ac_dir_suffix= ac_top_builddir_sub=. ac_top_build_prefix= ;;
+*)
+ ac_dir_suffix=/`echo "$ac_dir" | sed 's,^\.[\\/],,'`
+ # A ".." for each directory in $ac_dir_suffix.
+ ac_top_builddir_sub=`echo "$ac_dir_suffix" | sed 's,/[^\\/]*,/..,g;s,/,,'`
+ case $ac_top_builddir_sub in
+ "") ac_top_builddir_sub=. ac_top_build_prefix= ;;
+ *) ac_top_build_prefix=$ac_top_builddir_sub/ ;;
+ esac ;;
+esac
+ac_abs_top_builddir=$ac_pwd
+ac_abs_builddir=$ac_pwd$ac_dir_suffix
+# for backward compatibility:
+ac_top_builddir=$ac_top_build_prefix
+
+case $srcdir in
+ .) # We are building in place.
+ ac_srcdir=.
+ ac_top_srcdir=$ac_top_builddir_sub
+ ac_abs_top_srcdir=$ac_pwd ;;
+ [\\/]* | ?:[\\/]* ) # Absolute name.
+ ac_srcdir=$srcdir$ac_dir_suffix;
+ ac_top_srcdir=$srcdir
+ ac_abs_top_srcdir=$srcdir ;;
+ *) # Relative name.
+ ac_srcdir=$ac_top_build_prefix$srcdir$ac_dir_suffix
+ ac_top_srcdir=$ac_top_build_prefix$srcdir
+ ac_abs_top_srcdir=$ac_pwd/$srcdir ;;
+esac
+ac_abs_srcdir=$ac_abs_top_srcdir$ac_dir_suffix
+
+
+ case $ac_mode in
+ :F)
+ #
+ # CONFIG_FILE
+ #
+
+ case $INSTALL in
+ [\\/$]* | ?:[\\/]* ) ac_INSTALL=$INSTALL ;;
+ *) ac_INSTALL=$ac_top_build_prefix$INSTALL ;;
+ esac
+_ACEOF
+
+cat >>$CONFIG_STATUS <<\_ACEOF
+# If the template does not know about datarootdir, expand it.
+# FIXME: This hack should be removed a few years after 2.60.
+ac_datarootdir_hack=; ac_datarootdir_seen=
+
+case `sed -n '/datarootdir/ {
+ p
+ q
+}
+/@datadir@/p
+/@docdir@/p
+/@infodir@/p
+/@localedir@/p
+/@mandir@/p
+' $ac_file_inputs` in
+*datarootdir*) ac_datarootdir_seen=yes;;
+*@datadir@*|*@docdir@*|*@infodir@*|*@localedir@*|*@mandir@*)
+ { echo "$as_me:$LINENO: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&5
+echo "$as_me: WARNING: $ac_file_inputs seems to ignore the --datarootdir setting" >&2;}
+_ACEOF
+cat >>$CONFIG_STATUS <<_ACEOF
+ ac_datarootdir_hack='
+ s&@datadir@&$datadir&g
+ s&@docdir@&$docdir&g
+ s&@infodir@&$infodir&g
+ s&@localedir@&$localedir&g
+ s&@mandir@&$mandir&g
+ s&\\\${datarootdir}&$datarootdir&g' ;;
+esac
+_ACEOF
+
+# Neutralize VPATH when `$srcdir' = `.'.
+# Shell code in configure.ac might set extrasub.
+# FIXME: do we really want to maintain this feature?
+cat >>$CONFIG_STATUS <<_ACEOF
+ sed "$ac_vpsub
+$extrasub
+_ACEOF
+cat >>$CONFIG_STATUS <<\_ACEOF
+:t
+/@[a-zA-Z_][a-zA-Z_0-9]*@/!b
+s&@configure_input@&$configure_input&;t t
+s&@top_builddir@&$ac_top_builddir_sub&;t t
+s&@srcdir@&$ac_srcdir&;t t
+s&@abs_srcdir@&$ac_abs_srcdir&;t t
+s&@top_srcdir@&$ac_top_srcdir&;t t
+s&@abs_top_srcdir@&$ac_abs_top_srcdir&;t t
+s&@builddir@&$ac_builddir&;t t
+s&@abs_builddir@&$ac_abs_builddir&;t t
+s&@abs_top_builddir@&$ac_abs_top_builddir&;t t
+s&@INSTALL@&$ac_INSTALL&;t t
+$ac_datarootdir_hack
+" $ac_file_inputs | sed -f "$tmp/subs-1.sed" >$tmp/out
+
+test -z "$ac_datarootdir_hack$ac_datarootdir_seen" &&
+ { ac_out=`sed -n '/\${datarootdir}/p' "$tmp/out"`; test -n "$ac_out"; } &&
+ { ac_out=`sed -n '/^[ ]*datarootdir[ ]*:*=/p' "$tmp/out"`; test -z "$ac_out"; } &&
+ { echo "$as_me:$LINENO: WARNING: $ac_file contains a reference to the variable \`datarootdir'
+which seems to be undefined. Please make sure it is defined." >&5
+echo "$as_me: WARNING: $ac_file contains a reference to the variable \`datarootdir'
+which seems to be undefined. Please make sure it is defined." >&2;}
+
+ rm -f "$tmp/stdin"
+ case $ac_file in
+ -) cat "$tmp/out"; rm -f "$tmp/out";;
+ *) rm -f "$ac_file"; mv "$tmp/out" $ac_file;;
+ esac
+ ;;
+ :H)
+ #
+ # CONFIG_HEADER
+ #
+_ACEOF
+
+# Transform confdefs.h into a sed script `conftest.defines', that
+# substitutes the proper values into config.h.in to produce config.h.
+rm -f conftest.defines conftest.tail
+# First, append a space to every undef/define line, to ease matching.
+echo 's/$/ /' >conftest.defines
+# Then, protect against being on the right side of a sed subst, or in
+# an unquoted here document, in config.status. If some macros were
+# called several times there might be several #defines for the same
+# symbol, which is useless. But do not sort them, since the last
+# AC_DEFINE must be honored.
+ac_word_re=[_$as_cr_Letters][_$as_cr_alnum]*
+# These sed commands are passed to sed as "A NAME B PARAMS C VALUE D", where
+# NAME is the cpp macro being defined, VALUE is the value it is being given.
+# PARAMS is the parameter list in the macro definition--in most cases, it's
+# just an empty string.
+ac_dA='s,^\\([ #]*\\)[^ ]*\\([ ]*'
+ac_dB='\\)[ (].*,\\1define\\2'
+ac_dC=' '
+ac_dD=' ,'
+
+uniq confdefs.h |
+ sed -n '
+ t rset
+ :rset
+ s/^[ ]*#[ ]*define[ ][ ]*//
+ t ok
+ d
+ :ok
+ s/[\\&,]/\\&/g
+ s/^\('"$ac_word_re"'\)\(([^()]*)\)[ ]*\(.*\)/ '"$ac_dA"'\1'"$ac_dB"'\2'"${ac_dC}"'\3'"$ac_dD"'/p
+ s/^\('"$ac_word_re"'\)[ ]*\(.*\)/'"$ac_dA"'\1'"$ac_dB$ac_dC"'\2'"$ac_dD"'/p
+ ' >>conftest.defines
+
+# Remove the space that was appended to ease matching.
+# Then replace #undef with comments. This is necessary, for
+# example, in the case of _POSIX_SOURCE, which is predefined and required
+# on some systems where configure will not decide to define it.
+# (The regexp can be short, since the line contains either #define or #undef.)
+echo 's/ $//
+s,^[ #]*u.*,/* & */,' >>conftest.defines
+
+# Break up conftest.defines:
+ac_max_sed_lines=50
+
+# First sed command is: sed -f defines.sed $ac_file_inputs >"$tmp/out1"
+# Second one is: sed -f defines.sed "$tmp/out1" >"$tmp/out2"
+# Third one will be: sed -f defines.sed "$tmp/out2" >"$tmp/out1"
+# et cetera.
+ac_in='$ac_file_inputs'
+ac_out='"$tmp/out1"'
+ac_nxt='"$tmp/out2"'
+
+while :
+do
+ # Write a here document:
+ cat >>$CONFIG_STATUS <<_ACEOF
+ # First, check the format of the line:
+ cat >"\$tmp/defines.sed" <<\\CEOF
+/^[ ]*#[ ]*undef[ ][ ]*$ac_word_re[ ]*\$/b def
+/^[ ]*#[ ]*define[ ][ ]*$ac_word_re[( ]/b def
+b
+:def
+_ACEOF
+ sed ${ac_max_sed_lines}q conftest.defines >>$CONFIG_STATUS
+ echo 'CEOF
+ sed -f "$tmp/defines.sed"' "$ac_in >$ac_out" >>$CONFIG_STATUS
+ ac_in=$ac_out; ac_out=$ac_nxt; ac_nxt=$ac_in
+ sed 1,${ac_max_sed_lines}d conftest.defines >conftest.tail
+ grep . conftest.tail >/dev/null || break
+ rm -f conftest.defines
+ mv conftest.tail conftest.defines
+done
+rm -f conftest.defines conftest.tail
+
+echo "ac_result=$ac_in" >>$CONFIG_STATUS
+cat >>$CONFIG_STATUS <<\_ACEOF
+ if test x"$ac_file" != x-; then
+ echo "/* $configure_input */" >"$tmp/config.h"
+ cat "$ac_result" >>"$tmp/config.h"
+ if diff $ac_file "$tmp/config.h" >/dev/null 2>&1; then
+ { echo "$as_me:$LINENO: $ac_file is unchanged" >&5
+echo "$as_me: $ac_file is unchanged" >&6;}
+ else
+ rm -f $ac_file
+ mv "$tmp/config.h" $ac_file
+ fi
+ else
+ echo "/* $configure_input */"
+ cat "$ac_result"
+ fi
+ rm -f "$tmp/out12"
+ ;;
+
+
+ esac
+
+done # for ac_tag
+
+
+{ (exit 0); exit 0; }
+_ACEOF
+chmod +x $CONFIG_STATUS
+ac_clean_files=$ac_clean_files_save
+
+
+# configure is writing to config.log, and then calls config.status.
+# config.status does its own redirection, appending to config.log.
+# Unfortunately, on DOS this fails, as config.log is still kept open
+# by configure, so config.status won't be able to write to it; its
+# output is simply discarded. So we exec the FD to /dev/null,
+# effectively closing config.log, so it can be properly (re)opened and
+# appended to by config.status. When coming back to configure, we
+# need to make the FD available again.
+if test "$no_create" != yes; then
+ ac_cs_success=:
+ ac_config_status_args=
+ test "$silent" = yes &&
+ ac_config_status_args="$ac_config_status_args --quiet"
+ exec 5>/dev/null
+ $SHELL $CONFIG_STATUS $ac_config_status_args || ac_cs_success=false
+ exec 5>>config.log
+ # Use ||, not &&, to avoid exiting from the if with $? = 1, which
+ # would make configure fail if this is the last instruction.
+ $ac_cs_success || { (exit 1); exit 1; }
+fi
+
+
diff -Naur mxml-2.6/configure.in mxml-2.6-haiku/configure.in
--- mxml-2.6/configure.in 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/configure.in 2009-04-18 17:05:52.000000000 +0000
@@ -0,0 +1,340 @@
+dnl
+dnl "$Id: configure.in 387 2009-04-18 17:05:52Z mike $"
+dnl
+dnl Configuration script for Mini-XML, a small XML-like file parsing library.
+dnl
+dnl Copyright 2003-2009 by Michael Sweet.
+dnl
+dnl This program is free software; you can redistribute it and/or
+dnl modify it under the terms of the GNU Library General Public
+dnl License as published by the Free Software Foundation; either
+dnl version 2, or (at your option) any later version.
+dnl
+dnl This program is distributed in the hope that it will be useful,
+dnl but WITHOUT ANY WARRANTY; without even the implied warranty of
+dnl MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+dnl GNU General Public License for more details.
+dnl
+
+dnl Specify a source file from the distribution...
+AC_INIT(mxml.h)
+
+dnl Set the name of the config header file...
+AC_CONFIG_HEADER(config.h)
+
+dnl Version number...
+VERSION=2.6
+AC_SUBST(VERSION)
+AC_DEFINE_UNQUOTED(MXML_VERSION, "Mini-XML v$VERSION")
+
+dnl Clear default debugging options and set normal optimization by
+dnl default unless the user asks for debugging specifically.
+CFLAGS="${CFLAGS:=}"
+CXXFLAGS="${CXXFLAGS:=}"
+LDFLAGS="${LDFLAGS:=}"
+AC_SUBST(LDFLAGS)
+OPTIM=""
+AC_SUBST(OPTIM)
+
+AC_ARG_WITH(ansi, [ --with-ansi set full ANSI C mode, default=no],
+ use_ansi="$withval",
+ use_ansi="no")
+
+AC_ARG_WITH(archflags, [ --with-archflags set additional architecture flags, default=none],
+ ARCHFLAGS="$withval",
+ ARCHFLAGS="")
+AC_SUBST(ARCHFLAGS)
+
+AC_ARG_ENABLE(debug, [ --enable-debug turn on debugging, default=no],
+if eval "test x$enable_debug = xyes"; then
+ OPTIM="-g"
+fi)
+
+AC_ARG_WITH(docdir, [ --with-docdir set directory for documentation, default=${prefix}/share/doc/mxml],
+ docdir="$withval",
+ docdir="NONE")
+
+AC_SUBST(docdir)
+
+AC_ARG_WITH(vsnprintf, [ --with-vsnprintf use vsnprintf emulation functions, default=auto],
+ use_vsnprintf="$withval",
+ use_vsnprintf="no")
+
+dnl Get the operating system and version number...
+uname=`uname`
+uversion=`uname -r | sed -e '1,$s/[[^0-9]]//g'`
+if test x$uname = xIRIX64; then
+ uname="IRIX"
+fi
+
+dnl Checks for programs...
+AC_PROG_CC
+AC_PROG_CXX
+AC_PROG_INSTALL
+if test "$INSTALL" = "$ac_install_sh"; then
+ # Use full path to install-sh script...
+ INSTALL="`pwd`/install-sh -c"
+fi
+AC_PROG_RANLIB
+AC_PATH_PROG(AR,ar)
+AC_PATH_PROG(CP,cp)
+AC_PATH_PROG(LN,ln)
+AC_PATH_PROG(MKDIR,mkdir)
+AC_PATH_PROG(RM,rm)
+
+dnl Flags for "ar" command...
+case "$uname" in
+ Darwin* | *BSD*)
+ ARFLAGS="-rcv"
+ ;;
+ *)
+ ARFLAGS="crvs"
+ ;;
+esac
+
+AC_SUBST(ARFLAGS)
+
+dnl Inline functions...
+AC_C_INLINE
+
+dnl Checks for string functions.
+if test "x$use_ansi" != xyes; then
+ AC_CHECK_FUNCS(strdup)
+fi
+
+if test "x$use_vsnprintf" != xyes; then
+ AC_CHECK_FUNCS(snprintf vsnprintf)
+fi
+
+dnl Check for "long long" support...
+AC_CACHE_CHECK(for long long int, ac_cv_c_long_long,
+ [if test "$GCC" = yes; then
+ ac_cv_c_long_long=yes
+ else
+ AC_TRY_COMPILE(,[long long int i;],
+ ac_cv_c_long_long=yes,
+ ac_cv_c_long_long=no)
+ fi])
+
+if test $ac_cv_c_long_long = yes; then
+ AC_DEFINE(HAVE_LONG_LONG)
+fi
+
+dnl Threading support
+AC_ARG_ENABLE(threads, [ --enable-threads enable multi-threading support])
+
+have_pthread=no
+PTHREAD_FLAGS=""
+PTHREAD_LIBS=""
+
+if test "x$enable_threads" != xno; then
+ AC_CHECK_HEADER(pthread.h, AC_DEFINE(HAVE_PTHREAD_H))
+
+ if test x$ac_cv_header_pthread_h = xyes; then
+ dnl Check various threading options for the platforms we support
+ for flag in -lpthreads -lpthread -pthread; do
+ AC_MSG_CHECKING([for pthread_create using $flag])
+ SAVELIBS="$LIBS"
+ LIBS="$flag $LIBS"
+ AC_TRY_LINK([#include <pthread.h>],
+ [pthread_create(0, 0, 0, 0);],
+ have_pthread=yes)
+ AC_MSG_RESULT([$have_pthread])
+ LIBS="$SAVELIBS"
+
+ if test $have_pthread = yes; then
+ PTHREAD_FLAGS="-D_THREAD_SAFE -D_REENTRANT"
+ PTHREAD_LIBS="$flag"
+
+ # Solaris requires -D_POSIX_PTHREAD_SEMANTICS to
+ # be POSIX-compliant... :(
+ if test $uname = SunOS; then
+ PTHREAD_FLAGS="$PTHREAD_FLAGS -D_POSIX_PTHREAD_SEMANTICS"
+ fi
+ break
+ fi
+ done
+ fi
+fi
+
+AC_SUBST(PTHREAD_FLAGS)
+AC_SUBST(PTHREAD_LIBS)
+
+dnl Shared library support...
+DSO="${DSO:=:}"
+DSOFLAGS="${DSOFLAGS:=}"
+
+AC_ARG_ENABLE(shared, [ --enable-shared turn on shared libraries, default=no])
+
+if test x$enable_shared = xyes; then
+ AC_MSG_CHECKING(for shared library support)
+ PICFLAG=1
+
+ case "$uname" in
+ SunOS* | UNIX_S*)
+ AC_MSG_RESULT(yes)
+ LIBMXML="libmxml.so.1.4"
+ DSO="\$(CC)"
+ DSOFLAGS="$DSOFLAGS -Wl,-h,libmxml.so.1 -G -R\$(libdir) \$(OPTIM)"
+ LDFLAGS="$LDFLAGS -R\$(libdir)"
+ ;;
+
+ HP-UX*)
+ AC_MSG_RESULT(yes)
+ LIBMXML="libmxml.sl.1"
+ DSO="ld"
+ DSOFLAGS="$DSOFLAGS -b -z +h libmxml.sl.1 +s +b \$(libdir)"
+ LDFLAGS="$LDFLAGS -Wl,+s,+b,\$(libdir)"
+ ;;
+
+ IRIX)
+ AC_MSG_RESULT(yes)
+ LIBMXML="libmxml.so.1.4"
+ DSO="\$(CC)"
+ DSOFLAGS="$DSOFLAGS -Wl,-rpath,\$(libdir),-set_version,sgi1.0,-soname,libmxml.so.1 -shared \$(OPTIM)"
+ ;;
+
+ OSF1* | Linux | GNU)
+ AC_MSG_RESULT(yes)
+ LIBMXML="libmxml.so.1.4"
+ DSO="\$(CC)"
+ DSOFLAGS="$DSOFLAGS -Wl,-soname,libmxml.so.1,-rpath,\$(libdir) -shared \$(OPTIM)"
+ LDFLAGS="$LDFLAGS -Wl,-rpath,\$(libdir)"
+ ;;
+
+ *BSD*)
+ AC_MSG_RESULT(yes)
+ LIBMXML="libmxml.so.1.4"
+ DSO="\$(CC)"
+ DSOFLAGS="$DSOFLAGS -Wl,-soname,libmxml.so.1,-R\$(libdir) -shared \$(OPTIM)"
+ LDFLAGS="$LDFLAGS -Wl,-R\$(libdir)"
+ ;;
+
+ Darwin*)
+ AC_MSG_RESULT(yes)
+ LIBMXML="libmxml.1.dylib"
+ DSO="\$(CC)"
+ DSOFLAGS="$DSOFLAGS \$(RC_CFLAGS) -dynamiclib -lc"
+ ;;
+
+ *)
+ AC_MSG_RESULT(no)
+ AC_MSG_WARN(shared libraries not supported on this platform.)
+ PICFLAG=0
+ LIBMXML="libmxml.a"
+ ;;
+ esac
+else
+ PICFLAG=0
+ LIBMXML="libmxml.a"
+fi
+
+AC_SUBST(DSO)
+AC_SUBST(DSOFLAGS)
+AC_SUBST(LIBMXML)
+AC_SUBST(PICFLAG)
+
+dnl Add -Wall for GCC...
+if test -n "$GCC"; then
+ CFLAGS="-Wall $CFLAGS"
+
+ if test "x$OPTIM" = x; then
+ OPTIM="-Os -g"
+ fi
+
+ if test "x$use_ansi" = xyes; then
+ CFLAGS="-ansi -pedantic $CFLAGS"
+ fi
+
+ if test $PICFLAG = 1 -a $uname != AIX; then
+ OPTIM="-fPIC $OPTIM"
+ fi
+else
+ case $uname in
+ HP-UX*)
+ CFLAGS="-Ae $CFLAGS"
+
+ if test "x$OPTIM" = x; then
+ OPTIM="-O"
+ fi
+
+ OPTIM="+DAportable $OPTIM"
+
+ if test $PICFLAG = 1; then
+ OPTIM="+z $OPTIM"
+ fi
+ ;;
+
+ UNIX_SVR* | SunOS*)
+ if test "x$OPTIM" = x; then
+ OPTIM="-O"
+ fi
+
+ if test $PICFLAG = 1; then
+ OPTIM="-KPIC $OPTIM"
+ fi
+ ;;
+
+ *)
+ if test "x$OPTIM" = x; then
+ OPTIM="-O"
+ fi
+ ;;
+ esac
+fi
+
+dnl Fix "prefix" variable if it hasn't been specified...
+if test "$prefix" = "NONE"; then
+ prefix="/usr/local"
+fi
+
+dnl Fix "exec_prefix" variable if it hasn't been specified...
+if test "$exec_prefix" = "NONE"; then
+ exec_prefix="$prefix"
+fi
+
+dnl Fix "docdir" variable if it hasn't been specified...
+if test "$docdir" = "NONE"; then
+ docdir="$datadir/doc/mxml"
+fi
+
+dnl Fix "mandir" variable if it hasn't been specified...
+if test "$mandir" = "\${prefix}/man" -a "$prefix" = "/usr"; then
+ case "$uname" in
+ *BSD* | Darwin* | Linux*)
+ # BSD, Darwin (MacOS X), and Linux
+ mandir="/usr/share/man"
+ ;;
+ IRIX*)
+ # SGI IRIX
+ mandir="/usr/share/catman/u_man"
+ ;;
+ *)
+ # All others
+ mandir="/usr/man"
+ ;;
+ esac
+fi
+
+dnl pkg-config stuff...
+if test "$includedir" != /usr/include; then
+ PC_CFLAGS="-I$includedir"
+else
+ PC_CFLAGS=""
+fi
+
+if test "$libdir" != /usr/lib; then
+ PC_LIBS="-L$libdir -lmxml"
+else
+ PC_LIBS="-lmxml"
+fi
+
+AC_SUBST(PC_CFLAGS)
+AC_SUBST(PC_LIBS)
+
+dnl Output the makefile, etc...
+AC_OUTPUT(Makefile mxml.list mxml.pc)
+
+dnl
+dnl End of "$Id: configure.in 387 2009-04-18 17:05:52Z mike $".
+dnl
diff -Naur mxml-2.6/doc/0.gif mxml-2.6-haiku/doc/0.gif
--- mxml-2.6/doc/0.gif 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/0.gif 2007-04-26 22:21:37.000000000 +0000
@@ -0,0 +1,5 @@
+GIF89add<00>
+
+
+  !!!"""###$$$%%%&&&'''((()))***+++,,,---...///000111222333444555666777888999:::;;;<<<===>>>???@@@AAABBBCCCDDDEEEFFFGGGHHHIIIJJJKKKLLLMMMNNNOOOPPPQQQRRRSSSTTTUUUVVVWWWXXXYYYZZZ[[[\\\]]]^^^___```aaabbbcccdddeeefffggghhhiiijjjkkklllmmmnnnooopppqqqrrrssstttuuuvvvwwwxxxyyyzzz{{{|||}}}~~~<7F><7F><80><80><80><81><81><81><82><82><82><83><83><83><84><84><84><85><85><85><86><86><86><87><87><87><88><88><88><89><89><89><8A><8A><8A><8B><8B><8B><8C><8C><8C><8D><8D><8D><8E><8E><8E><8F><8F><8F><90><90><90><91><91><91><92><92><92><93><93><93><94><94><94><95><95><95><96><96><96><97><97><97><98><98><98><99><99><99><9A><9A><9A><9B><9B><9B><9C><9C><9C><9D><9D><9D><9E><9E><9E><9F><9F><9F><A0><A0><A0><A1><A1><A1><A2><A2><A2><A3><A3><A3><A4><A4><A4><A5><A5><A5><A6><A6><A6><A7><A7><A7><A8><A8><A8><A9><A9><A9><AA><AA><AA><AB><AB><AB><AC><AC><AC><AD><AD><AD><AE><AE><AE><AF><AF><AF><B0><B0><B0><B1><B1><B1><B2><B2><B2><B3><B3><B3><B4><B4><B4><B5><B5><B5><B6><B6><B6><B7><B7><B7><B8><B8><B8><B9><B9><B9><BA><BA><BA><BB><BB><BB><BC><BC><BC><BD><BD><BD><BE><BE><BE><BF><BF><BF><C0><C0><C0><C1><C1><C1><C2><C2><C2><C3><C3><C3><C4><C4><C4><C5><C5><C5><C6><C6><C6><C7><C7><C7><C8><C8><C8><C9><C9><C9><CA><CA><CA><CB><CB><CB><CC><CC><CC><CD><CD><CD><CE><CE><CE><CF><CF><CF><D0><D0><D0><D1><D1><D1><D2><D2><D2><D3><D3><D3><D4><D4><D4><D5><D5><D5><D6><D6><D6><D7><D7><D7><D8><D8><D8><D9><D9><D9><DA><DA><DA><DB><DB><DB><DC><DC><DC><DD><DD><DD><DE><DE><DE><DF><DF><DF><E0><E0><E0><E1><E1><E1><E2><E2><E2><E3><E3><E3><E4><E4><E4><E5><E5><E5><E6><E6><E6><E7><E7><E7><E8><E8><E8><E9><E9><E9><EA><EA><EA><EB><EB><EB><EC><EC><EC><ED><ED><ED><EE><EE><EE><EF><EF><EF><F0><F0><F0><F1><F1><F1><F2><F2><F2><F3><F3><F3><F4><F4><F4><F5><F5><F5><F6><F6><F6><F7><F7><F7><F8><F8><F8><F9><F9><F9><FA><FA><FA><FB><FB><FB><FC><FC><FC><FD><FD><FD><FE><FE><FE><FF>,dd<08><00> H<>`A5*\Ȱ<>Ç#*Tc<54><63>ŋ<06>I<87>ȱ<DC><C8B1><03>0<C3><30>h<BC><68>ɓ(<28><>\<5C><>ʗ0;<3B>ay1<79>͛i$<24><><85>τ<A7>t<A4>k<FE><6B>(<28>&4a]j<13>J<C6>L<A2><4C>D<BE><44><8A>ԫ'<27><><83><D6><C4><CA>֮ yd<79><64><AA><E6>5MD<4D>*<2A><><AC>k<1D><><96><94>,<2C><15>Ё<0E>,)u<>]<5D>RU<0E>*<2A>oE?RjdzͰ<7A>{QC<51><43><FE><8B>1ƨ<02>޳,<2C>if<69><66>9_<<3C><>¢'D<>Lb<4C>tQ<74>+<2B><>4{$d<>'u<>hD'n<><6E>XƋ(<28>%<25><><1E>o<85><6F>9<>1<C7>9<CD><39><B2>\"K !D<><44>p<FE><70><BB><F4><1D><><1E><>c<E4><63>6<95>7<C2><06><>Ht<48>z<>8_}<7D><><FD><8D><F7>|v<>W<D2><57>3<F8><33><AC>G<9A><47>TC| <09><>v&<26>5<D9>&<1E><>O<EE89B4><4F><84>G<E1>~<1B>סsZ<>!r!FT<46>l'v7<76>o):<3A>bW/ʷ"n1.T<>U7&<26>#f3<66>ԣZ;<3B><>ُ. <09><>2<91><32>!<21>62<36><32><89>:Bɣ<42>( Y<><59>V<15><>CR<43><1B>WziR<69><52>a <09><>f<96>ޖjrئ<72>o:<3A>M<E7><18><13>+)eU"<12><>"]rR,+<2B><>d<B5>&<26>fgc*<2A>&<26>>B<><42>&+<2B><>Q+qaB<61>2
+<2B><><A7><A7>H&S<12>><3E>*<2A>K<>l<BB> K<><0F><>K<>DD M<>*d<>N4T<34>N<82><4E>:km<6B><6D>j<08><18>!l<><6C>V<C8>l<B4><6C><0E><>B6D;<3B>L <0A><>\<5C>~<7E><>dL<64><4C>-<2D>R<8F>@<40><08><><89><81>hz<68><7A><FD>THX6V<>uu<75>]U)_]<5D>1 j &<26><>]<0E><16>EqKİOU=|<7C>VA%1J|b<><62><A4>9Œ<39>o<><6F>JV<4A><11>B<C5><1C>a<07>|<7C>–<80>˱<F1><CBB1><C0><B5>ph֚<68>,E;
\ No newline at end of file
diff -Naur mxml-2.6/doc/1.gif mxml-2.6-haiku/doc/1.gif
--- mxml-2.6/doc/1.gif 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/1.gif 2007-04-26 22:21:37.000000000 +0000
@@ -0,0 +1,7 @@
+GIF89add<00>
+
+
+  !!!"""###$$$%%%&&&'''((()))***+++,,,---...///000111222333444555666777888999:::;;;<<<===>>>???@@@AAABBBCCCDDDEEEFFFGGGHHHIIIJJJKKKLLLMMMNNNOOOPPPQQQRRRSSSTTTUUUVVVWWWXXXYYYZZZ[[[\\\]]]^^^___```aaabbbcccdddeeefffggghhhiiijjjkkklllmmmnnnooopppqqqrrrssstttuuuvvvwwwxxxyyyzzz{{{|||}}}~~~<7F><7F><80><80><80><81><81><81><82><82><82><83><83><83><84><84><84><85><85><85><86><86><86><87><87><87><88><88><88><89><89><89><8A><8A><8A><8B><8B><8B><8C><8C><8C><8D><8D><8D><8E><8E><8E><8F><8F><8F><90><90><90><91><91><91><92><92><92><93><93><93><94><94><94><95><95><95><96><96><96><97><97><97><98><98><98><99><99><99><9A><9A><9A><9B><9B><9B><9C><9C><9C><9D><9D><9D><9E><9E><9E><9F><9F><9F><A0><A0><A0><A1><A1><A1><A2><A2><A2><A3><A3><A3><A4><A4><A4><A5><A5><A5><A6><A6><A6><A7><A7><A7><A8><A8><A8><A9><A9><A9><AA><AA><AA><AB><AB><AB><AC><AC><AC><AD><AD><AD><AE><AE><AE><AF><AF><AF><B0><B0><B0><B1><B1><B1><B2><B2><B2><B3><B3><B3><B4><B4><B4><B5><B5><B5><B6><B6><B6><B7><B7><B7><B8><B8><B8><B9><B9><B9><BA><BA><BA><BB><BB><BB><BC><BC><BC><BD><BD><BD><BE><BE><BE><BF><BF><BF><C0><C0><C0><C1><C1><C1><C2><C2><C2><C3><C3><C3><C4><C4><C4><C5><C5><C5><C6><C6><C6><C7><C7><C7><C8><C8><C8><C9><C9><C9><CA><CA><CA><CB><CB><CB><CC><CC><CC><CD><CD><CD><CE><CE><CE><CF><CF><CF><D0><D0><D0><D1><D1><D1><D2><D2><D2><D3><D3><D3><D4><D4><D4><D5><D5><D5><D6><D6><D6><D7><D7><D7><D8><D8><D8><D9><D9><D9><DA><DA><DA><DB><DB><DB><DC><DC><DC><DD><DD><DD><DE><DE><DE><DF><DF><DF><E0><E0><E0><E1><E1><E1><E2><E2><E2><E3><E3><E3><E4><E4><E4><E5><E5><E5><E6><E6><E6><E7><E7><E7><E8><E8><E8><E9><E9><E9><EA><EA><EA><EB><EB><EB><EC><EC><EC><ED><ED><ED><EE><EE><EE><EF><EF><EF><F0><F0><F0><F1><F1><F1><F2><F2><F2><F3><F3><F3><F4><F4><F4><F5><F5><F5><F6><F6><F6><F7><F7><F7><F8><F8><F8><F9><F9><F9><FA><FA><FA><FB><FB><FB><FC><FC><FC><FD><FD><FD><FE><FE><FE><FF>,dd<08><00> H<>`A5*\Ȱ<>Ç#*Tc<54><63>ŋ<06>I<87>ȱ<DC><C8B1><03>0<C3><30>h<BC><68>ɓ(<28><>\<5C><>ʗ0;<3B>ay1<79>͛i$<24><><85>τ<A7>t<A4>k<FE><6B>(<28>&4a]j<13>J<C6>L<A2><4C>D<BE><44><8A>ԫ'<27><><83><D6><C4><CA>֮`9Vt<19>lę<05>6<CD>*<2A>`I<>
+<2B><><A9><B0>r ܅<18><0E>x<D4><78><F7><80>\C<><43><FE>P$X<><58>i<19>;<3B>.<2E><><8F><11><><C2><12>d<AC><64>X<12><>@<40><><E7><1B>6<84><36>sD:шI<D188>T<9F><54>EI<>PT}R<>b<F6>m<03><>Q<DD>\<5C>}[<04>[<5B>l<F8><1B>G\9A<39><12>?<3F><>Szj<7A>75c<35>^y<>M<BB><4D>aނ<0F>r<y<><79><93><E6><CF><E7>=<3D><><FB>!<21><><C3>~~<7E><><F2><FA><F6><9B>?<><7F><FD>W<FD>:<3A>^<5E>xᇠB.x@<40> B<><42><88>R(<28><><A0>aȟ<61><C89F>qh<71><68><9F><87><08><>푨<88><ED91A8><9E><89>H<A1><48><9E><8A>蝋<B1><E89D8B><DB><C1><88><9D><8C><08><><9D>ሜ<CC><E1889C><8E><08><><9C><01><>ef <09>Ew<19>`<60>
+2u]<5D>M.%_P<18>`<60>9X<39>@oi<6F>Q]vy<76><79>@d<><64>Zi<5A><69><99>ojV<6A><56>BZ]<04><>T<9A><54><89><A4>N<99>4<B1><34>u<83>dՂq
+<15>neڇ<65>o]<5D><07>sTz<54><7A>u<11>E<>;
\ No newline at end of file
diff -Naur mxml-2.6/doc/2.gif mxml-2.6-haiku/doc/2.gif
--- mxml-2.6/doc/2.gif 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/2.gif 2007-04-26 22:21:37.000000000 +0000
@@ -0,0 +1,9 @@
+GIF89add<00>
+
+
+  !!!"""###$$$%%%&&&'''((()))***+++,,,---...///000111222333444555666777888999:::;;;<<<===>>>???@@@AAABBBCCCDDDEEEFFFGGGHHHIIIJJJKKKLLLMMMNNNOOOPPPQQQRRRSSSTTTUUUVVVWWWXXXYYYZZZ[[[\\\]]]^^^___```aaabbbcccdddeeefffggghhhiiijjjkkklllmmmnnnooopppqqqrrrssstttuuuvvvwwwxxxyyyzzz{{{|||}}}~~~<7F><7F><80><80><80><81><81><81><82><82><82><83><83><83><84><84><84><85><85><85><86><86><86><87><87><87><88><88><88><89><89><89><8A><8A><8A><8B><8B><8B><8C><8C><8C><8D><8D><8D><8E><8E><8E><8F><8F><8F><90><90><90><91><91><91><92><92><92><93><93><93><94><94><94><95><95><95><96><96><96><97><97><97><98><98><98><99><99><99><9A><9A><9A><9B><9B><9B><9C><9C><9C><9D><9D><9D><9E><9E><9E><9F><9F><9F><A0><A0><A0><A1><A1><A1><A2><A2><A2><A3><A3><A3><A4><A4><A4><A5><A5><A5><A6><A6><A6><A7><A7><A7><A8><A8><A8><A9><A9><A9><AA><AA><AA><AB><AB><AB><AC><AC><AC><AD><AD><AD><AE><AE><AE><AF><AF><AF><B0><B0><B0><B1><B1><B1><B2><B2><B2><B3><B3><B3><B4><B4><B4><B5><B5><B5><B6><B6><B6><B7><B7><B7><B8><B8><B8><B9><B9><B9><BA><BA><BA><BB><BB><BB><BC><BC><BC><BD><BD><BD><BE><BE><BE><BF><BF><BF><C0><C0><C0><C1><C1><C1><C2><C2><C2><C3><C3><C3><C4><C4><C4><C5><C5><C5><C6><C6><C6><C7><C7><C7><C8><C8><C8><C9><C9><C9><CA><CA><CA><CB><CB><CB><CC><CC><CC><CD><CD><CD><CE><CE><CE><CF><CF><CF><D0><D0><D0><D1><D1><D1><D2><D2><D2><D3><D3><D3><D4><D4><D4><D5><D5><D5><D6><D6><D6><D7><D7><D7><D8><D8><D8><D9><D9><D9><DA><DA><DA><DB><DB><DB><DC><DC><DC><DD><DD><DD><DE><DE><DE><DF><DF><DF><E0><E0><E0><E1><E1><E1><E2><E2><E2><E3><E3><E3><E4><E4><E4><E5><E5><E5><E6><E6><E6><E7><E7><E7><E8><E8><E8><E9><E9><E9><EA><EA><EA><EB><EB><EB><EC><EC><EC><ED><ED><ED><EE><EE><EE><EF><EF><EF><F0><F0><F0><F1><F1><F1><F2><F2><F2><F3><F3><F3><F4><F4><F4><F5><F5><F5><F6><F6><F6><F7><F7><F7><F8><F8><F8><F9><F9><F9><FA><FA><FA><FB><FB><FB><FC><FC><FC><FD><FD><FD><FE><FE><FE><FF>,dd<08><00> H<>`A5*\Ȱ<>Ç#*Tc<54><63>ŋ<06>I<87>ȱ<DC><C8B1><03>0<C3><30>h<BC><68>ɓ(<28><>\<5C><>ʗ0;<3B>ay1<79>͛i$<24><><85>τ<A7>t<A4>k<FE><6B>(<28>&4a]j<13>J<C6>L<A2><4C>D<BE><44><8A>ԫ'<27><><83><D6><C4><CA>֮`9Vt<56>Ջ<C9><D58B>v<95><76>,<2C>u<88>Ё<8E><D081>,<19><>ۊRU<0E>:<3A><>EwQj\ͯH KC<4B>c<FE><63><CA><CF>0K.<2E><>x<E7> <20><><A3>&<26><>2H<32>j<7F>L<E0>h蟤u<E89FA4>=y)5M<<3C><><AB><BD>W<F4>ᒷ<82>;fQ Q<>N9<4E>7<B9>\'<27>t<B6><74>Ƌ<88><<0E>ˏXb<>0<EE>Jv&<26>SW<53><57><F8><DC><E4>۹<EE>/? ><3E><><FC><1E>o_
+<2B>z<A5>+<2B><>o<><6F><FE><0E>G<F3>O<D6>2A~<7E><><91><07>H_v<06>Y<F8>
+<2B><><F6>{ <0A><04>J<CF>D<D1><44>H<E0>Y<FE><59>=jx<6A>w+<2B><><89>Mv8bz,<2C>qbL<62><4C>xR-<2D><>Q :a <20>I<A3><49>Dō5F<35><<3C>H<A2>Ar<41><72>P7<14>Q=BA<42>dD0
+<2B>dD<64>5ϔ9 5<07>9'\6d<36>N<9D><4E><F4><84>[;<3B><><10>R<8D><52>"B<11>fB<66><42>8gB<67><42>杨<>yg:<3A>s<C1>x,Y3(4<7F>s<95>pjwg<77>w<8C>B<8A>'<27>
+<2B><1A><>ap)n<><6E><FB>)<29><>}
+*s<><73><1A> <0C>:J<>,<2C><>[<5B>p<AB>zt<1A><><8B>wE8<45>j<D5>M<AB><4D><99>k<AA>7<81>J<F5><4A><16><><E5>`<60>k<>M<D0>-V<>p<03><><D1>Cz<43>5<ED>C<06>u<91>Bk<42><6B><B1>B_m[շZ]ճT<D5B3><54>T<A4>N<A5>t<B1><74><EE><9D>d՜<64><D59C>ife<66>N<DA>me<6D>Y<>kȺ<6B>l<D8><6C>*H<>];
\ No newline at end of file
diff -Naur mxml-2.6/doc/3.gif mxml-2.6-haiku/doc/3.gif
--- mxml-2.6/doc/3.gif 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/3.gif 2007-04-26 22:21:37.000000000 +0000
@@ -0,0 +1,6 @@
+GIF89add<00>
+
+
+  !!!"""###$$$%%%&&&'''((()))***+++,,,---...///000111222333444555666777888999:::;;;<<<===>>>???@@@AAABBBCCCDDDEEEFFFGGGHHHIIIJJJKKKLLLMMMNNNOOOPPPQQQRRRSSSTTTUUUVVVWWWXXXYYYZZZ[[[\\\]]]^^^___```aaabbbcccdddeeefffggghhhiiijjjkkklllmmmnnnooopppqqqrrrssstttuuuvvvwwwxxxyyyzzz{{{|||}}}~~~<7F><7F><80><80><80><81><81><81><82><82><82><83><83><83><84><84><84><85><85><85><86><86><86><87><87><87><88><88><88><89><89><89><8A><8A><8A><8B><8B><8B><8C><8C><8C><8D><8D><8D><8E><8E><8E><8F><8F><8F><90><90><90><91><91><91><92><92><92><93><93><93><94><94><94><95><95><95><96><96><96><97><97><97><98><98><98><99><99><99><9A><9A><9A><9B><9B><9B><9C><9C><9C><9D><9D><9D><9E><9E><9E><9F><9F><9F><A0><A0><A0><A1><A1><A1><A2><A2><A2><A3><A3><A3><A4><A4><A4><A5><A5><A5><A6><A6><A6><A7><A7><A7><A8><A8><A8><A9><A9><A9><AA><AA><AA><AB><AB><AB><AC><AC><AC><AD><AD><AD><AE><AE><AE><AF><AF><AF><B0><B0><B0><B1><B1><B1><B2><B2><B2><B3><B3><B3><B4><B4><B4><B5><B5><B5><B6><B6><B6><B7><B7><B7><B8><B8><B8><B9><B9><B9><BA><BA><BA><BB><BB><BB><BC><BC><BC><BD><BD><BD><BE><BE><BE><BF><BF><BF><C0><C0><C0><C1><C1><C1><C2><C2><C2><C3><C3><C3><C4><C4><C4><C5><C5><C5><C6><C6><C6><C7><C7><C7><C8><C8><C8><C9><C9><C9><CA><CA><CA><CB><CB><CB><CC><CC><CC><CD><CD><CD><CE><CE><CE><CF><CF><CF><D0><D0><D0><D1><D1><D1><D2><D2><D2><D3><D3><D3><D4><D4><D4><D5><D5><D5><D6><D6><D6><D7><D7><D7><D8><D8><D8><D9><D9><D9><DA><DA><DA><DB><DB><DB><DC><DC><DC><DD><DD><DD><DE><DE><DE><DF><DF><DF><E0><E0><E0><E1><E1><E1><E2><E2><E2><E3><E3><E3><E4><E4><E4><E5><E5><E5><E6><E6><E6><E7><E7><E7><E8><E8><E8><E9><E9><E9><EA><EA><EA><EB><EB><EB><EC><EC><EC><ED><ED><ED><EE><EE><EE><EF><EF><EF><F0><F0><F0><F1><F1><F1><F2><F2><F2><F3><F3><F3><F4><F4><F4><F5><F5><F5><F6><F6><F6><F7><F7><F7><F8><F8><F8><F9><F9><F9><FA><FA><FA><FB><FB><FB><FC><FC><FC><FD><FD><FD><FE><FE><FE><FF>,dd<08><00> H<>`A5*\Ȱ<>Ç#*Tc<54><63>ŋ<06>I<87>ȱ<DC><C8B1><03>0<C3><30>h<BC><68>ɓ(<28><>\<5C><>ʗ0;<3B>ay1<79>͛i$<24><><85>τ<A7>t<A4>k<FE><6B>(<28>&4a]j<13>J<C6>L<A2><4C>D<BE><44><8A>ԫ'<27><><83><D6><C4><CA>֮b<18>U<FA>^<5E>g<BB><67><9D>UX<55>%V]4<><34><FB>:<3A><>UDB <09><>Z<C3>$SGy-JU9<55>)<29><><18>D<1D><>(<16>"<22>1 <0A>oi(<28>+<2B>
+4<><07><>~K7<4B><37><FF><BC>e*<2A><><10>,MӨj<D3A8><6A>X<E5>^{R6<52><05>?*ә<><D399>(<28><>=Ҭ Qg<51><67>,<2C><>$~<<3C><><E2>':F`ɫy<C9AB><79>±[w<>r<B8><72>9ڷ<39>3<FE>l2<6C>x<BC>#k<>?<3F>p}<7D><><F6><F4><EC><DB><C3>>~}<7D><><8E><E6>߸<DF>_|<7C>$<24><14>Qͳ<1F>=<3D><> NѬ<4E>܂><3E><> <20>0=1!<21>(<28>4<01>19<31><39>N,pXd<16>8b`&<26>'<27>.)<29><><AA>$-<2D><><9E>1*<2A><>?5<><35>9<>T=r<><1A>A.<2E><>x<>C<1B> V$G<08>ϓi<><69>T<>7[<5B><>]ȥB<01>Tȗ]HfB.xy<78><79>d<9A><64><B2><F9>`<60>ِ<C1>\<5C>)<29>|<7C>ى<1E><>限<E2><E99990><9F><19><02>j&<26>I<E6><14><>=v<1E><>QC<51>4<B0>{#AA<41>p6
+z<>NO<4E><4F>e|'U<>C<C2>‚<><01>` <0A><><A9><01><><85><91><AD><0F><>b$b<><62>D<>O<E4><4F>dF<64>=<3D>EK=,n<>U<A8><55><05>*<2A>><3E>*hcLA<4C><41>1WQ<57><51>T؀| <0A>V IJ<>87<38>EXag<61>(<28>[<5B>rT<72>]<5D>jYQ<59>eVd<15> iuT<>*D<>HJ|<7C>S,\<5C><>,<2C>ۮ<ED><DBAE><BF><AA><19>T<BC><54>ٸ=<3D>k<1B>-j l<>RX@;
\ No newline at end of file
diff -Naur mxml-2.6/doc/4.gif mxml-2.6-haiku/doc/4.gif
--- mxml-2.6/doc/4.gif 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/4.gif 2007-04-26 22:21:37.000000000 +0000
@@ -0,0 +1,6 @@
+GIF89add<00>
+
+
+  !!!"""###$$$%%%&&&'''((()))***+++,,,---...///000111222333444555666777888999:::;;;<<<===>>>???@@@AAABBBCCCDDDEEEFFFGGGHHHIIIJJJKKKLLLMMMNNNOOOPPPQQQRRRSSSTTTUUUVVVWWWXXXYYYZZZ[[[\\\]]]^^^___```aaabbbcccdddeeefffggghhhiiijjjkkklllmmmnnnooopppqqqrrrssstttuuuvvvwwwxxxyyyzzz{{{|||}}}~~~<7F><7F><80><80><80><81><81><81><82><82><82><83><83><83><84><84><84><85><85><85><86><86><86><87><87><87><88><88><88><89><89><89><8A><8A><8A><8B><8B><8B><8C><8C><8C><8D><8D><8D><8E><8E><8E><8F><8F><8F><90><90><90><91><91><91><92><92><92><93><93><93><94><94><94><95><95><95><96><96><96><97><97><97><98><98><98><99><99><99><9A><9A><9A><9B><9B><9B><9C><9C><9C><9D><9D><9D><9E><9E><9E><9F><9F><9F><A0><A0><A0><A1><A1><A1><A2><A2><A2><A3><A3><A3><A4><A4><A4><A5><A5><A5><A6><A6><A6><A7><A7><A7><A8><A8><A8><A9><A9><A9><AA><AA><AA><AB><AB><AB><AC><AC><AC><AD><AD><AD><AE><AE><AE><AF><AF><AF><B0><B0><B0><B1><B1><B1><B2><B2><B2><B3><B3><B3><B4><B4><B4><B5><B5><B5><B6><B6><B6><B7><B7><B7><B8><B8><B8><B9><B9><B9><BA><BA><BA><BB><BB><BB><BC><BC><BC><BD><BD><BD><BE><BE><BE><BF><BF><BF><C0><C0><C0><C1><C1><C1><C2><C2><C2><C3><C3><C3><C4><C4><C4><C5><C5><C5><C6><C6><C6><C7><C7><C7><C8><C8><C8><C9><C9><C9><CA><CA><CA><CB><CB><CB><CC><CC><CC><CD><CD><CD><CE><CE><CE><CF><CF><CF><D0><D0><D0><D1><D1><D1><D2><D2><D2><D3><D3><D3><D4><D4><D4><D5><D5><D5><D6><D6><D6><D7><D7><D7><D8><D8><D8><D9><D9><D9><DA><DA><DA><DB><DB><DB><DC><DC><DC><DD><DD><DD><DE><DE><DE><DF><DF><DF><E0><E0><E0><E1><E1><E1><E2><E2><E2><E3><E3><E3><E4><E4><E4><E5><E5><E5><E6><E6><E6><E7><E7><E7><E8><E8><E8><E9><E9><E9><EA><EA><EA><EB><EB><EB><EC><EC><EC><ED><ED><ED><EE><EE><EE><EF><EF><EF><F0><F0><F0><F1><F1><F1><F2><F2><F2><F3><F3><F3><F4><F4><F4><F5><F5><F5><F6><F6><F6><F7><F7><F7><F8><F8><F8><F9><F9><F9><FA><FA><FA><FB><FB><FB><FC><FC><FC><FD><FD><FD><FE><FE><FE><FF>,dd<08><00> H<>`A5*\Ȱ<>Ç#*Tc<54><63>ŋ<06>I<87>ȱ<DC><C8B1><03>0<C3><30>h<BC><68>ɓ(<28><>\<5C><>ʗ0;<3B>ay1<79>͛i$<24><><85>τ<A7>t<A4>k<FE><6B>(<28>&4a]j<13>J<C6>L<A2><4C>D<BE><44><8A>ԫ'<27><><83><D6><C4><CA>֮`9Vt<19>lę<05>2<CD>H<A4>h<D3><68>j
+5<>r`\<5C><><85><E9><15><>.<02><><A1><FF> |<7C>`<60>{ S9<53>T`<60>È<E1><C388>Cwd<><64><A6>B<E3>\<5C><>fΝq<02>Z2<5A><32>=<3D>}<06><><8D>j֭Mb<4D><62>2v<32> <0A><> #<0E>#y<><79><A3><1B>H<B8>'<27>W<>\<5C><>\rw7<77><18>y<82><79>1<>Xx;<3B>P̗<50><FE><7F>0<EE>x<BC><78><1F><><FA><BB>a<A9><61>
+-<2D>?_>C<><14>K<CA>`<60><>|<0F><07>| H><17><><ED>~<7E>9@`<60> <0C><><92>8]<17>#<23><><91>=]p<><70>sQ<17>E<D9>\~x<><78><9C>Uh<55>p`\<5C>MGږ"w/<2F>F<DA>E@xT#j<6A><7F>a<B8><61><8E>x<1F><>-qQ_>"<19><>G<91><47><82>kT<6B>fV<66><56><95><AF><A1>jZn<5A>Y<B9>^2VZ<56><5A><98>I&``<60>ٖ<9E>j<99><6A>d<F9>nvg<><67>-(e<><65>9<B2>g<89>z<80><7A>^<5E>~<7E>xg<78>%J<><4A><A8><1E>g<CA><67><A2><8A>h<C9><68><A3><08><><A9><1A><19><><9B>DQl?<3F><>X<E4><58>&g<>Z<A5><5A><9D><0F>o><1A>`<60>N<A3><4E>?Kp<4B><70>Q]v<><76>$Ad<41>*Zi<5A>:d}<7D>.Z<>U<91>.<2E><>EP{U")U<>S,%k+<2B>,<11><><EB>zM<7A>Z<BA><5A><AE><84>Z<BA>xҊ%<25>鱪楼<E9B1AA>X@;
\ No newline at end of file
diff -Naur mxml-2.6/doc/5.gif mxml-2.6-haiku/doc/5.gif
--- mxml-2.6/doc/5.gif 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/5.gif 2007-04-26 22:21:37.000000000 +0000
@@ -0,0 +1,5 @@
+GIF89add<00> 
+ 
+
+    ! "! #"!$#"%$#&%#'&$'&$('%)(&*)'+*(,+)-,*.-,0/-10.21/320431542653665886997::8;;9<<:=<;>=<?>=@?>A@?BA@CBADCBEDCFEDGFEHGFIHHKJILKJMLKNMLONNQPORQPSRQTSRUTSUUTVVUWWVXXWYYY[[Z\\[]]\^^]__^``_a``baacbbdcbedcfedgfehgfihgjihkjilkjmlknmlonmponqporqpsrqtsrttsuutvvuwwvxxwyyxzzy{{z||{}}|~~}~<7E><><80><7F><81><81><80><82><82><81><83><83><82><84><83><83><85><84><84><86><85><85><87><86><86><88><87><88><8A><89><89><8B><8A><8A><8C><8B><8B><8D><8C><8C><8E><8D><8D><8F><8E><8E><90><8F><8F><91><90><90><92><91><92><93><93><93><94><94><95><96><96><96><97><97><97><98><98><98><99><99><99><9A><9A><9A><9B><9B><9C><9D><9D><9D><9E><9E><9E><9F><9F><9F><A0><A0><A0><A1><A1><A1><A2><A2><A1><A3><A3><A2><A4><A4><A3><A5><A5><A4><A6><A6><A5><A7><A6><A6><A8><A7><A7><A9><A8><A8><AA><A9><A9><AB><AA><AA><AC><AB><AB><AD><AC><AC><AE><AD><AD><AF><AE><AE><B0><AF><AF><B1><B0><B0><B2><B1><B1><B2><B2><B2><B3><B3><B3><B4><B4><B4><B5><B5><B5><B6><B6><B6><B7><B7><B7><B8><B8><B8><B9><B9><B9><BA><BA><BA><BB><BB><BB><BC><BC><BC><BD><BD><BD><BE><BE><BE><BF><BF><BF><C0><C0><C0><C1><C1><C1><C2><C2><C2><C3><C3><C3><C4><C4><C4><C5><C5><C5><C6><C6><C6><C7><C7><C7><C8><C8><C8><C9><C9><CA><CB><CA><CB><CC><CB><CC><CD><CC><CD><CE><CD><CE><CF><CE><CF><D0><CF><D0><D1><D0><D1><D1><D1><D2><D2><D2><D3><D3><D3><D4><D4><D4><D5><D5><D5><D6><D6><D6><D7><D7><D7><D8><D8><D8><D9><D9><D9><DA><DA><DA><DB><DB><DB><DC><DC><DC><DD><DD><DD><DE><DE><DE><DF><DF><DF><E0><E0><E0><E0><E1><E1><E1><E2><E2><E3><E4><E4><E4><E5><E5><E5><E6><E6><E7><E8><E8><E8><E9><E9><E9><EA><EA><EA><EB><EB><EB><EC><EC><EC><ED><ED><ED><EE><ED><EE><EF><EE><EF><F0><EF><F0><F0><F0><F1><F1><F1><F2><F2><F2><F3><F3><F3><F4><F4><F4><F5><F5><F5><F6><F6><F6><F7><F7><F7><F8><F8><F8><F9><F9><F9><FA><FA><FA><FB><FB><FB><FC><FC><FC><FD><FD><FD><FE><FE><FE><FF>,dd<08><00> H<>`A1*\Ȱ<>Ç#*c<><63>ŋsI<73>ȱ<DC>G<00>0<B9><30><8A><BC><F8>ɓ(<28><>\I<>ʗ0;<3B>ay1<79>͛iԄ<><D484>τ<A7>t<9A>3<D2><33>(N#4U]jS<6A>J<C5>L<A2><4C>D<BE><44><8A>ԫ'<27><><83><D6><C4><CA>֮`9Vt<19>lę<05>"<11>V`ς%<25><>j˶<6A>ʁK<CA81><4B>}+P<>Q<A3>B}<7D><><86><14>Οn<CE9F>f<><66><89>Q<18><19><><FB><A4>(<28><>+V<7F><56>y<8B>Y<A4><59>=6Z<>hҥ<68><D2A5><BF>h!<21><><B5>a<>m<84>4<D6><34><ED>owͭ+<2B>U<C6><55><0E><>#8<>9<D6><39>_=<3D>\yT<79><54>9<CE><39><BF><8E>"<22><>^<5E>U<E4>&<26><>G<BA>l<14>ڠ<FE><DAA0>{D,<00><>6<D0>y<98><79>f<CF><03><><8C>B<FD><05><>O<D9><4F><88><DF><E0><FE><FE>`<60><>1`A<>xWˁ@<1D>*<2A><>*9<10><><0F><>Ct4<74>Q6<51>9ǒ <11><>ʡ<>R ߱<14>r<8F><72><9B><8C>G<06>$<24>hIÒz<C392><7A><FB>R<C4>=<3D>dc<64>/<2F> <19><>e<A0>d<86>8.镒N><3E>d<D9>bAIe<49>S^ёZJ<5A>e<C4>9Y d<>i<96><69>2 <09>j<DD><6A><F3>JY|<7C><>-+͡&F<>􆆜<05>R<C0><52> <09><><C0><A7><97><83>']<5D><>:<3A>є@Gi<47><04>n<A8>Д<A1>F<C2>v#M<t<>P<1D>aZ<1C><>Xt<58><74><1A>y<88><79><A3><BE><F3> 2<>YO(<28>c?]<5D><<3C><>Z<E1>k<94>Hu<48>Q˄<51>=~<15><>X <0A>+Ss<53><73><B1><00> V<><56><88>
+<2B>`݅<17>w<98><04>Ih<49>:nGӝ<47>PU<50>F<EA><46>EP<45><50>U")%<25>BN<42>o<><6F><BB>d<B2><64><95><BA>8<86>adiY<69>a<AE>.<2E>mg<6D><67><C9>l<6C>*GQ[;
\ No newline at end of file
diff -Naur mxml-2.6/doc/6.gif mxml-2.6-haiku/doc/6.gif
--- mxml-2.6/doc/6.gif 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/6.gif 2007-04-26 22:21:37.000000000 +0000
@@ -0,0 +1,7 @@
+GIF89add<00> 
+ 
+
+    ! "! #"!$#"%$#'&$'&$('%)(&*)'+*(,+)-,*.-+/.,0/-10.21/320431542653664775886997::8;;9<<:=<;>=<?>=@?>A@?BA@CBADCBEDCFEDGFEHGFIHGJIHKJILKJMLKNMLONMPONQPORQPSRQTSRUTSUUTVVUWWVXXWYYXZZY[[Z\\[]]\^^]__^``_a``baacbbdcbedcfedgfehgfihgjihkjilkjmlknmlonmponqporqpsrqtsrttsuutvvuwwvxxwyyxzzy{{{}}|~~~<7E><><80><7F><81><81><80><82><82><81><83><83><82><84><83><83><85><84><84><86><85><85><87><86><86><88><87><87><89><88><88><8A><89><89><8B><8A><8A><8C><8B><8B><8D><8C><8C><8E><8D><8D><8F><8E><8F><91><90><90><92><91><91><93><92><92><93><93><93><94><94><94><95><95><95><96><96><96><97><97><97><98><98><98><99><99><99><9A><9A><9A><9B><9B><9B><9C><9C><9C><9D><9D><9D><9E><9E><9E><9F><9F><A0><A1><A1><A1><A2><A2><A1><A3><A3><A2><A4><A4><A3><A5><A5><A4><A6><A6><A5><A7><A6><A6><A8><A7><A7><A9><A8><A8><AA><A9><A9><AB><AA><AA><AC><AB><AB><AD><AC><AC><AE><AD><AD><AF><AE><AE><B0><AF><AF><B1><B0><B0><B2><B1><B1><B2><B2><B2><B3><B3><B3><B4><B4><B4><B5><B5><B5><B6><B6><B6><B7><B7><B7><B8><B8><B8><B9><B9><B9><BA><BA><BA><BB><BB><BB><BC><BC><BC><BD><BD><BD><BE><BE><BE><BF><BF><BF><C0><C0><C0><C1><C1><C1><C2><C2><C2><C3><C3><C3><C4><C4><C5><C6><C6><C7><C8><C8><C8><C9><C9><C9><CA><CA><CA><CB><CA><CB><CC><CB><CC><CD><CC><CD><CE><CD><CE><CF><CE><CF><D0><CF><D0><D1><D0><D1><D1><D1><D2><D2><D2><D3><D3><D3><D4><D4><D4><D5><D5><D5><D6><D6><D6><D7><D7><D7><D8><D8><D8><D9><D9><D9><DA><DA><DA><DB><DB><DB><DC><DC><DC><DD><DD><DD><DE><DE><DE><DF><DF><DF><E0><E0><E0><E0><E1><E1><E1><E2><E2><E2><E3><E3><E3><E4><E4><E4><E5><E5><E5><E6><E6><E6><E7><E7><E7><E8><E8><E8><E9><E9><E9><EA><EA><EA><EB><EB><EB><EC><EC><EC><ED><ED><ED><EE><ED><EE><EF><EE><EF><F0><EF><F0><F0><F0><F1><F1><F1><F2><F2><F2><F3><F3><F3><F4><F4><F4><F5><F5><F5><F6><F6><F6><F7><F7><F7><F8><F8><F8><F9><F9><F9><FA><FA><FA><FB><FB><FB><FC><FC><FC><FD><FD><FD><FE><FE><FE><FF>,dd<08><00> H<>`A3*\Ȱ<>Ç#*4c<34><63>ŋ{I<>ȱ<DC>G<00>0<BD><30>(<28><>ɓ(<28><>\<5C>/ʗ0;<3B>ay1<79>͛i􄳧τ<F484B3A7>t<9E>C<E6><43>(N$4U]jS<6A>J<C5>L<A2><4C>D<BE><44><8A>ԫ'<27><><83><D6><C4><CA>֮ s0R6n<1D>R[<04><><80><12>֑<AC>\<5C>Y<9D>k
+<2B>YI-X<><58><02>1U9<10>8<AB><16>Ը<17><>FC<46><43>*<2A><><C0>F6<><36>1BQ͊9<CD8A><39><8F>p<8C><70><A9><E8>~<7E>6
+<2B><>J`a<>f<1B><>Ru<>6Y<19>D*, <0B><><ED>G8<47><38>s\i<><69>J<F8><1B>=<3D>:zĕWL<57><a<>!<21><>ݹ<E9><DDB9><FE><15>+<2B><>Wϣg<CFA3>G<BA><47><FD>#<23><>ߌ1<DF8C><31><CD><FC><A8><DB>I<00>E<><45><CC>2<><32><9E>G<16><07>.+ip<69>Cu<43>׍Pp<<3C>/<2F>U<E0>X&<26>!<21><><9C>!m<><6D>6<9C><36>,<2C>2<B5><Φy<><79><FA><B9>1<>HS<48>6<8D>d<AE>}<7D><><96>ȁ^<<06>:<3A>2^zl<7A><6C>{B<><42>$K@I3ԍD<D48D><44><8D>y<C9>E<B4><45><97>T<D1>I`<60>w<86>I<E3>(ݙd<DD99><64><8E>z,AզH<D5A6><48><93><C0>r# <09>^4wN)8<>ҧD+ݳ<> <0A>^7:\b$[<5B><>~5'F<>D<8D><44>K+ aiEV`Z<>zo9z<39><1C><>@<40> <0A><19>H<E6>}<7D><>J<C0><4A><14>iG,<2C>p <0C>BTL<54><4C><AE><AB> G~<7E>9<B0>/,<2C>64)<29>"M<>8t<38>P<16><><FE>E<1E>8mE<02>µue 7<>
+<2B><><B4>r<><72>R<CD><52><AB>c<97>FQD<51>l<DF><6C>v<84>2.<2E><><BA>dWQ<57>Z<03>1v<31>%<25>}r<>d<95>r<F8><72>P<AC>aE<61><45>]<5D>*$`V<18><><15><16>><3E><>-<2D>=I<><49><CA>Y<><59>K<F1>V$<24><>Q%<25>R({<7B>T<E4>-s<>2K"<22><>P<EC><50>ڬg۬1g ,<2C>l<F1>RL<52><4C><F0><B5>G`;
\ No newline at end of file
diff -Naur mxml-2.6/doc/7.gif mxml-2.6-haiku/doc/7.gif
--- mxml-2.6/doc/7.gif 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/7.gif 2007-04-26 22:21:37.000000000 +0000
@@ -0,0 +1,8 @@
+GIF89add<00> 
+ 
+
+    ! #"!$#"%$#&%#'&$'&$('%)(&*)'+*)-,*.-+/.,0/-10.21/320431542653664775886997::8;;9<<:=<;>==@?>A@ADCBEDFIHGJIHKJILKKNMLONMPONQPORQPSRQTSRUTSUUUWWWYYXZZY[[[]]\^^]__^``_a`acbbdcbedehgfihgjihkjilkjmlknmlonorqpsrqtsrttsuutvvuwwvxxwyyxzzy{{{}}|~~}~<7E><><80><7F><81><81><80><82><82><82><84><83><83><85><84><84><86><85><85><87><86><86><88><87><88><8A><89><8A><8C><8B><8B><8D><8C><8D><8F><8E><90><92><91><92><93><93><94><95><95><95><96><96><98><99><99><99><9A><9A><9A><9B><9B><9B><9C><9C><9C><9D><9D><9D><9E><9E><9F><A0><A0><A0><A1><A1><A1><A2><A2><A3><A5><A5><A5><A7><A6><A6><A8><A7><A7><A9><A8><A8><AA><A9><A9><AB><AA><AA><AC><AB><AB><AD><AC><AD><AF><AE><AE><B0><AF><AF><B1><B0><B0><B2><B1><B2><B3><B3><B5><B6><B6><B7><B8><B8><B8><B9><B9><B9><BA><BA><BA><BB><BB><BB><BC><BC><BD><BE><BE><BF><C0><C0><C0><C1><C1><C2><C3><C3><C3><C4><C4><C4><C5><C5><C5><C6><C6><C6><C7><C7><C8><C9><C9><CA><CB><CA><CB><CC><CB><CC><CD><CC><CD><CE><CD><CE><CF><CE><CF><D0><CF><D0><D1><D0><D1><D1><D1><D2><D2><D2><D3><D3><D3><D4><D4><D4><D5><D5><D5><D6><D6><D6><D7><D7><D7><D8><D8><D8><D9><D9><D9><DA><DA><DA><DB><DB><DB><DC><DC><DC><DD><DD><DD><DE><DE><DE><DF><DF><DF><E0><E0><E0><E0><E1><E1><E1><E2><E2><E2><E3><E3><E3><E4><E4><E5><E6><E6><E6><E7><E7><E7><E8><E8><E8><E9><E9><E9><EA><EA><EA><EB><EB><EC><ED><ED><ED><EE><ED><EE><EF><EE><F0><F0><F0><F2><F2><F2><F3><F3><F3><F4><F4><F4><F5><F5><F5><F6><F6><F6><F7><F7><F7><F8><F8><F8><F9><F9><F9><FA><FA><FA><FB><FB><FB><FC><FC><FC><FD><FD><FD><FE><FE><FE><FF>,dd<08><00> H<>`<60>+*\Ȱ<>Ç#*<2A>b<BC><62>ŋ3I<33>ȱ<DC>G<00>0<99><30><8A><BC><88>ɓ(<28><>\ ʗ0;<3B>ay1<79>͛i<1C><><84>τ<A7>tF<74><46><FB>(<28>4Q]j<13>J<C5>L<A2><4C>D<BE><44><8A>ԫ'<27><><83><D6><C4><CA>֮`9Vt<19>lęm
+]Kf<><66>1<92><31> S<><53><E5>s<9B>V<F3>+P<>Z<A3><5A><05>  g<><67> ֛<18><><EF>j:~,צ<>ɔך}<7D><><98>憝<F2>~Z<><5A><E7>V*8 v<><16>]W<><57><F6><82><CD>J<D8>X<DA><58><B7>-5<><35><0E><><BC><A5><<3C><><EA>ō<DD>@<40><><9E><BC>͍6<1B>,zQ̭+<16>A<E9><41>c#<23><>y<FE>)!<21>x<FB>#y<><79> <09><><C9><FC><FA><93>{<1D>J><3E><>#<23><><17>F?<3F>#<23><>'<27>JDh<>]t8<>HB(<28>:Hva<>
+%3-nta<74>`|<7C><>JCt8`~&B<><42><A4><15><>T<A4><54><8A>cC<63><43>(<28>J\<5C>萍<0E><><F2><C0><A3><82>h<FC>J`<60>8!FF2d<32><64><02>¤,%<25><>J<D0>H<89><48>J9X <09>O<><4F>I<F7><49>E<F6><45><A9>V<98>)<29><><A5>]<5D>T
+hnF<6E>U}<7D>i<B4>`RA#gYtF<74>k} w'X<><15>eD<04>5hC<08>y<E6><79><05><>hBh<42><68>hB_ZբZ]<04><>T<95><54>b<F4>N<92><4E>錝<B4>d<15><>
+<05>^<5E>:<18>^<11><><86><FA>a~<7E>hij&G[;
\ No newline at end of file
diff -Naur mxml-2.6/doc/8.gif mxml-2.6-haiku/doc/8.gif
--- mxml-2.6/doc/8.gif 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/8.gif 2007-04-26 22:21:37.000000000 +0000
@@ -0,0 +1,7 @@
+GIF89add<00> 
+ 
+
+    ! "! #"!$#"%$#&%#'&$'&$('%)(&*)'+*(,+)-,*.-+/.,0/-10.21/320431542653664775886997::8;;9<<:=<;>=<?>=@?>A@?BA@CBADCBEDCFEDGFEHGFIHGJIHKJILKJMLKNMLONMPONQPORQPSRQTSRUTSUUTVVUWWVXXXZZY[[Z\\[]]\^^]__^``_a``baacbbdcbedcfedgfehgfihgjihkjilkjmlknmlonmponqporqpsrqtsrttsuutvvuwwvxxwyyxzzy{{z||{}}|~~}~<7E><><80><7F><81><81><80><82><82><81><83><83><82><84><83><83><85><84><84><86><85><85><87><86><86><88><87><87><89><88><88><8A><89><89><8B><8A><8A><8C><8B><8B><8D><8C><8C><8E><8D><8D><8F><8E><8E><90><8F><8F><91><90><90><92><91><91><93><92><92><93><93><93><94><94><94><95><95><95><96><96><96><97><97><97><98><98><98><99><99><99><9A><9A><9A><9B><9B><9B><9C><9C><9C><9D><9D><9D><9E><9E><9E><9F><9F><9F><A0><A0><A0><A1><A1><A1><A2><A2><A1><A3><A3><A2><A4><A4><A3><A5><A5><A5><A7><A6><A6><A8><A7><A7><A9><A8><A8><AA><A9><AA><AC><AB><AB><AD><AC><AC><AE><AD><AD><AF><AE><AF><B1><B0><B0><B2><B1><B1><B2><B2><B2><B3><B3><B3><B4><B4><B4><B5><B5><B5><B6><B6><B6><B7><B7><B7><B8><B8><B8><B9><B9><B9><BA><BA><BA><BB><BB><BB><BC><BC><BC><BD><BD><BD><BE><BE><BE><BF><BF><BF><C0><C0><C0><C1><C1><C1><C2><C2><C2><C3><C3><C3><C4><C4><C4><C5><C5><C5><C6><C6><C6><C7><C7><C7><C8><C8><C8><C9><C9><C9><CA><CA><CA><CB><CA><CB><CC><CB><CC><CD><CC><CD><CE><CD><CE><CF><CE><CF><D0><CF><D0><D1><D0><D1><D1><D1><D2><D2><D2><D3><D3><D3><D4><D4><D4><D5><D5><D5><D6><D6><D6><D7><D7><D7><D8><D8><D8><D9><D9><D9><DA><DA><DA><DB><DB><DB><DC><DC><DC><DD><DD><DD><DE><DE><DE><DF><DF><DF><E0><E0><E0><E0><E1><E1><E1><E2><E2><E2><E3><E3><E3><E4><E4><E4><E5><E5><E5><E6><E6><E6><E7><E7><E7><E8><E8><E8><E9><E9><E9><EA><EA><EA><EB><EB><EB><EC><EC><EC><ED><ED><ED><EE><ED><EE><EF><EE><EF><F0><EF><F0><F0><F0><F1><F1><F1><F2><F2><F2><F3><F3><F3><F4><F4><F4><F5><F5><F5><F6><F6><F6><F7><F7><F7><F8><F8><F8><F9><F9><F9><FA><FA><FA><FB><FB><FB><FC><FC><FC><FD><FD><FD><FE><FE><FE><FF>,dd<08><00> H<>`A3*\Ȱ<>Ç#*4c<34><63>ŋ}I<>ȱ<DC>G<00>0<BE><30>8<BC><38>ɓ(<28><>\<5C>Oʗ0;<3B>ay1<79>͛i<14><><85>τ<A7>t<A2>K<F2><4B>(<28>$4W]js<6A>J<C5>L<A2><4C>D<BE><44><8A>ԫ'<27><><83><D6><C4><CA>֮ yT
+<2B>-<2D>7Ym<1A>MX<4D>%<25><06>h<E2><68>:<3A> VhB R<>Z<B8>dTvy+:<3A><>r`T<><54>-ҋ:P<><50>z<D2>EX<1A><1F><>+5,<15><19>JF9<17>L34Ÿ<34>H<8D><48>y<FE><79>j<A7><6A>֞<94><D69E>z<F7>l<B5>:M= 0<><30><8F><E6><1D><>,<2C><>6<D1><36>,kxl<78><6C><B7>ƕ`L<><4C><AE><1C><><E2>'<27>Wo<57>i<A8><01><>F<F2>nw<6E>L<J<05><>/<2F>,fz<66> ݽ<><DDBD><1E>B<BE><42>Q<F5>W?g?<3F><><EE><11>G<12>ԋ} <0B>dJ<>a<B4><00>
+i<><15><08>0<CA>*<2A>a$<0E> <09>$<24>G<87> z#<23>S<A5>H<DC>p<D0><70>),<01>P!J<>bB<62>Ԇь<0E>bcE8><3E>Ž-<2D>#D<><44><E1><D9><C8><12>S<8D>HBT<06><>4<EE><10>q %PY-M<><4D><FA>A<A5> Y×Ń<>B<1D>U4<55>2<DD>NH<14>Jp<> K<>tD<74>q<86><71>)Q,<2C><>`0,<2C>ԛ<9D>۱<8C><DBB1>~+M<>'<27>61<><31><F0><F5>5/ P<>z,<2C><>Ҧ<F9><D2A6>ʨ<81><CAA8><88><B2><1D><><A4><C0>!<21>Ω:!<21><>k<E5><6B><1F>`<60>ڑ<C9><DA91><AD><A5><AE>{<7B><><A8>gG=<3D><><E0>"<22><>Tl<54>+<2B>sR ,<2C><><A5>J:<3A>*<2A>w<D2><77>C<D9><07><>
+<2B><>4}<7D><>:9k_^v<C^B@&F娸<46>W<1C>k<BE>8r <20>@<40> yǽ<79>՚O<D59A><4F>kEKAf<41><66><94>kTZ<>q<AA><71>KŲ<4B>T9U8<55>=UeG<>o`<60>pE<70>_\<11>J<CF><4A>U<80>aW&L<>[-<2D>T<F7>]1<>o͟^d<15>(iuT<<>&FJݑS,m4DC<44><43><AF><B4> <0A>,<14>Sb<06><>3{F2<46>+<2B>f<D7><66><>/<2F><><87>;
\ No newline at end of file
diff -Naur mxml-2.6/doc/9.gif mxml-2.6-haiku/doc/9.gif
--- mxml-2.6/doc/9.gif 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/9.gif 2007-04-26 22:21:37.000000000 +0000
@@ -0,0 +1,6 @@
+GIF89add<00> 
+ 
+
+    ! "! #"!$#"%$#&%#'&$'&$('%)(&*)'+*(,+)-,*.-+/.,0/-10.21/320431542653664775886997::8;;9<<:=<;>=<?>=@?>A@?BA@CBADCCFEDGFEHGFIHGJIHKJILKKNMLONMPONQPORQPSRQTSRUTSUUTVVUWWVXXWYYXZZY[[Z\\[]]\^^]__^``_a``baacbbdcbedcfedgfehgfihgjihkjilkjmlknmlonmponqporqpsrqtsrttsuutvvuwwvxxwyyxzzy{{z||{}}|~~}~<7E><><80><7F><81><81><80><82><82><81><83><83><82><84><83><83><85><84><84><86><85><85><87><86><86><88><87><87><89><88><88><8A><89><89><8B><8A><8A><8C><8B><8B><8D><8C><8C><8E><8D><8D><8F><8E><8F><91><90><90><92><91><91><93><92><92><93><93><93><94><94><94><95><95><95><96><96><96><97><97><97><98><98><98><99><99><99><9A><9A><9A><9B><9B><9B><9C><9C><9C><9D><9D><9D><9E><9E><9E><9F><9F><A0><A1><A1><A1><A2><A2><A1><A3><A3><A2><A4><A4><A3><A5><A5><A4><A6><A6><A5><A7><A6><A6><A8><A7><A7><A9><A8><A8><AA><A9><A9><AB><AA><AA><AC><AB><AB><AD><AC><AC><AE><AD><AD><AF><AE><AE><B0><AF><AF><B1><B0><B0><B2><B1><B1><B2><B2><B2><B3><B3><B3><B4><B4><B4><B5><B5><B5><B6><B6><B6><B7><B7><B7><B8><B8><B8><B9><B9><B9><BA><BA><BA><BB><BB><BB><BC><BC><BC><BD><BD><BD><BE><BE><BE><BF><BF><BF><C0><C0><C0><C1><C1><C1><C2><C2><C2><C3><C3><C3><C4><C4><C4><C5><C5><C5><C6><C6><C6><C7><C7><C7><C8><C8><C8><C9><C9><C9><CA><CA><CA><CB><CA><CB><CC><CB><CC><CD><CC><CD><CE><CD><CE><CF><CE><CF><D0><CF><D0><D1><D0><D1><D1><D1><D2><D2><D2><D3><D3><D3><D4><D4><D4><D5><D5><D5><D6><D6><D6><D7><D7><D7><D8><D8><D8><D9><D9><D9><DA><DA><DA><DB><DB><DB><DC><DC><DC><DD><DD><DD><DE><DE><DE><DF><DF><DF><E0><E0><E0><E0><E1><E1><E1><E2><E2><E2><E3><E3><E3><E4><E4><E4><E5><E5><E5><E6><E6><E6><E7><E7><E7><E8><E8><E8><E9><E9><E9><EA><EA><EA><EB><EB><EB><EC><EC><EC><ED><ED><ED><EE><ED><EE><EF><EE><EF><F0><EF><F0><F0><F0><F1><F1><F1><F2><F2><F2><F3><F3><F3><F4><F4><F4><F5><F5><F5><F6><F6><F6><F7><F7><F7><F8><F8><F8><F9><F9><F9><FA><FA><FA><FB><FB><FB><FC><FC><FC><FD><FD><FD><FE><FE><FE><FF>,dd<08><00> H<>`<60>2*\Ȱ<>Ç#*,c<><63>ŋ}I<>ȱ<DC>G<00>0<BE><30><18><>ɓ(<28><>\<5C>/ʗ0;<3B>ay1<79>͛i<16><><FC><84>τ<A7>t<9F>;<3B><>(<28>#4W]js<6A>J<C5>L<A2><4C>D<BE><44><8A>ԫ'<27><><83><D6><C4><CA>֮~Xb<58><62>]5MH<4D>.<2E><><12>)<29><><96><98>,xU<78>Ё<08>,<2C>4<C9>]<5D>XU<0E>z<8C>oE5Wj\j<><6A>;<3B>!<21>-e<>X<D0>T<A4>F Ts<><73>#<23>1<E1><31><E5>'<27><>|<7C><><96><96><F6><89>J<F4>0]<5D><>}Rg;<3B>tZ<74><5A><A1>e<95><65>h<><68><F2>n6G<36>|<7C>Gdy<64><79>q<A3>A<> <0C><><F7>k<CD><0F>]<5D>-<2D>v<><76>=<3D>ε<FE><CEB5><FC><9D>(<28><>O<97><4F>;F<>띴<A8><EB9DB4>o<98><6F><E4> ;<3B><>xh<78><68>h<F2>m<FE>C<D4><43><80>C`D<08>>
+><3E><>H <0C><>M<E7><0E><><8D><1B> CaCg<43> ~<7E>l<8D>4<>a<E1><61><87>k<88><6B><95>J<17><>"t+<2B>s<13><><C2><E1>D:<3A><07>=+=<3D><>9<><39>K8<17><>76t<36><74><00>C<EC>!<21><17> <09>D<E8>C6%<25><>m<B2><6D>]
+<2B>dB <0C><><86><99>f<8A><08>ir6fBz<42>6F򼩐~<7E>1<03>J<C0>ة<12>ݷ<9B>HW<48><57>P<00><><8D><AD>JE<1A>Pw<>6(y<>.<2E>K<>(<28>f<E9> <15>ME<4D><10> jr<6A>P&<26><>j<9A>H<DE><48>j<A8>J<D3><01>S<><53><02><02><><AD><B2>Q/c<><63>˯<92> lm#<23><>d9(r<>kT<6B>0<A5><30>E<DE><45><A2><8D>J<C3><4A><FB><D0><E7>,)<29><>-g<><67><A2><12><><8D>~<7E><><8A><A3> YW<59><57>mZd<5A><64><88>V<ED>i<C4>=<3D><>1<E9><31>ӌ<F2><D38C>J%iO<69><4F>+<2B>Qm&60<36>]ރ<>gK)<29>z<><7A>S<>TvW<>U5w <09>A<>I%@.#<23>B<9D>`<60><><83><D5>Am<41>lӜ)<29><<3C>E2<45>v<C7>U5<35><7F>E<D5><45><F0>U"i<>sDN<44><4E><B1><D4> <01><12>H+<2B><><B4>M<98>WY<57>9<CB><39>Xȵ<58>,<2C>Īf<C4AA><66><DC>LR<4C>W@;
\ No newline at end of file
diff -Naur mxml-2.6/doc/A.gif mxml-2.6-haiku/doc/A.gif
--- mxml-2.6/doc/A.gif 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/A.gif 2007-04-26 22:21:37.000000000 +0000
@@ -0,0 +1,6 @@
+GIF89add<00> 
+ 
+
+   ! "! #""%$#&%$'&$('%)(&*)'+*)-,*.-,0/-10.21/320431542653664775887::8;;9<<:=<;>=<?>=@?>A@?BA@CBADCBEDCFEDGFEHGFIHGJIHKJJMLKNMLONMPONQPPSRQTSRUTSUUTVVUWWVXXWYYY[[Z\\]__^``_a``babdcbedehgfihhkjknmmponqporqqtstvvuwwvxxwyyxzzz|||~~}~<7E><><80><7F><81><81><80><82><82><82><84><83><83><85><84><84><86><85><85><87><86><86><88><87><87><89><88><88><8A><89><89><8B><8A><8A><8C><8B><8C><8E><8D><8D><8F><8E><8E><90><8F><8F><91><90><90><92><91><91><93><92><92><93><93><93><94><94><94><95><95><95><96><96><96><97><97><97><98><98><98><99><99><99><9A><9A><9A><9B><9B><9C><9D><9D><9E><9F><9F><9F><A0><A0><A0><A1><A1><A1><A3><A3><A2><A4><A4><A3><A5><A5><A4><A6><A6><A6><A8><A7><A7><A9><A8><AA><AC><AB><AB><AD><AC><AD><AF><AE><AE><B0><AF><AF><B1><B0><B0><B2><B1><B3><B4><B4><B5><B6><B6><B6><B7><B7><B7><B8><B8><B8><B9><B9><B9><BA><BA><BB><BC><BC><BC><BD><BD><BD><BE><BE><BE><BF><BF><BF><C0><C0><C0><C1><C1><C2><C3><C3><C3><C4><C4><C5><C6><C6><C7><C8><C8><C8><C9><C9><C9><CA><CA><CB><CC><CB><CC><CD><CC><CE><CF><CE><CF><D0><CF><D0><D1><D0><D1><D1><D1><D2><D2><D2><D4><D4><D4><D5><D5><D5><D6><D6><D6><D7><D7><D7><D8><D8><D8><D9><D9><D9><DA><DA><DA><DB><DB><DB><DC><DC><DC><DD><DD><DD><DE><DE><DE><DF><DF><DF><E0><E0><E0><E0><E1><E1><E1><E2><E2><E2><E3><E3><E3><E4><E4><E4><E5><E5><E5><E6><E6><E6><E7><E7><E7><E8><E8><E9><EA><EA><EA><EB><EB><EB><EC><EC><EC><ED><ED><ED><EE><ED><EF><F0><EF><F0><F0><F0><F1><F1><F1><F3><F3><F3><F4><F4><F4><F5><F5><F5><F6><F6><F6><F7><F7><F7><F8><F8><F8><F9><F9><F9><FA><FA><FA><FB><FB><FB><FC><FC><FC><FD><FD><FD><FE><FE><FE><FF>,dd<08><00> H<>`<60>+*\Ȱ<>Ç#*<2A>b<BC><62>ŋ9I<39>ȱ<DC>G<00>0<9C><30><8A><BC><A8>ɓ(<28><>\)m ʗ0;<3B>ay1<79>͛i4<><34><84>τ<A7>tJ <0B><>(<28> 4K]j<><6A>J<C4>L<A2><4C>D<BE><44><8A>ԫ'<27><><83><D6><C4><CA>֮`9Vt<56>U(י<05>~ڢ,<2C><>n<92>bU9<10>P<AC>]j<><6A>讴"\CJ<43><4A>w<EB>[<5B>~<7E><1A>ڪ<C6>4,e<11>-<2D>U2V<04><><8E><F1><86>,<2C>46<34><36>z<A5>ڨ<>ѥ<D3><D1A5>H(u<>դ]߄{<7B>l<B1><6C><9B>]<5D>}<7D>e,<2C><>c<BC>Y +<00><>/Y<00><>r<><72><C7>|nR<13><><F1>W<0E><>Q<EE>B<B9>¸<96>s<FE>>r!<21><><AC>#[<5B>j!y<><0E>G<D2><47><F4><BE>3<A5>+<2B>Wx~:<3A><>,<2C><><B9>{y<>C<>!<21><><,<2C><>+<0E><17>C^TÁ %`<60>ܭ<84><DCAD>C~<7E>_sUh<55>j<>M<>!<21><>B<E1><42><1C><12>XQ#<23><><AE>F,<2C>ט<A6><11>X^z,<2C>ґ<B1><06>!f@J<>#u<>5<19><><A4><15><11>)B T<><54>eXOz<4F>ʗ<C4><CA97>&<26>'<27><>ffb3<62><33>׎<E9><D78E><B7><B9>-<2D><>!'<27><><9B><B2><DD>q<>)<29>1<94>Y<B2><59>\U*<2A><04>aihEѤ<45>ޢ:
+iR<69>Q0)<29>e<A1>$<24>Oa*&%L4<4C>V<>+<2B><><ED><0E>^EӦ?<3F>*<1A><>^<5E>DEW^<5E><><B0>QF<51><46>K<><4B>+n<>ƺX<><58>.L<><4C>iD<69>uD<13>F<9C>
+E&I<>M~<7E><>ј+<2B><16>n(<28>H<EC><D0>{m<><6D><C4>=<3D>IG<49><47><16>2,ՂU<18>~7\2EW]<5D>2eY<01><>VZ<05>jQ<6A><51>^d<15>0iuT<10>D<9F>HJU<4A><55>iOi<4F><69><DC>,=<3D><>Cc:r}<7D>|<7C><><F2><C1>[񿵥[p<>w6+E~;
\ No newline at end of file
diff -Naur mxml-2.6/doc/B.gif mxml-2.6-haiku/doc/B.gif
--- mxml-2.6/doc/B.gif 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/B.gif 2007-04-26 22:21:37.000000000 +0000
@@ -0,0 +1,4 @@
+GIF89add<00> 
+ 
+
+    ! #"!$#"%$#&%#'&$'&%)(&*)'+*(,+)-,*.-+/.,0/-10.21/320431542653664775886997::8;;9<<:=<;>=<?>=@??BA@CBADCBEDCFEDGFFIHGJIHKJJMLKNMLONMPONQPORQPSRQTSRUTSUUTVVUWWVXXWYYXZZY[[Z\\[]]\^^]__^``_a`acbbdcbeddgfehggjihkjilkjmlknmlonmponqporqpsrqtssuutvvuwwvxxwyyxzzy{{z||{}}|~~}<7F><7F><81><81><80><82><82><81><83><83><82><84><83><83><85><84><84><86><85><85><87><86><87><89><88><88><8A><89><89><8B><8A><8A><8C><8B><8C><8E><8D><8D><8F><8E><8F><91><90><90><92><91><91><93><92><92><93><93><93><94><94><94><95><95><96><97><97><97><98><98><98><99><99><9A><9B><9B><9C><9D><9D><9D><9E><9E><9E><9F><9F><A0><A1><A1><A1><A2><A2><A1><A3><A3><A2><A4><A4><A3><A5><A5><A4><A6><A6><A6><A8><A7><A7><A9><A8><A8><AA><A9><A9><AB><AA><AA><AC><AB><AB><AD><AC><AC><AE><AD><AD><AF><AE><AE><B0><AF><AF><B1><B0><B1><B2><B2><B2><B3><B3><B3><B4><B4><B4><B5><B5><B5><B6><B6><B7><B8><B8><B8><B9><B9><B9><BA><BA><BA><BB><BB><BB><BC><BC><BC><BD><BD><BD><BE><BE><BE><BF><BF><BF><C0><C0><C0><C1><C1><C1><C2><C2><C2><C3><C3><C3><C4><C4><C4><C5><C5><C5><C6><C6><C6><C7><C7><C7><C8><C8><C8><C9><C9><CB><CC><CB><CC><CD><CC><CD><CE><CD><CE><CF><CE><CF><D0><CF><D0><D1><D0><D1><D1><D1><D2><D2><D2><D3><D3><D3><D4><D4><D4><D5><D5><D5><D6><D6><D6><D7><D7><D7><D8><D8><D8><D9><D9><D9><DA><DA><DA><DC><DC><DC><DD><DD><DD><DF><DF><DF><E0><E0><E0><E0><E1><E1><E1><E2><E2><E2><E3><E3><E3><E4><E4><E4><E5><E5><E5><E6><E6><E6><E7><E7><E7><E8><E8><E8><E9><E9><E9><EA><EA><EA><EB><EB><EB><EC><EC><EC><ED><ED><ED><EE><ED><EE><EF><EE><EF><F0><EF><F0><F0><F0><F1><F1><F1><F2><F2><F2><F3><F3><F3><F4><F4><F4><F5><F5><F5><F6><F6><F6><F7><F7><F7><F8><F8><F8><F9><F9><F9><FA><FA><FA><FB><FB><FB><FC><FC><FC><FD><FD><FD><FE><FE><FE><FF>,dd<08><00> H<>`<60>/*\Ȱ<>Ç#*<2A>b<FC><62>ŋ]I<>ȱ<DC>G<00>0<AE><30><8A><BC><E8>ɓ(<28><>\<5C>Nʗ0;<3B>ay1<79>͛i<16><><94><84>τ<A7>t<92>#<23><>(N"4S]j3<6A>J<C5>L<A2><4C>D<BE><44><8A>ԫ'<27><><83><D6><C4><CA>֮`9VtiR<69>ق<A8>0<>Y<10>ٷ -X<>$ܻ<19>T9<54>%޿<>~<0E><><D4><E8><F6>=C<><43>i<83><69><D8><F0>7<><37>gd<67><64><BF>ZF<5A>93ޛ<33>;{<7B><>(l<>њM/D<>w<8D>j<98>4?<12><10><><C5><D4> c<><63>!tn<>1<DD><31><83><E9><12>0঑<30>T<0E><>K><3E>_;<17><><8D>J<F8><4A>UO/<<3C>zw<7A>ץ<C8>g<FE>9><3E>v<EC>nV<6E><56>.<12><><FC><C8><CA>۴U<DBB4>|<7C><><FD>XF<58> <0A><><E0>49<34>_<5F>A4<41>M<>bր<04><> <20>>a<>,I<> l<14>tąf<><15> zX <20>&<26>EДxb{<1C>(<28> <17>(<28><13>xT<><54>hP<03><><FC><F9>1<><11><><8E><15>64<36><34><95><93>0 @<40><01>}g<><67>R<91><52><F9>TFe<46>G,uR<75>|8y<38><79>R[r fWev4<76>\kzu&Wi<57><69>&VqnԦ`w<>9<AA>UuF<75>I<C4><49>I9<49><39>U%}ڔhC9<43>tǗ<74><C797>4<C2>p<CA><70><13>BE<42><45>E2h<32><68>AK~*P <09><>ڣ<8A><DAA3><A8><A0><9E>@<40><>jc z8<7A>fת<66>t<10>b<EB>m<D4><1D><>m<DC> <09><><9E><92> <0B><><9B>*<2A> K)<29>kY"~B<03><03>U<D5>i|<7C>5mr<05>u-Wl<57><6C>-<2D>} <0B>EV<45>k<89>V7<56>[U")<29>.NN<4E><4E><B1><84>S U.<2E>&<26><>)<29>n¥-<2D>u<><75><8B>/T<>d<ED><02><><AC><AC>nK<6E>Y;
\ No newline at end of file
diff -Naur mxml-2.6/doc/C.gif mxml-2.6-haiku/doc/C.gif
--- mxml-2.6/doc/C.gif 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/C.gif 2007-04-26 22:21:37.000000000 +0000
@@ -0,0 +1,9 @@
+GIF89add<00> 
+ 
+
+    ! "! #"!$#"%$#&%#'&$'&$('%)(&*)'+*(,+)-,*.-+/.,0/-10.21/320431542653664775886997::8;;9<<:=<;>=<?>=@?>A@?BA@CBADCBEDCFEDGFEHGFIHGJIHKJILKJMLKNMLONMPONQPQTSRUTSUUTVVUWWVXXWYYXZZY[[Z\\[]]\^^]__^``_a``baacbbdccfedgfehgfihgjihkjilkjmlknmlonmponqporqpsrqtsrttsuutvvuwwvxxwyyxzzy{{z||{}}|~~}~<7E><><80><7F><81><81><80><82><82><81><83><83><82><84><83><83><85><84><84><86><85><85><87><86><88><8A><89><89><8B><8A><8A><8C><8B><8B><8D><8C><8C><8E><8D><8D><8F><8E><8E><90><8F><8F><91><90><90><92><91><91><93><92><92><93><93><93><94><94><94><95><95><95><96><96><96><97><97><97><98><98><98><99><99><99><9A><9A><9A><9B><9B><9B><9C><9C><9C><9D><9D><9D><9E><9E><9E><9F><9F><9F><A0><A0><A0><A1><A1><A1><A2><A2><A1><A3><A3><A2><A4><A4><A3><A5><A5><A4><A6><A6><A5><A7><A6><A6><A8><A7><A7><A9><A8><A8><AA><A9><A9><AB><AA><AA><AC><AB><AB><AD><AC><AD><AF><AE><AE><B0><AF><AF><B1><B0><B0><B2><B1><B1><B2><B2><B2><B3><B3><B3><B4><B4><B5><B6><B6><B6><B7><B7><B7><B8><B8><B8><B9><B9><B9><BA><BA><BA><BB><BB><BB><BC><BC><BC><BD><BD><BD><BE><BE><BE><BF><BF><BF><C0><C0><C0><C1><C1><C1><C2><C2><C2><C3><C3><C3><C4><C4><C4><C5><C5><C5><C6><C6><C6><C7><C7><C7><C8><C8><C8><C9><C9><C9><CA><CA><CA><CB><CA><CB><CC><CB><CC><CD><CC><CD><CE><CD><CE><CF><CE><CF><D0><CF><D0><D1><D0><D1><D1><D1><D2><D2><D2><D3><D3><D3><D4><D4><D4><D5><D5><D5><D6><D6><D6><D7><D7><D7><D8><D8><D8><D9><D9><D9><DA><DA><DA><DB><DB><DB><DC><DC><DC><DD><DD><DD><DE><DE><DE><DF><DF><DF><E0><E0><E0><E0><E1><E1><E1><E2><E2><E2><E3><E3><E3><E4><E4><E4><E5><E5><E5><E6><E6><E6><E7><E7><E7><E8><E8><E8><E9><E9><E9><EA><EA><EA><EB><EB><EB><EC><EC><EC><ED><ED><ED><EE><ED><EE><EF><EE><EF><F0><EF><F0><F0><F0><F1><F1><F1><F2><F2><F2><F3><F3><F3><F4><F4><F4><F5><F5><F5><F6><F6><F6><F7><F7><F7><F8><F8><F8><F9><F9><F9><FA><FA><FA><FB><FB><FB><FC><FC><FC><FD><FD><FD><FE><FE><FE><FF>,dd<08><00> H<>`A2*\Ȱ<>Ç#*$c<><63>ŋwI<77>ȱ<DC>G<00>0<BB><30><18><>ɓ(<28><>\<5C>ʗ0;<3B>ay1<79>͛i􄳧τ<F484B3A7>t<9E>K<E6><4B>(<28>$4W]js<6A>J<C5>L<A2><4C>D<BE><44><8A>ԫ'<27><><83><D6><C4><CA>V<E3><56>hvp<><70>K<A2><<3C><1A><>tfA<66><41><A9>b`<60>`ɥ<><C9A5><F2>$<24>S<EB><53><E5><C0><A5>Ҕ<F4>s<F7>Ƣ<A0>՚<82>2_Q$<24><><12>)<29>g<F0><67>r<C8><72><F1>ܳ<18><>7<C4>!<21><><C4>sb<73>1G߼b:<3A><><B2><07><> <04><><F6><C3><C8>舰`Fv<>m3<1C>w<A7>F:z<>+, <20><>G(j<>
+W<><57><9B>Z<A5>/<2F>f<84>)T<><54>!<21>i<A1><69><FE>=A<>)<29>4mw<6D>)(=l<><6C>Y<88><59>C3UQc<51><63>¯<BB><C2AF><BB>~<7E><>,<2C><>\<5C><>#<23><><D1>9*<2A>K<>88]~><3E>R<B8><52><85><B0> <20>R]<5D><>2rEKZ<4B><5A>Ն&
+Ha<48>L<8A><4C>ba+<2B>߅2<DF85>Hc<48>3<8D><33>#<23>:<3A><08><>>nc<><63> I<>uFy<12>+<15><>M<A4><4D>˓1<CB93><31>"<22>]<5D>%GZn)Mf0<66><30>J<CC>pEL<45>E<97><45> W <0C> Kk<4B><6B><FC>%6<><36>W<><57><FB>H<D4>KA<>9<><39><8A><A4><1F>@<40>O<A8><4F><19>J<DE>L<D3>!8<>B<03><>$<24>M>(ڕl:<3A><01>:a<><61>Z<A0><5A><04>z<CC><7A>UbG6<47>U!!<21>z%Dܒ<1C><>a <20><><06>!s<>^<5E>b
+<2B><>D‹5<14><>8<><38><A9><05>b<CA>C<94><43><1A>@<06><>T8<54>
+<2B><><84>K<B6><19>
+<2B><1D><><14><>aTc<54>FuBk/<2F>8<B4>]W<>!<21>vQ<76><51><F9>mG#R((<28>9<C8>Y^<5E><><DE>[/jP<6A>iVd<15>&iuTwD<77>HJU<4A><55>S,Q<><51>C<17><><B3><F4> I<>*<2A>DFp<46>GFo<46><6F><C1>f.<2E><>*<2A>l<EB><14>;
\ No newline at end of file
diff -Naur mxml-2.6/doc/D.gif mxml-2.6-haiku/doc/D.gif
--- mxml-2.6/doc/D.gif 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/D.gif 2007-04-26 22:21:37.000000000 +0000
@@ -0,0 +1,8 @@
+GIF89add<00> 
+ 
+
+    ! "! #"!$#"%$#&%#'&$'&$('%)(&*)'+*(,+)-,*.--10.21/320432653664776997::8;;9<<:=<=@?>A@?BA@CBADCBEDCFEDGFEHGFIHGJIHKJILKJMLKNMLONMPONQPORQPSRQTSRUTTVVUWWVXXWYYXZZY[[Z\\[]]\^^]___a``baacbbdcbedcfedgfehgfihgjihkjilkjmlknmlonmponqporqpsrqtsrttsuutvvuwwwyyxzzy{{z|||~~}~<7E><><80><7F><81><81><81><83><83><82><84><83><83><85><84><85><87><86><86><88><87><87><89><88><88><8A><89><89><8B><8A><8A><8C><8B><8B><8D><8C><8C><8E><8D><8D><8F><8E><8E><90><8F><8F><91><90><90><92><91><92><93><93><93><94><94><94><95><95><95><96><96><97><98><98><99><9A><9A><9A><9B><9B><9B><9C><9C><9C><9D><9D><9D><9E><9E><9E><9F><9F><9F><A0><A0><A0><A1><A1><A1><A2><A2><A1><A3><A3><A3><A5><A5><A4><A6><A6><A5><A7><A6><A6><A8><A7><A7><A9><A8><A8><AA><A9><A9><AB><AA><AA><AC><AB><AB><AD><AC><AC><AE><AD><AD><AF><AE><AE><B0><AF><AF><B1><B0><B0><B2><B1><B1><B2><B2><B3><B4><B4><B4><B5><B5><B5><B6><B6><B6><B7><B7><B7><B8><B8><B8><B9><B9><B9><BA><BA><BA><BB><BB><BB><BC><BC><BC><BD><BD><BD><BE><BE><BE><BF><BF><BF><C0><C0><C1><C2><C2><C2><C3><C3><C3><C4><C4><C4><C5><C5><C5><C6><C6><C6><C7><C7><C7><C8><C8><C8><C9><C9><C9><CA><CA><CA><CB><CA><CB><CC><CB><CC><CD><CC><CD><CE><CD><CE><CF><CE><CF><D0><CF><D0><D1><D0><D1><D1><D1><D2><D2><D2><D3><D3><D3><D4><D4><D4><D5><D5><D5><D7><D7><D7><D9><D9><D9><DA><DA><DA><DB><DB><DB><DC><DC><DC><DD><DD><DD><DE><DE><DE><E0><E0><E0><E0><E1><E1><E1><E2><E2><E2><E3><E3><E3><E4><E4><E4><E5><E5><E5><E6><E6><E6><E7><E7><E7><E8><E8><E8><E9><E9><E9><EA><EA><EA><EB><EB><EB><EC><EC><EC><ED><ED><ED><EE><ED><EE><EF><EE><EF><F0><EF><F0><F0><F0><F1><F1><F1><F2><F2><F2><F3><F3><F3><F4><F4><F4><F5><F5><F5><F6><F6><F6><F7><F7><F7><F8><F8><F8><F9><F9><F9><FA><FA><FA><FB><FB><FB><FC><FC><FC><FD><FD><FD><FE><FE><FE><FF>,dd<08><00> H<>`<60>/*\Ȱ<>Ç#*<2A>b<FC><62>ŋaI<61>ȱ<DC>G<00>0<B0><30><8A><BC><C8>ɓ(<28><>\<5C>.ʗ0;<3B>ay1<79>͛i<16><><9C><84>τ<A7>t<93><1B><>(<28>!4S]j3<6A>J<C5>L<A2><4C>D<BE><44><8A>ԫ'<27><><83><D6><C4><CA>֮`9Vt<56>U<E9><55>u<D9><75>`<60>Y<9D><59>ٷ5D-X<>$ܻ<>
+-U9%^<5E>T<BC><0E><><D4>/ޢ!׽4<D7BD>7<FC>O<C0><4F><19>-<2D><13>_ɇ{<7B>Cx<19>ݞ<F3>;{<7B><1B><>h<E1>J3<<3C>YuB<75><1B><>S<D0><53>k<00>Q:<3A><>v<76><EE9790>fi3<69>P<15><AE><14><>8N<38><4E>W<CD><57>A<D4><41>j<9A>6<E5><36><A1><1E>8<D3>۝<>kf<6B>-<2D>t<BC>&<26>_U<5F>\|W<>0i<30> <0B>%<18><><96><CD><><7F><FE><FD><FE>IU_d<5F>q5<71>h"<22>W`O˰X<07><>K]@<18>MY<4D><04><> <0B>K<>p8<70>Q<18>4<B0><34> <16>K᠈<4B>Q<03><><B0><94>_<8B>DK<><4B>h<D0>Q'<27><><B0><B4>E<>J<DD>i<>Qo<51>$<24><>m
+KD0I<30>Q<90><51>d<B0><64>}ae<17>ס<B6>]<5D><17>`c<><63>ݗs<DD97>iR&,e<><65><A2><E0><88><8F><B1><B4>)r<>f<89>w<9A><77>ǖv<C796><76><C2>H<DF><48><91><98>M;<3B><>g<D9>7iG<69><47>8%C<>ש<><D7A9><13>.Z<>K@<40>Nt<4E><74><83>
+s<>"j<>f<>3\<5C><10><><C9>m<D6><6D><06>'<27><><9E>JZ<4A><5A><AC><B2><18><><AD>D<06><><AB><AF>4<><34><BC><F6>H<AB>+<2B><><16><>Shv!k<>/EQD<51><44><04>@<40><><E6>B<D4><42>e<94>Q+
+<2B><>5;,1\<5C><>bݲLo<>e<D6>m|e<>n<F9>-ͫ[M<> <0B><><A4>Yd<15>QiuTE<>HJ<15><>S,<11><>M<07><><B3><F4>/ *<2A><><C5>E<16>዗<>;<14>dᆜй<E1869C>2 0Eg;
\ No newline at end of file
diff -Naur mxml-2.6/doc/E.gif mxml-2.6-haiku/doc/E.gif
--- mxml-2.6/doc/E.gif 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/E.gif 2007-04-26 22:21:37.000000000 +0000
@@ -0,0 +1,3 @@
+GIF89add<00>  $'&&*)-100437:::=<KNMNQPRUTUWW_a`bdchkjknm|~~<><7F><81><81><82><84><83><8D><8F><8E><9A><9B><9B><A3><A5><A5><A7><A9><A8><AA><AC><AB><B5><B6><B6><B8><B9><B9><BB><BC><BC><C2><C3><C3><C5><C6><C6><CF><D0><CF><D9><D9><D9><E0><E0><E0><E5><E6><E6><E9><EA><EA><EC><ED><ED><F3><F3><F3><FD><FD><FD><FF>,dd<06>@<40>pH,'<27><>r<A4>l:<3A>Шrb<72>Z<AC>F<AF>t<90><74>z <20><>
+<2B><><F9>h<CF>x<C8><78><AD><AA><A0>n<F0>}<7D><><8D>PzQ<7A><51><83><EF>z* <>x t <09><>v k<><6B><84>o<91>X|<7C><>g<97>u<81><75>_<9C><5F><9B>\Unf<6E><66><82>psEh<45><68>k<AE>pEeg<65><67>W<B6>ojCo<43><6F>E<BE><45>BZ<42><5A><AD><BF>ha*<2A>ƿ<B2><C6BF><C8>ͷϵ<CDB7><CFB5>ҶԥH<D4A5>خ<D7>_<DA><5F>ަ<DD><DEA6><E0><9D><E4><AF><E6>ߡNt<4E><74>I<F1><49><F0><F2><EE><F4><F5><A0><F7>l<EB><6C><FB><F9><FD><FE> (p AL<41>.J<><4A>Æ~B<>#q<><71><A2><16><19><>#<23>j?<3F>a<F6><61><A7>A<C3>tLD<>Fe@<40>k\<5C><>9F<39>><3E>bl<62>ÉEg<45>=<3D>W|<7C>jEh<<3C>U<A2><55>CZDi(<28>MOy<>#<23>.V<>nɪ5
+׮O<D7AE><4F>m"v쒲f<EC92B2>MM<4D>mZ<6D>f᎕ <0B>nW<6E>Z<BB>^<5E>K<D5><4B>H<AF><1F>~*<2A><><B8><CA>F#&<26>x<A2><78>Ǝ!/<2F>#<0E>ckp<6B>h<A8><1C><><E7>ɝ1[<5B>̌<E6>h<D8>o<D0><6F><94>t<F6>s7Zl<5A><6C><EF><15>jR<>߬b<DFAC><62>3<FB>ެ<ED>X<02>E<CE>HģP<12>(<28>Gl<47>;W<><57><B2><9C><CD><F0>Mp w<>ݷ`<60><><A7><9D>tW<74><57>*O<>r*;
\ No newline at end of file
diff -Naur mxml-2.6/doc/F.gif mxml-2.6-haiku/doc/F.gif
--- mxml-2.6/doc/F.gif 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/F.gif 2007-04-26 22:21:37.000000000 +0000
@@ -0,0 +1 @@
+GIF89add<00>  $'&&*)-100437:::=<KNMNQPRUTUWW_a`bdchkjknm|~~<><7F><81><81><8A><8C><8B><8D><8F><8E><9A><9B><9B><A3><A5><A5><A7><A9><A8><AA><AC><AB><B5><B6><B6><B8><B9><B9><BB><BC><BC><C2><C3><C3><C5><C6><C6><CF><D0><CF><D9><D9><D9><E0><E0><E0><E5><E6><E6><E9><EA><EA><EC><ED><ED><F3><F3><F3><FD><FD><FD><FF>,dd<06><><FE>pH,%<25><>r<A4>l:<3A>ШRb<52>Z<AC>Ət<C68F><74>z<1F><><AC><F8><FA><F8><9A><CF>x<C7><78><9D><A2><A0>.<2E>}<7D><><8D>Pz1<7A><31><83><EF>z) <>x t<08><>vk<><6B><84>o<91>X|<7C><>g<97>u<81><75>_<9C><5F><9B>\Un<55><6E><9E>twsEg<45><67>cxEef<65><66>VxjCh<43><68>D}CZ<43><5A><AC>}a)o<>þƺȵ~B<>ʹ<C7>H<CF>ҭ~<7E><>צ<D6>yܧ<79>O<DE><4F><E0>M<E2><4D><A8><E6><DE><E8><E9><A0><EB><EC><9C><EE><EF><97><F1><F2><91><F4><F5><8B><F7><F8><85><FA>l<CF>$<24> xg <20>8F[<5B><>P†<50>B<><42>p<C7><70><A2> <0B>øo#G|_ )<29> I,&O<><1A><>Jʖ<4A>X<AB><58>%s&<26><>6_<36>\<5C><>a<EF><61>->F *t<>Ģ E"<22>Vr)S<>N<94>}<7D>*<2A>(<28>.D<>f<AF><66>5jW<6A>_<A7><5F>E:<3A>hY<68>g<67>͸<A6>bۉo!<21>m8Wa݃wi<>8"<22><>M<A4><4D>䫔<F2><E4AB94>R}<7D><>F8<46><38>b<C5><62>Z<B1>;D<>U;<3B>r]<5D>c<B6><63>f4<66>b~<7E>jdt<64>=<3D><>h<BB>)5Jb<14>v<B9><76>M<88><4D>I`<60><><B3>{<7B> ܵ<o]<5D>r<CB><72><D4><17>Ln<4C>A*<2A><>;
\ No newline at end of file
diff -Naur mxml-2.6/doc/advanced.html mxml-2.6-haiku/doc/advanced.html
--- mxml-2.6/doc/advanced.html 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/advanced.html 2009-03-19 05:33:20.000000000 +0000
@@ -0,0 +1,633 @@
+<html>
+<body>
+
+<h1 align='right'><a name='ADVANCED'><img src="3.gif" align="right"
+hspace="10" width="100" height="100" alt="3"></a>More Mini-XML
+Programming Techniques</h1>
+
+<p>This chapter shows additional ways to use the Mini-XML
+library in your programs.</p>
+
+<h2><a name='LOAD_CALLBACKS'>Load Callbacks</a></h2>
+
+<p><a href='#LOAD_XML'>Chapter 2</a> introduced the <a
+href='#mxmlLoadFile'><tt>mxmlLoadFile()</tt></a> and <a
+href='#mxmlLoadString'><tt>mxmlLoadString()</tt></a> functions.
+The last argument to these functions is a callback function
+which is used to determine the value type of each data node in
+an XML document.</p>
+
+<p>Mini-XML defines several standard callbacks for simple
+XML data files:</p>
+
+<ul>
+
+ <li><tt>MXML_INTEGER_CALLBACK</tt> - All data nodes
+ contain whitespace-separated integers.</li>
+
+ <li><tt>MXML_OPAQUE_CALLBACK</tt> - All data nodes
+ contain opaque strings ("CDATA").</li>
+
+ <li><tt>MXML_REAL_CALLBACK</tt> - All data nodes contain
+ whitespace-separated floating-point numbers.</li>
+
+ <li><tt>MXML_TEXT_CALLBACK</tt> - All data nodes contain
+ whitespace-separated strings.</li>
+
+</ul>
+
+<p>You can provide your own callback functions for more complex
+XML documents. Your callback function will receive a pointer to
+the current element node and must return the value type of the
+immediate children for that element node: <tt>MXML_INTEGER</tt>,
+<tt>MXML_OPAQUE</tt>, <tt>MXML_REAL</tt>, or <tt>MXML_TEXT</tt>.
+The function is called <i>after</i> the element and its
+attributes have been read, so you can look at the element name,
+attributes, and attribute values to determine the proper value
+type to return.</p>
+
+<!-- NEED 2in -->
+<p>The following callback function looks for an attribute named
+"type" or the element name to determine the value type for its
+child nodes:</p>
+
+<pre>
+ mxml_type_t
+ type_cb(mxml_node_t *node)
+ {
+ const char *type;
+
+ /*
+ * You can lookup attributes and/or use the
+ * element name, hierarchy, etc...
+ */
+
+ type = mxmlElementGetAttr(node, "type");
+ if (type == NULL)
+ type = node->value.element.name;
+
+ if (!strcmp(type, "integer"))
+ return (MXML_INTEGER);
+ else if (!strcmp(type, "opaque"))
+ return (MXML_OPAQUE);
+ else if (!strcmp(type, "real"))
+ return (MXML_REAL);
+ else
+ return (MXML_TEXT);
+ }
+</pre>
+
+<p>To use this callback function, simply use the name when you
+call any of the load functions:</p>
+
+<pre>
+ FILE *fp;
+ mxml_node_t *tree;
+
+ fp = fopen("filename.xml", "r");
+ tree = mxmlLoadFile(NULL, fp, <b>type_cb</b>);
+ fclose(fp);
+</pre>
+
+
+<h2><a name='SAVE_CALLBACKS'>Save Callbacks</a></h2>
+
+<p><a href='#LOAD_XML'>Chapter 2</a> also introduced the <a
+href='#mxmlSaveFile'><tt>mxmlSaveFile()</tt></a>, <a
+href='#mxmlSaveString'><tt>mxmlSaveString()</tt></a>, and <a
+href='#mxmlSaveAllocString'><tt>mxmlSaveAllocString()</tt></a>
+functions. The last argument to these functions is a callback
+function which is used to automatically insert whitespace in an
+XML document.</p>
+
+<p>Your callback function will be called up to four times for
+each element node with a pointer to the node and a "where" value
+of <tt>MXML_WS_BEFORE_OPEN</tt>, <tt>MXML_WS_AFTER_OPEN</tt>,
+<tt>MXML_WS_BEFORE_CLOSE</tt>, or <tt>MXML_WS_AFTER_CLOSE</tt>.
+The callback function should return <tt>NULL</tt> if no
+whitespace should be added and the string to insert (spaces,
+tabs, carriage returns, and newlines) otherwise.</p>
+
+<p>The following whitespace callback can be used to add
+whitespace to XHTML output to make it more readable in a standard
+text editor:</p>
+
+<pre>
+ const char *
+ whitespace_cb(mxml_node_t *node,
+ int where)
+ {
+ const char *name;
+
+ /*
+ * We can conditionally break to a new line
+ * before or after any element. These are
+ * just common HTML elements...
+ */
+
+ name = node->value.element.name;
+
+ if (!strcmp(name, "html") ||
+ !strcmp(name, "head") ||
+ !strcmp(name, "body") ||
+ !strcmp(name, "pre") ||
+ !strcmp(name, "p") ||
+ !strcmp(name, "h1") ||
+ !strcmp(name, "h2") ||
+ !strcmp(name, "h3") ||
+ !strcmp(name, "h4") ||
+ !strcmp(name, "h5") ||
+ !strcmp(name, "h6"))
+ {
+ /*
+ * Newlines before open and after
+ * close...
+ */
+
+ if (where == MXML_WS_BEFORE_OPEN ||
+ where == MXML_WS_AFTER_CLOSE)
+ return ("\n");
+ }
+ else if (!strcmp(name, "dl") ||
+ !strcmp(name, "ol") ||
+ !strcmp(name, "ul"))
+ {
+ /*
+ * Put a newline before and after list
+ * elements...
+ */
+
+ return ("\n");
+ }
+ else if (!strcmp(name, "dd") ||
+ !strcmp(name, "dt") ||
+ !strcmp(name, "li"))
+ {
+ /*
+ * Put a tab before &lt;li>'s, * &lt;dd>'s,
+ * and &lt;dt>'s, and a newline after them...
+ */
+
+ if (where == MXML_WS_BEFORE_OPEN)
+ return ("\t");
+ else if (where == MXML_WS_AFTER_CLOSE)
+ return ("\n");
+ }
+
+ /*
+ * Return NULL for no added whitespace...
+ */
+
+ return (NULL);
+ }
+</pre>
+
+<p>To use this callback function, simply use the name when you
+call any of the save functions:</p>
+
+<pre>
+ FILE *fp;
+ mxml_node_t *tree;
+
+ fp = fopen("filename.xml", "w");
+ mxmlSaveFile(tree, fp, <b>whitespace_cb</b>);
+ fclose(fp);
+</pre>
+
+
+<!-- NEED 10 -->
+<h2>Custom Data Types</h2>
+
+<p>Mini-XML supports custom data types via global load and save
+callbacks. Only a single set of callbacks can be active at any
+time, however your callbacks can store additional information in
+order to support multiple custom data types as needed. The
+<tt>MXML_CUSTOM</tt> node type identifies custom data nodes.</p>
+
+<p>The load callback receives a pointer to the current data node
+and a string of opaque character data from the XML source with
+character entities converted to the corresponding UTF-8
+characters. For example, if we wanted to support a custom
+date/time type whose value is encoded as "yyyy-mm-ddThh:mm:ssZ"
+(ISO format), the load callback would look like the
+following:</p>
+
+<pre>
+ typedef struct
+ {
+ unsigned year, /* Year */
+ month, /* Month */
+ day, /* Day */
+ hour, /* Hour */
+ minute, /* Minute */
+ second; /* Second */
+ time_t unix; /* UNIX time */
+ } iso_date_time_t;
+
+ int
+ load_custom(mxml_node_t *node,
+ const char *data)
+ {
+ iso_date_time_t *dt;
+ struct tm tmdata;
+
+ /*
+ * Allocate data structure...
+ */
+
+ dt = calloc(1, sizeof(iso_date_time_t));
+
+ /*
+ * Try reading 6 unsigned integers from the
+ * data string...
+ */
+
+ if (sscanf(data, "%u-%u-%uT%u:%u:%uZ",
+ &(dt->year), &(dt->month),
+ &(dt->day), &(dt->hour),
+ &(dt->minute),
+ &(dt->second)) != 6)
+ {
+ /*
+ * Unable to read numbers, free the data
+ * structure and return an error...
+ */
+
+ free(dt);
+
+ return (-1);
+ }
+
+ /*
+ * Range check values...
+ */
+
+ if (dt->month < 1 || dt->month > 12 ||
+ dt->day < 1 || dt->day > 31 ||
+ dt->hour < 0 || dt->hour > 23 ||
+ dt->minute < 0 || dt->minute > 59 ||
+ dt->second < 0 || dt->second > 59)
+ {
+ /*
+ * Date information is out of range...
+ */
+
+ free(dt);
+
+ return (-1);
+ }
+
+ /*
+ * Convert ISO time to UNIX time in
+ * seconds...
+ */
+
+ tmdata.tm_year = dt->year - 1900;
+ tmdata.tm_mon = dt->month - 1;
+ tmdata.tm_day = dt->day;
+ tmdata.tm_hour = dt->hour;
+ tmdata.tm_min = dt->minute;
+ tmdata.tm_sec = dt->second;
+
+ dt->unix = gmtime(&amp;tmdata);
+
+ /*
+ * Assign custom node data and destroy
+ * function pointers...
+ */
+
+ node->value.custom.data = dt;
+ node->value.custom.destroy = free;
+
+ /*
+ * Return with no errors...
+ */
+
+ return (0);
+ }
+</pre>
+
+<p>The function itself can return 0 on success or -1 if it is
+unable to decode the custom data or the data contains an error.
+Custom data nodes contain a <tt>void</tt> pointer to the
+allocated custom data for the node and a pointer to a destructor
+function which will free the custom data when the node is
+deleted.</p>
+
+<p>The save callback receives the node pointer and returns an
+allocated string containing the custom data value. The following
+save callback could be used for our ISO date/time type:</p>
+
+<pre>
+ char *
+ save_custom(mxml_node_t *node)
+ {
+ char data[255];
+ iso_date_time_t *dt;
+
+
+ dt = (iso_date_time_t *)node->custom.data;
+
+ snprintf(data, sizeof(data),
+ "%04u-%02u-%02uT%02u:%02u:%02uZ",
+ dt->year, dt->month, dt->day,
+ dt->hour, dt->minute, dt->second);
+
+ return (strdup(data));
+ }
+</pre>
+
+<p>You register the callback functions using the <a
+href='#mxmlSetCustomHandlers'><tt>mxmlSetCustomHandlers()</tt></a>
+function:</p>
+
+<pre>
+ mxmlSetCustomHandlers(<b>load_custom</b>,
+ <b>save_custom</b>);
+</pre>
+
+
+<!-- NEED 20 -->
+<h2>Changing Node Values</h2>
+
+<p>All of the examples so far have concentrated on creating and
+loading new XML data nodes. Many applications, however, need to
+manipulate or change the nodes during their operation, so
+Mini-XML provides functions to change node values safely and
+without leaking memory.</p>
+
+<p>Existing nodes can be changed using the <a
+href='#mxmlSetElement'><tt>mxmlSetElement()</tt></a>, <a
+href='#mxmlSetInteger'><tt>mxmlSetInteger()</tt></a>, <a
+href='#mxmlSetOpaque'><tt>mxmlSetOpaque()</tt></a>, <a
+href='#mxmlSetReal'><tt>mxmlSetReal()</tt></a>, <a
+href='#mxmlSetText'><tt>mxmlSetText()</tt></a>, and <a
+href='#mxmlSetTextf'><tt>mxmlSetTextf()</tt></a> functions. For
+example, use the following function call to change a text node
+to contain the text "new" with leading whitespace:</p>
+
+<pre>
+ mxml_node_t *node;
+
+ mxmlSetText(node, 1, "new");
+</pre>
+
+
+<h2>Formatted Text</h2>
+
+<p>The <a href='#mxmlNewTextf'><tt>mxmlNewTextf()</tt></a> and <a
+href='#mxmlSetTextf'><tt>mxmlSetTextf()</tt></a> functions create
+and change text nodes, respectively, using <tt>printf</tt>-style
+format strings and arguments. For example, use the following
+function call to create a new text node containing a constructed
+filename:</p>
+
+<pre>
+ mxml_node_t</a> *node;
+
+ node = mxmlNewTextf(node, 1, "%s/%s",
+ path, filename);
+</pre>
+
+
+<h2>Indexing</h2>
+
+<p>Mini-XML provides functions for managing indices of nodes.
+The current implementation provides the same functionality as
+<a href='#mxmlFindElement'><tt>mxmlFindElement()</tt></a>.
+The advantage of using an index is that searching and
+enumeration of elements is significantly faster. The only
+disadvantage is that each index is a static snapshot of the XML
+document, so indices are not well suited to XML data that is
+updated more often than it is searched. The overhead of creating
+an index is approximately equal to walking the XML document
+tree. Nodes in the index are sorted by element name and
+attribute value.</p>
+
+<p>Indices are stored in <a
+href='#mxml_index_t'><tt>mxml_index_t</tt></a> structures. The
+<a href='#mxmlIndexNew'><tt>mxmlIndexNew()</tt></a> function
+creates a new index:</p>
+
+<pre>
+ mxml_node_t *tree;
+ mxml_index_t *ind;
+
+ ind = mxmlIndexNew(tree, "element",
+ "attribute");
+</pre>
+
+<p>The first argument is the XML node tree to index. Normally this
+will be a pointer to the <tt>?xml</tt> element.</p>
+
+<p>The second argument contains the element to index; passing
+<tt>NULL</tt> indexes all element nodes alphabetically.</p>
+
+<p>The third argument contains the attribute to index; passing
+<tt>NULL</tt> causes only the element name to be indexed.</p>
+
+<p>Once the index is created, the <a
+href='#mxmlIndexEnum'><tt>mxmlIndexEnum()</tt></a>, <a
+href='#mxmlIndexFind'><tt>mxmlIndexFind()</tt></a>, and <a
+href='#mxmlIndexReset'><tt>mxmlIndexReset()</tt></a> functions
+are used to access the nodes in the index. The <a
+href='#mxmlIndexReset'><tt>mxmlIndexReset()</tt></a> function
+resets the "current" node pointer in the index, allowing you to
+do new searches and enumerations on the same index. Typically
+you will call this function prior to your calls to <a
+href='#mxmlIndexEnum'><tt>mxmlIndexEnum()</tt></a> and <a
+href='#mxmlIndexFind'><tt>mxmlIndexFind()</tt></a>.</p>
+
+<p>The <a href='#mxmlIndexEnum'><tt>mxmlIndexEnum()</tt></a>
+function enumerates each of the nodes in the index and can be
+used in a loop as follows:</p>
+
+<pre>
+ mxml_node_t *node;
+
+ mxmlIndexReset(ind);
+
+ while ((node = mxmlIndexEnum(ind)) != NULL)
+ {
+ // do something with node
+ }
+</pre>
+
+<p>The <a href='#mxmlIndexFind'><tt>mxmlIndexFind()</tt></a>
+function locates the next occurrence of the named element and
+attribute value in the index. It can be used to find all
+matching elements in an index, as follows:</p>
+
+<pre>
+ mxml_node_t *node;
+
+ mxmlIndexReset(ind);
+
+ while ((node = mxmlIndexFind(ind, "element",
+ "attr-value"))
+ != NULL)
+ {
+ // do something with node
+ }
+</pre>
+
+<p>The second and third arguments represent the element name and
+attribute value, respectively. A <tt>NULL</tt> pointer is used
+to return all elements or attributes in the index. Passing
+<tt>NULL</tt> for both the element name and attribute value
+is equivalent to calling <tt>mxmlIndexEnum</tt>.</p>
+
+<p>When you are done using the index, delete it using the
+<a href='#mxmlIndexDelete()'><tt>mxmlIndexDelete()</tt></a>
+function:</p>
+
+<pre>
+ mxmlIndexDelete(ind);
+</pre>
+
+<h2>SAX (Stream) Loading of Documents</h2>
+
+<p>Mini-XML supports an implementation of the Simple API for XML
+(SAX) which allows you to load and process an XML document as a
+stream of nodes. Aside from allowing you to process XML documents of
+any size, the Mini-XML implementation also allows you to retain
+portions of the document in memory for later processing.</p>
+
+<p>The <a href='#mxmlSAXLoad'><tt>mxmlSAXLoadFd</tt></a>, <a
+href='#mxmlSAXLoadFile'><tt>mxmlSAXLoadFile</tt></a>, and <a
+href='#mxmlSAXLoadString'><tt>mxmlSAXLoadString</tt></a> functions
+provide the SAX loading APIs. Each function works like the
+corresponding <tt>mxmlLoad</tt> function but uses a callback to
+process each node as it is read.</p>
+
+<p>The callback function receives the node, an event code, and
+a user data pointer you supply:</p>
+
+<pre>
+ void
+ sax_cb(mxml_node_t *node,
+ mxml_sax_event_t event,
+ void *data)
+ {
+ ... do something ...
+ }
+</pre>
+
+<p>The event will be one of the following:</p>
+
+<ul>
+
+ <li><tt>MXML_SAX_CDATA</tt> - CDATA was just read</li>
+
+ <li><tt>MXML_SAX_COMMENT</tt> - A comment was just read</li>
+
+ <li><tt>MXML_SAX_DATA</tt> - Data (custom, integer, opaque, real, or text) was just read</li>
+
+ <li><tt>MXML_SAX_DIRECTIVE</tt> - A processing directive was just read</li>
+
+ <li><tt>MXML_SAX_ELEMENT_CLOSE</tt> - A close element was just read (<tt>&lt;/element&gt;</tt>)</li>
+
+ <li><tt>MXML_SAX_ELEMENT_OPEN</tt> - An open element was just read (<tt>&lt;element&gt;</tt>)</li>
+
+</ul>
+
+<p>Elements are <em>released</em> after the close element is
+processed. All other nodes are released after they are processed.
+The SAX callback can <em>retain</em> the node using the <a
+href='#mxmlRetain'><tt>mxmlRetain</tt></a> function. For example,
+the following SAX callback will retain all nodes, effectively
+simulating a normal in-memory load:</p>
+
+<pre>
+ void
+ sax_cb(mxml_node_t *node,
+ mxml_sax_event_t event,
+ void *data)
+ {
+ if (event != MXML_SAX_ELEMENT_CLOSE)
+ mxmlRetain(node);
+ }
+</pre>
+
+<p>More typically the SAX callback will only retain a small portion
+of the document that is needed for post-processing. For example, the
+following SAX callback will retain the title and headings in an
+XHTML file. It also retains the (parent) elements like <tt>&lt;html&gt;</tt>, <tt>&lt;head&gt;</tt>, and <tt>&lt;body&gt;</tt>, and processing
+directives like <tt>&lt;?xml ... ?&gt;</tt> and <tt>&lt;!DOCTYPE ... &gt;</tt>:</p>
+
+<!-- NEED 10 -->
+<pre>
+ void
+ sax_cb(mxml_node_t *node,
+ mxml_sax_event_t event,
+ void *data)
+ {
+ if (event == MXML_SAX_ELEMENT_OPEN)
+ {
+ /*
+ * Retain headings and titles...
+ */
+
+ char *name = node->value.element.name;
+
+ if (!strcmp(name, "html") ||
+ !strcmp(name, "head") ||
+ !strcmp(name, "title") ||
+ !strcmp(name, "body") ||
+ !strcmp(name, "h1") ||
+ !strcmp(name, "h2") ||
+ !strcmp(name, "h3") ||
+ !strcmp(name, "h4") ||
+ !strcmp(name, "h5") ||
+ !strcmp(name, "h6"))
+ mxmlRetain(node);
+ }
+ else if (event == MXML_SAX_DIRECTIVE)
+ mxmlRetain(node);
+ else if (event == MXML_SAX_DATA &amp;&amp;
+ node->parent->ref_count > 1)
+ {
+ /*
+ * If the parent was retained, then retain
+ * this data node as well.
+ */
+
+ mxmlRetain(node);
+ }
+ }
+</pre>
+
+<p>The resulting skeleton document tree can then be searched just
+like one loaded using the <tt>mxmlLoad</tt> functions. For example,
+a filter that reads an XHTML document from stdin and then shows the
+title and headings in the document would look like:</p>
+
+<pre>
+ mxml_node_t *doc, *title, *body, *heading;
+
+ doc = mxmlSAXLoadFd(NULL, 0,
+ MXML_TEXT_CALLBACK,
+ <b>sax_cb</b>, NULL);
+
+ title = mxmlFindElement(doc, doc, "title",
+ NULL, NULL,
+ MXML_DESCEND);
+
+ if (title)
+ print_children(title);
+
+ body = mxmlFindElement(doc, doc, "body",
+ NULL, NULL,
+ MXML_DESCEND);
+
+ if (body)
+ {
+ for (heading = body->child;
+ heading;
+ heading = heading->next)
+ print_children(heading);
+ }
+</pre>
+
+</body>
+</html>
diff -Naur mxml-2.6/doc/basics.html mxml-2.6-haiku/doc/basics.html
--- mxml-2.6/doc/basics.html 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/basics.html 2007-04-26 22:21:37.000000000 +0000
@@ -0,0 +1,526 @@
+<html>
+<body>
+
+<h1 align='right'><a name='BASICS'><img src="2.gif" align="right"
+hspace="10" width="100" height="100" alt="2"></a>Getting Started
+with Mini-XML</h1>
+
+<p>This chapter describes how to write programs that use Mini-XML to
+access data in an XML file. Mini-XML provides the following
+functionality:</p>
+
+<ul>
+
+ <li>Functions for creating and managing XML documents
+ in memory.</li>
+
+ <li>Reading of UTF-8 and UTF-16 encoded XML files and
+ strings.</li>
+
+ <li>Writing of UTF-8 encoded XML files and strings.</li>
+
+ <li>Support for arbitrary element names, attributes, and
+ attribute values with no preset limits, just available
+ memory.</li>
+
+ <li>Support for integer, real, opaque ("cdata"), and text
+ data types in "leaf" nodes.</li>
+
+ <li>"Find", "index", and "walk" functions for easily
+ accessing data in an XML document.</li>
+
+</ul>
+
+<p>Mini-XML doesn't do validation or other types of processing
+on the data based upon schema files or other sources of
+definition information, nor does it support character entities
+other than those required by the XML specification.</p>
+
+
+<h2>The Basics</h2>
+
+<p>Mini-XML provides a single header file which you include:</p>
+
+<pre>
+ #include &lt;mxml.h&gt;
+</pre>
+
+<p>The Mini-XML library is included with your program using the
+<kbd>-lmxml</kbd> option:</p>
+
+<pre>
+ <kbd>gcc -o myprogram myprogram.c -lmxml ENTER</kbd>
+</pre>
+
+<p>If you have the <tt>pkg-config(1)</tt> software installed,
+you can use it to determine the proper compiler and linker options
+for your installation:</p>
+
+<pre>
+ <kbd>pkg-config --cflags mxml ENTER</kbd>
+ <kbd>pkg-config --libs mxml ENTER</kbd>
+</pre>
+
+<h2>Nodes</h2>
+
+<p>Every piece of information in an XML file (elements, text,
+numbers) is stored in memory in "nodes". Nodes are defined by
+the <a
+href='#mxml_node_t'><tt>mxml_node_t</tt></a>
+structure. The <a
+href='#mxml_type_t'><tt>type</tt></a> member
+defines the node type (element, integer, opaque, real, or text)
+which determines which value you want to look at in the <a
+href='#mxml_value_t'><tt>value</tt></a> union.</p>
+
+<!-- NEED 10 -->
+<center><table width="80%" border="1" cellpadding="5" cellspacing="0" summary="Mini-XML Node Value Members">
+<caption align="bottom"><i>Table 2-1: Mini-XML Node Value Members</i></caption>
+<tr bgcolor="#cccccc">
+ <th>Value</th>
+ <th>Type</th>
+ <th>Node member</th>
+</tr>
+<tr>
+ <td>Custom</td>
+ <td><tt>void *</tt></td>
+ <td><tt>node-&gt;value.custom.data</tt></td>
+</tr>
+<tr>
+ <td>Element</td>
+ <td><tt>char *</tt></td>
+ <td><tt>node-&gt;value.element.name</tt></td>
+</tr>
+<tr>
+ <td>Integer</td>
+ <td><tt>int</tt></td>
+ <td><tt>node-&gt;value.integer</tt></td>
+</tr>
+<tr>
+ <td>Opaque (string)</td>
+ <td><tt>char *</tt></td>
+ <td><tt>node-&gt;value.opaque</tt></td>
+</tr>
+<tr>
+ <td>Real</td>
+ <td><tt>double</tt></td>
+ <td><tt>node-&gt;value.real</tt></td>
+</tr>
+<tr>
+ <td>Text</td>
+ <td><tt>char *</tt></td>
+ <td><tt>node-&gt;value.text.string</tt></td>
+</tr>
+</table></center>
+
+<p>Each node also has a <tt>user_data</tt> member which allows you
+to associate application-specific data with each node as needed.</p>
+
+<p>New nodes are created using the <a
+href='#mxmlNewElement'><tt>mxmlNewElement</tt></a>, <a
+href='#mxmlNewInteger'><tt>mxmlNewInteger</tt></a>, <a
+href='#mxmlNewOpaque'><tt>mxmlNewOpaque</tt></a>, <a
+href='#mxmlNewReal'><tt>mxmlNewReal</tt></a>, <a
+href='#mxmlNewText'><tt>mxmlNewText</tt></a> <a
+href='#mxmlNewTextf'><tt>mxmlNewTextf</tt></a> <a
+href='#mxmlNewXML'><tt>mxmlNewXML</tt></a> functions. Only
+elements can have child nodes, and the top node must be an element,
+usually the <tt>&lt;?xml version="1.0"?&gt;</tt> node created by
+<tt>mxmlNewXML()</tt>.</p>
+
+<p>Nodes have pointers to the node above (<tt>parent</tt>), below
+(<tt>child</tt>), left (<tt>prev</tt>), and right (<tt>next</tt>)
+of the current node. If you have an XML file like the following:</p>
+
+<pre>
+ &lt;?xml version="1.0"?&gt;
+ &lt;data&gt;
+ &lt;node&gt;val1&lt;/node&gt;
+ &lt;node&gt;val2&lt;/node&gt;
+ &lt;node&gt;val3&lt;/node&gt;
+ &lt;group&gt;
+ &lt;node&gt;val4&lt;/node&gt;
+ &lt;node&gt;val5&lt;/node&gt;
+ &lt;node&gt;val6&lt;/node&gt;
+ &lt;/group&gt;
+ &lt;node&gt;val7&lt;/node&gt;
+ &lt;node&gt;val8&lt;/node&gt;
+ &lt;/data&gt;
+</pre>
+
+<p>the node tree for the file would look like the following in
+memory:</p>
+
+<pre>
+ ?xml
+ |
+ data
+ |
+ node - node - node - group - node - node
+ | | | | | |
+ val1 val2 val3 | val7 val8
+ |
+ node - node - node
+ | | |
+ val4 val5 val6
+</pre>
+
+<p>where "-" is a pointer to the next node and "|" is a pointer
+to the first child node.</p>
+
+<p>Once you are done with the XML data, use the <a
+href='#mxmlDelete'><tt>mxmlDelete</tt></a> function to recursively
+free the memory that is used for a particular node or the entire
+tree:</p>
+
+<pre>
+ mxmlDelete(tree);
+</pre>
+
+<!-- NEW PAGE -->
+<h2>Creating XML Documents</h2>
+
+<p>You can create and update XML documents in memory using the
+various <tt>mxmlNew</tt> functions. The following code will
+create the XML document described in the previous section:</p>
+
+<pre>
+ mxml_node_t *xml; /* &lt;?xml ... ?&gt; */
+ mxml_node_t *data; /* &lt;data&gt; */
+ mxml_node_t *node; /* &lt;node&gt; */
+ mxml_node_t *group; /* &lt;group&gt; */
+
+ xml = mxmlNewXML("1.0");
+
+ data = mxmlNewElement(xml, "data");
+
+ node = mxmlNewElement(data, "node");
+ mxmlNewText(node, 0, "val1");
+ node = mxmlNewElement(data, "node");
+ mxmlNewText(node, 0, "val2");
+ node = mxmlNewElement(data, "node");
+ mxmlNewText(node, 0, "val3");
+
+ group = mxmlNewElement(data, "group");
+
+ node = mxmlNewElement(group, "node");
+ mxmlNewText(node, 0, "val4");
+ node = mxmlNewElement(group, "node");
+ mxmlNewText(node, 0, "val5");
+ node = mxmlNewElement(group, "node");
+ mxmlNewText(node, 0, "val6");
+
+ node = mxmlNewElement(data, "node");
+ mxmlNewText(node, 0, "val7");
+ node = mxmlNewElement(data, "node");
+ mxmlNewText(node, 0, "val8");
+</pre>
+
+<p>We start by creating the <tt>&lt;?xml version="1.0"?&gt;</tt>
+node common to all XML files using the <a
+href="#mxmlNewXML"><tt>mxmlNewXML</tt></a> function:</p>
+
+<pre>
+ xml = mxmlNewXML("1.0");
+</pre>
+
+<p>We then create the <tt>&lt;data&gt;</tt> node used for this
+document using the <a
+href="#mxmlNewElement"><tt>mxmlNewElement</tt></a> function. The
+first argument specifies the parent node (<tt>xml</tt>) while the
+second specifies the element name (<tt>data</tt>):</p>
+
+<pre>
+ data = mxmlNewElement(xml, "data");
+</pre>
+
+<p>Each <tt>&lt;node&gt;...&lt;/node&gt;</tt> in the file is
+created using the <tt>mxmlNewElement</tt> and <a
+href="#mxmlNewText"><tt>mxmlNewText</tt></a> functions. The first
+argument of <tt>mxmlNewText</tt> specifies the parent node
+(<tt>node</tt>). The second argument specifies whether whitespace
+appears before the text - 0 or false in this case. The last
+argument specifies the actual text to add:</p>
+
+<pre>
+ node = mxmlNewElement(data, "node");
+ mxmlNewText(node, 0, "val1");
+</pre>
+
+<p>The resulting in-memory XML document can then be saved or
+processed just like one loaded from disk or a string.</p>
+
+<!-- NEW PAGE -->
+<h2>Loading XML</h2>
+
+<p>You load an XML file using the <a
+href='#mxmlLoadFile'><tt>mxmlLoadFile</tt></a>
+function:</p>
+
+<pre>
+ FILE *fp;
+ mxml_node_t *tree;
+
+ fp = fopen("filename.xml", "r");
+ tree = mxmlLoadFile(NULL, fp,
+ MXML_TEXT_CALLBACK);
+ fclose(fp);
+</pre>
+
+<p>The first argument specifies an existing XML parent node, if
+any. Normally you will pass <tt>NULL</tt> for this argument
+unless you are combining multiple XML sources. The XML file must
+contain a complete XML document including the <tt>?xml</tt>
+element if the parent node is <tt>NULL</tt>.</p>
+
+<p>The second argument specifies the stdio file to read from, as
+opened by <tt>fopen()</tt> or <tt>popen()</tt>. You can also use
+<tt>stdin</tt> if you are implementing an XML filter
+program.</p>
+
+<p>The third argument specifies a callback function which returns
+the value type of the immediate children for a new element node:
+<tt>MXML_CUSTOM</tt>, <tt>MXML_IGNORE</tt>,
+<tt>MXML_INTEGER</tt>, <tt>MXML_OPAQUE</tt>, <tt>MXML_REAL</tt>,
+or <tt>MXML_TEXT</tt>. Load callbacks are described in detail in
+<a href='#LOAD_CALLBACKS'>Chapter 3</a>. The example code uses
+the <tt>MXML_TEXT_CALLBACK</tt> constant which specifies that all
+data nodes in the document contain whitespace-separated text
+values. Other standard callbacks include
+<tt>MXML_IGNORE_CALLBACK</tt>, <tt>MXML_INTEGER_CALLBACK</tt>,
+<tt>MXML_OPAQUE_CALLBACK</tt>, and
+<tt>MXML_REAL_CALLBACK</tt>.</p>
+
+<p>The <a href='#mxmlLoadString'><tt>mxmlLoadString</tt></a>
+function loads XML node trees from a string:</p>
+
+<!-- NEED 10 -->
+<pre>
+ char buffer[8192];
+ mxml_node_t *tree;
+
+ ...
+ tree = mxmlLoadString(NULL, buffer,
+ MXML_TEXT_CALLBACK);
+</pre>
+
+<p>The first and third arguments are the same as used for
+<tt>mxmlLoadFile()</tt>. The second argument specifies the
+string or character buffer to load and must be a complete XML
+document including the <tt>?xml</tt> element if the parent node
+is <tt>NULL</tt>.</p>
+
+
+<!-- NEW PAGE -->
+<h2>Saving XML</h2>
+
+<p>You save an XML file using the <a
+href='#mxmlSaveFile'><tt>mxmlSaveFile</tt></a> function:</p>
+
+<pre>
+ FILE *fp;
+ mxml_node_t *tree;
+
+ fp = fopen("filename.xml", "w");
+ mxmlSaveFile(tree, fp, MXML_NO_CALLBACK);
+ fclose(fp);
+</pre>
+
+<p>The first argument is the XML node tree to save. It should
+normally be a pointer to the top-level <tt>?xml</tt> node in
+your XML document.</p>
+
+<p>The second argument is the stdio file to write to, as opened
+by <tt>fopen()</tt> or <tt>popen()</tt>. You can also use
+<tt>stdout</tt> if you are implementing an XML filter
+program.</p>
+
+<p>The third argument is the whitespace callback to use when
+saving the file. Whitespace callbacks are covered in detail in <a
+href='SAVE_CALLBACKS'>Chapter 3</a>. The previous example code
+uses the <tt>MXML_NO_CALLBACK</tt> constant to specify that no
+special whitespace handling is required.</p>
+
+<p>The <a
+href='#mxmlSaveAllocString'><tt>mxmlSaveAllocString</tt></a>,
+and <a href='#mxmlSaveString'><tt>mxmlSaveString</tt></a>
+functions save XML node trees to strings:</p>
+
+<pre>
+ char buffer[8192];
+ char *ptr;
+ mxml_node_t *tree;
+
+ ...
+ mxmlSaveString(tree, buffer, sizeof(buffer),
+ MXML_NO_CALLBACK);
+
+ ...
+ ptr = mxmlSaveAllocString(tree, MXML_NO_CALLBACK);
+</pre>
+
+<p>The first and last arguments are the same as used for
+<tt>mxmlSaveFile()</tt>. The <tt>mxmlSaveString</tt> function
+takes pointer and size arguments for saving the XML document to
+a fixed-size buffer, while <tt>mxmlSaveAllocString()</tt>
+returns a string buffer that was allocated using
+<tt>malloc()</tt>.</p>
+
+<h3>Controlling Line Wrapping</h3>
+
+<p>When saving XML documents, Mini-XML normally wraps output
+lines at column 75 so that the text is readable in terminal
+windows. The <a
+href='#mxmlSetWrapMargin'><tt>mxmlSetWrapMargin</tt></a> function
+overrides the default wrap margin:</p>
+
+<pre>
+ /* Set the margin to 132 columns */
+ mxmlSetWrapMargin(132);
+
+ /* Disable wrapping */
+ mxmlSetWrapMargin(0);
+</pre>
+
+
+<!-- NEW PAGE-->
+<h2>Finding and Iterating Nodes</h2>
+
+<p>The <a
+href='#mxmlWalkPrev'><tt>mxmlWalkPrev</tt></a>
+and <a
+href='#mxmlWalkNext'><tt>mxmlWalkNext</tt></a>functions
+can be used to iterate through the XML node tree:</p>
+
+<pre>
+ mxml_node_t *node;
+
+ node = mxmlWalkPrev(current, tree,
+ MXML_DESCEND);
+
+ node = mxmlWalkNext(current, tree,
+ MXML_DESCEND);
+</pre>
+
+<p>In addition, you can find a named element/node using the <a
+href='#mxmlFindElement'><tt>mxmlFindElement</tt></a>
+function:</p>
+
+<pre>
+ mxml_node_t *node;
+
+ node = mxmlFindElement(tree, tree, "name",
+ "attr", "value",
+ MXML_DESCEND);
+</pre>
+
+<p>The <tt>name</tt>, <tt>attr</tt>, and <tt>value</tt>
+arguments can be passed as <tt>NULL</tt> to act as wildcards,
+e.g.:</p>
+
+<!-- NEED 4 -->
+<pre>
+ /* Find the first "a" element */
+ node = mxmlFindElement(tree, tree, "a",
+ NULL, NULL,
+ MXML_DESCEND);
+</pre>
+<!-- NEED 5 -->
+<pre>
+ /* Find the first "a" element with "href"
+ attribute */
+ node = mxmlFindElement(tree, tree, "a",
+ "href", NULL,
+ MXML_DESCEND);
+</pre>
+<!-- NEED 6 -->
+<pre>
+ /* Find the first "a" element with "href"
+ to a URL */
+ node = mxmlFindElement(tree, tree, "a",
+ "href",
+ "http://www.easysw.com/",
+ MXML_DESCEND);
+</pre>
+<!-- NEED 5 -->
+<pre>
+ /* Find the first element with a "src"
+ attribute */
+ node = mxmlFindElement(tree, tree, NULL,
+ "src", NULL,
+ MXML_DESCEND);
+</pre>
+<!-- NEED 5 -->
+<pre>
+ /* Find the first element with a "src"
+ = "foo.jpg" */
+ node = mxmlFindElement(tree, tree, NULL,
+ "src", "foo.jpg",
+ MXML_DESCEND);
+</pre>
+
+<p>You can also iterate with the same function:</p>
+
+<pre>
+ mxml_node_t *node;
+
+ for (node = mxmlFindElement(tree, tree,
+ "name",
+ NULL, NULL,
+ MXML_DESCEND);
+ node != NULL;
+ node = mxmlFindElement(node, tree,
+ "name",
+ NULL, NULL,
+ MXML_DESCEND))
+ {
+ ... do something ...
+ }
+</pre>
+
+<!-- NEED 10 -->
+<p>The <tt>MXML_DESCEND</tt> argument can actually be one of
+three constants:</p>
+
+<ul>
+
+ <li><tt>MXML_NO_DESCEND</tt> means to not to look at any
+ child nodes in the element hierarchy, just look at
+ siblings at the same level or parent nodes until the top
+ node or top-of-tree is reached.
+
+ <p>The previous node from "group" would be the "node"
+ element to the left, while the next node from "group" would
+ be the "node" element to the right.<br><br></p></li>
+
+ <li><tt>MXML_DESCEND_FIRST</tt> means that it is OK to
+ descend to the first child of a node, but not to descend
+ further when searching. You'll normally use this when
+ iterating through direct children of a parent node, e.g. all
+ of the "node" and "group" elements under the "?xml" parent
+ node in the example above.
+
+ <p>This mode is only applicable to the search function; the
+ walk functions treat this as <tt>MXML_DESCEND</tt> since
+ every call is a first time.<br><br></p></li>
+
+ <li><tt>MXML_DESCEND</tt> means to keep descending until
+ you hit the bottom of the tree. The previous node from
+ "group" would be the "val3" node and the next node would
+ be the first node element under "group".
+
+ <p>If you were to walk from the root node "?xml" to the end
+ of the tree with <tt>mxmlWalkNext()</tt>, the order would
+ be:</p>
+
+ <p><tt>?xml data node val1 node val2 node val3 group node
+ val4 node val5 node val6 node val7 node val8</tt></p>
+
+ <p>If you started at "val8" and walked using
+ <tt>mxmlWalkPrev()</tt>, the order would be reversed,
+ ending at "?xml".</p></li>
+
+</ul>
+
+</body>
+</html>
diff -Naur mxml-2.6/doc/chapters.xcf.gz mxml-2.6-haiku/doc/chapters.xcf.gz
--- mxml-2.6/doc/chapters.xcf.gz 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/chapters.xcf.gz 2007-04-26 22:21:37.000000000 +0000
@@ -0,0 +1,26 @@
+<1F><03>Y x<>Ź<95><C5B9>L<93>I<98> 䐄$'$8<><38><82><B6>Z)<29>A<B8>>UHB<48><12>ł<94><C582>Vk<56>ko<>m+<2B>]<5D>VP<56>Zm+<2B>m-V<><56>6t<36>.6<B8>`Ep<17>f<7F><66><EE>r<CD><72>}<7D><>{<7B><><9F>̼_<CCBC><5F><FE><FF><FC><CB><FC>7<CC><37><EF><F7><B2><BA><B3><FB><F2><F8>U<F6>U<F1><55>:c<><63><B1><E9>t <20><>M<>u3c<33><63>oG<>@+<2B>1<F6>n<<3C> `<60>jܶ<6A>}}wwG<77>&<26>ORc<52><63>Lgw<67>ꎆ<EB>:W<><57>1Y<31>q<B7><71>u<1D>ΞM6v<36>o<B4>\߳1<DFB3>U<91>ju<6A><75>u<FA>7<EB><37>,4lX<6C><58>o<><6F>h<D1><68>G0<47> \<5C><><1E><>z<CE>O <0A><>-/om<6F><6D>Y<1D>[<5B><><DF>?ְ<><D6B0>s^<5E>}M<07><><BD><F5><96>Vm<56><6D>y<><79><F5>ܑї<DC91><D197><E1>=<3D><>3F<1C><03><1E>2<><32><AD><89><8E>3c<<07>x<1A>G<C1><47><A6>_ֈx<D688><78>8{D<>3"<22><><CE><F3><F7>1<80><16>q.<2E><><F0>9?/<2F>즎-<2D>ֵn<D6B5><6E><10>m<98><6D>c<A3>ʦJ<CAA6>s}<0F>ŝ<C2>m<DD>7<9B>/j<><6A><18>H<FF><48><FC><AC>V<EB>s ;<3B><><AF>75<37><35>J<F8><4A><A9>C]޹<>c}<7D>5<E3>*<2A><>V<C6><56>[7oZOGŸ8׺<38><D7BA>u<B3><75>{]k<><6B>͘s<CD98>ʎ<F1><CA8E>K/<2F>ǵ<A2>n<B5>hXٹ<58>͵<C1><CDB5>Mp<>=c<>n޸<6E>s<A9><73><D5><D6><F8>U<8E><55>y<E8>= a<>4<BE>1<><31><9C>[<1A>ׯ숯<D7AF><EC88AF><DC><DA><D3><DA><DD><0F><1A><08>ӿ<CE>.<2E><><F2><F1>`b<>G<E0>Xzŕ<7A><C595><A3><CF>hg<68>]<5D>ֆ<1E>5h<35><68>,Y<16><13>ރ<AC><DE83><99><<3C>`<1C><><F7><05><11><><96><FB><9F>7<D2><37>[<5B><><C1>h<0F>=<3D><><81>㏠ ҃<><D283>33<33><33><A2>w<FA><77>fD<66><44><FB>>]<5D>(}zka<6B><61><EF>_<F7><5F><F7>ưf6Tq<54>޷ 7<>Y<14><> #<23>L<16>e<0F><><98><B1>E%<25>39f<1A>jv<6A>c<BD>L<F2>E<82>}<7D><14>Z<16><><E5><DD>)2SY[v،7<D88C>LU>h&<26>JXqܔ<71>)L~<7E>L4q<34><71><A6>Ք<FF>
+<2B><><A6>0<9C>f2<66>W<D3>ɦ<9A><C9A6><9C>ϙ
+S<06><><FC><AA><89>Lžl<C5BE><6C>R<98>vS <09>[L<>)a<>|Sm&05<30><04><><B0><98>g<82>T3<1E><><BF><BA><00>ZSk<53>1U<31>&<26><08>d<7F><64>z<80>I<99>B<98><42><A6><B2><9E>G֛<02><>^<5E><>[O3<4F>L<F9>-<2D>f:<3A>c<C1><<3C>g<A6><06><>pN:<07>X<CB>=<3D><>Ԟ\<5C><><96>|
+7ǰ<37><C7B0><A2>x<8D>җ"<22><>? <20>+)<29>D<9A> ϼ o<>N<><4E>kxWub
+R<>~<1A><><A1><BE>:x8<78><38><C2><7F>W"<13><><18>z<9D> b4uײ粧<D7B2><E7B2A7><9D>ھ<EA><BB><7F>g<AB>?<3F><>[o<>v<BE><76>?<3F><><FF><F2><E1><EF>v<BA>y3rX<05>v<8B><08><>䑟|a<><1C>JY<4A><<3C><><F9><F8>W<9F><57>Rk<06><13><>1<8D><31>43<34><33><F4>͌a(3L<33><4C><F4>|<7C><>F<13><><BD>z<95><7A>&<26><u<>Q<9A>5"<0F><18><>R,<2C><>&zcG<>L<1A><>t$<24><><A2><D3><CD><D0>4f<34><1B><><B5>,0<>y<FA><79>0<><30><AF><B5><7F><E7><EA>Ǐ<EB><C78F>hr˲-w=<3D><>5t<35><74>33<33><33>hʆ\t<><74>ih4<68>냠]<5D>7o<><6F><AA>Sa<12><><A6><CE><D2>$<24>*տ<>T<C1><54><C1><D4>9<FF><0E>R<A6>cZ%S<>/<2F>RS<52><53>\<5C>)V<><56><CD>,<2C><>C<AC>zS<7A>2<EEB0A0>f<FE>M ӟ<><D39F>J#L<>Q+<2B><83><7F>f<E9> ߾<>U<98><55><B1>X%K3<4B><33><18><>t<B3>n<A3><6E><88>r<83>? <0A>0z-<2D> P<>#l"<22>Y9F=<3D><>ʘ4<CA98>@<40><><17><><00><>D<CA>(<28><>=<3D><>F<46><7F><00>9<><39><9B><C0>n<8D><6E><B7><A0><9E><97>s<EA>^mA<6D><41><FD><85>\<5C>/r<><0F>gt%<25>`<60><05><>fJ<66><4A> <0E>r<AE>߂<1A><>4+0<>C><3E><>/
+<2B><0F><01>w@<40>u<93><14>f<CB><66><FA>G <0B>ֿ<CF>h1<68><31>b<AB>c٩<63>2in<69><6E><8E>?<3F><>s(<28>L<DA>Eͧ<><CDA7>~<7E><>)<29><1E><><1B><><86>B<BF>><3E><><8A><EE>K<14><><ED><A7><14><><FD>6<A2><36>J<FE>"<22><>N<FE><4E><14>AQE<>P<14>h<A7><68>b<A2>4E<34><45><B9>r<B0><03> fa[<5B><>Q<F6><51>ez/<2F>`<60><>: *vČ3uL?<3F><>F+|<7C>A<D8><41><83>
+H<07><0E><1D>wP<77>`<60><><86>:\<5C><>^=<3D><><16>d<F5>R<F7>8<97><03>ĕ<C0>-<2D><><EA>t~<08>I><3E><><D3><CD>XI<>,<2C><>~<7E>z+<2B><07><>Y
+<2B>u?<3F>R<E2><52><01><><97><0E><14><>}<05> 98<39><1A><><97><83>,F,<2C><>;<3B>{<7B><>M|p<1F>oJ<><4A><9B>0<F3>S<14>z<B3><7A>2<FD>i:{#6&g\Yݙ<1F><><ED><BE>OGȖ<47>Q<18>!1<>d<9C>tja&i<>vco2H#Ǘǐ><3E>"mT@<40><>1<CC>+8<><11><>'A<00><><B7><98><E8>%83)<29><><1C>i^<5E><>e<CC><65>Ny<4E><79>F.m<><6D>k<EC><04><><FF><1C><><FC>3<0E>98<39><38><EE>=<3D>/O:<3A><><F8><81>9<AF>up<75><70>&@<40>Q<81>X<D1><58><8B>-<2D>/;<3B><14>ՊL<>wk<77><6B><0E>,<2C><>ݪ<87> <0C>k<90> c,<2C>MXWHGs-<2D>n<EA>q<CC><71>?<3F><><8F><B1>EVKC.A<>Q/<02><><91><89>HA<48>t<99><74>HS<48><53>4 <20><>/<2F><><B3><91><AF><90>V<FE>4<82><34>v<B4>i<><69>Q5HsH~<7E>ME<4D>C2<43>m9<6D>ą<1F><>),2}9R<39>b<AF>b<DB>a<9F>4$<24>H}. <0B><><87>?<3F><>/<2F>L<D2>oʰyS<1D><>2汅<32><E6B185><B8><F5>,<2C><>,<2C>qM<71>L+<2B><>z E<>P<EF>K<94>q<D1><71>):J}<12> Es(<28>E<>S<E7>c<F4>:)<29><><BA><9B>)<29>E<>Q<F7> <09>(<28>8<FA><38><ED><C6>/<2F><>\<5C><>)ډH<DA89>^<5E><1F><>~<7E>s:XM<58>o<A7><6F><1A>V<8A><56>><3E>F<90>z&><3E>$Ę<><C498><B7><13><><B4>-p<><70><14>"ROIq<06><\<5C>1j<31><6A>5m<35>aw<61><77><84><C5>y<D2><79><86>-,<2C>H4<48><34><9F><BD>3<F3>=<3D><06>P<9E>Nƪ?<3F><>_)<29><>6<><36><94><F7>ބd*cQn<51><6E><D7>z<>o<FE><1A><>u;<3B><><E7><B8><DB><19><><C5>v{e<>Kn<4B><6E><93><AC><FC>' <0A>DX<44><58>MLj<4C>t]<5D><>. *<2A><00>T=S<>߀<93><DF80>F <09>@e>k<><6B>t<CD><74>XPY/C60}<7D><>:<3A> <0C><>4<9F>W;h<><68><B1>_<D2><5F><87><A4><9C>O<1D><><DC><EC><A0>9<0E>;(q<><71> ÁtP<74><50><E4>A<C2><41> lvp<76><70><AB><7WY<57>#<23><>|<11><>ɢ>۽<>wN<><4E><B5><B6><A8><BF>a<D1><61><10> <20><17><>g<AF><67><FA>$<24>4<F8>_<05><>e<8B>ǧ<1A><><99>`)\<11><>@ݒ<>d<EE>}<7D>V<16>}<7D>N<00><12>?<3F>I<C3>]1<><31>o<F7><6F>0<A0><30><D9><AE><7F>m<DC>VGжO<D0B6>ީ<A0><DEA9>F<D9> <20>)WD<57><44>@=<3D>]:<3A><>K,<2C>?<3F>Cw<43>7z<37><7A><01>FWA<57>Ӛ!P<>Ơ'=<3D><>5~ (1z<1C><><12><>np<6E>߂z-<06>Xj<58>g:X<><58><E3><0E><><BE><E2><0E>p<9E><70><F0><8C>^q<><71><03> r<><72><F0><96>q<>O:<3A><><D8>79<37>qp<71><70>F<00>WeZ<65><5A>v<14>:<3A>u<E8>!<05> <09><11>G<EC><47><B8>B<C1>ȵ<C0><C8B5>$<24><1A><><AD>9<A1><39>wSAp<41><70>
+<2B>K<82>dx<64><78><04><95><7F><92>
+<2B>d<A8>u<><75>/<2F><>F1Ӏ$~.<2E><><EE>Q3<51>Q6<51><36><89>e<><14>#<23>$ ,$y<>dl9rO<>gKըq<D5A8>*,T1<54>5<D5>$[T<>Ol<4F>P<15>#WA<57>]jAž<41>t<8E><74>)<29>;:J<>)/C<><43><BC><A1><B4><9A><F7>'<27><02><> <0B>W`"<22><>J<BF><1A>Ra<52>I<C9>b<9B>ٯ<D4>|<7C><><83>y<A8>I<CA><49>{<7B>T<AD>b<8F>:<3A>><3E><>V<F7>G<A3><47>!<21>if<69><66>fT<><54><8A>e^<5E>w<FE>T<9B><54>M/<2F><><11><><8D><B9>.ˡXˮ<58><CBAE>=g<><67><B1>K<EC>9<EE>r<89><72><B4><99>mGL<47>ia<69>iM<1B>{<7B><><C4><C4><CC>a<F8>Eײm|ۻD<DBBB><44>}<7D> <09>k<AA><6B><90><D5>ا<EC>ld<6C><64>[<5B>.<2E>I<D0><49><C5>I <1D>Kb~c %<25>D<DF><44>^]<5D><><9F><15><><F6><BE>EǮ<45><C7AE><AF><C0><B2><8C><<3C>o1<6F><31><F4><19><><B4><92>g^y_<>؉<F6><D889>w-<2D>Y^<5E><>><3E><>j~<7E>g<EB><67><BF>ٖ<9A><D996><F1>:<3A>L<85><4C>l<on<6F>`f<1E><>
+<2B>w<A7><77>8<B7><38><BD><0F><>i6<69><36>š<EF8BA1><C29A><85><CA>5,<13>ؐ~<7E>ұ<E8>(<28><><D0><F4>'<27>yuf<75><66><E8>m<13>ҫ<B0><D2AB><CD><E0><A1>g<EB><67>龿DT<44><54><E6><BD>_W<5F>S<9E>s(<28><><A3>U<DC>n<DB><6E><FD>_;<3B>vd<76>w<A2><77><8E><BF><F2><1E><><BD>7^q<><71><F1><18><><BE>Q<F2><00><>`f]1iy<69> <09><01>!Y<>Y<C6>j<><6A>䐗<>XD<58>ȣ 38<33>"<22>F><3E>=<3D>"<22><06>zT<7A>S=_v:<3A><><E7>N<F1><4E>Xe<58><65><A3>@<40><><E4><B6>N<E9><4E><D3><FC>4?<3F><><07><><99>2|rdF<64>A<F5>fz<66><7A>Ab<41>j<B4>{  <09>'<27>ɘ<D2><C998>:<19><><F3>N<B1> <20>Zs <07>#<23>
+*<2A><>N<A0><4E>e<9C><65><F5><CB>!V<>U<D4><55> ?<3F><><FC>(<28><><B1><11>Կ<ED>#fD#k<>"<22>g<B4><67><BD>@<40>b<BB><62>7כ<37>#<23><><FD>g<B1><67>w<B6>ް~s<><73><CF>o2<>{/2m<32>t<F8><74><F1><EF><DF><F5>8<E9>&c<><63><B3><BE>M<F6><4D><B4>>?<3F><><A1><83>C<F2>M½&<26><19><><9B>U><3E>XՍh<D58D><68><FF> <0A>o3V}<19>Z<DA>+ѮAہ<41><DB81><B6><8B><B1><9A>^Eb<><16><>8<96><38><97>f<86>n<B4><6E><B4><AD>XFO<46><4F> <0C><>Z<EF><5A>3<CC><33><A7><99>틋x:o2<6F>ޮj.x<><78><A3>w<F6><77>,<2C>`<60><><A2>y<0E>f<9F><66>5<<3C>#_<>_<EF> y<>Q<AD>^<5E><><C8><C7>F=<3D><><17>*L<><4C>y <09>4<AF><34>^<5E><>F<E3><46><BD><B4><9C>
+<2B><>(<28><>|<7C><>]|2/Go<><15>̨<BC>2y<32>OD]<5D>+9rH<1B><><13>:<3A><>Ws<57><73><17>|*<2A>jh<>5<1C>g<EB><67><A0>r,<2C>yNJ9<C78A><39> <09>^<5E><>y]=<3D><>ӽ<E7>s<A6><73><88>x<03><02>ϴ<E9>[<5B> <0C>Cϟ<43>!<21><><F2><EF><1C><><CB>R<A5>z9<7A>ų<9F><C5B3><8C><BE><93><CF><E6>k,<2C><>y<13>F?͛ <09><03>я<84><D18F>.<04><><8C><C1><FE>,d<>@<40>-kX<G3,<2C><>|.A# <20><><9D>G<98><47><D0><14>f<90>^<5E>$<24>rP <0A><><88>N'<27><>`<60><>"<22>2<80>|><3E>]<5D>_c<5F><63><FB><A4>ЃӃ}] <0B><>Ӄ;/<2F> <20>%8<><38>S+<2B><04><><A7><8F><F4>, N<><4E>l<ED>9<12><1E>ʔy<12>><3E>LJpz`<60>'<27><>VY,<2C><>^Y"<22><><C1><E9><DD>T<B2><54>#<23><>L<B2><4C>=<3D><>\<5C><>9Y<39>ӃIY!<21><><C1>92.<2E><><C1>e<A7><04>+e<>$N<17>j N/<2F>S%q<>,k$q:K<>Jpz<70>Y<B8>I<D6>t<E2>L<00>bY/ <0B><>i2<69><32>5]<5D><><82>e<DB><04>s,ꤜ!s<><73>3%8<>#%8=RnQ<6E><51>Y<12><>-gK<67><4B>ޢ<B4><DEA2>M<95>8<92><38><04><00>y@<40>F<9E>2<1F>s<08>@<40>A<E6>B<D9><00><>2-<2D><>r.A3 <20><><9D>G<98><47><D0><16><>$A<><41>Z@<40><>v:<3A>N8<>P栜<50><E6A09C><8F><BE>]<5D>_`<60>"<22><>N<B4><4E><FB>/<2F><>t<EB><74><C7>"]<10><>5BⴻLd <09>tG<74><47><11>N<B4>J<D7>',<2C><>P<10>K<A7>8A<38><41><10><>r*J8<>+!Jq<>B<BA> p<><70>L<BB> p<>-& Z<>IQ!<21><>lĩ<><14><>]T <09>t<E2><74><16><>|1U<10>M<A7>F<10><><A7>V<10>M<A7>N<10><>E<02><17>zQ@WOĩ<>.<2E>S<88> h<>f[<5B>I1CPQ.f
+p<>[4
+<2B><>̢^!f pz<70><7A>-<2D>ӄE<D384>+<2B>q*<2A> V<00>Sq<1A>q*<2A>,<03>:-kĩ<><C4A9>w<A8><77>M<00>T<E2>#<23>vP NE<4E><45><92>A <0A>֩8<D6A9>`<60><><87><03>N<B0>|<7C>}<7D>_k<5F><6B><FB>/Db<7F><62>]W<>-l<>)<29><><CD><CB><E4>N<F2><0F><><F5>\<5C><>//ʑ8 <20><><ED>E<F6>DYa<59><61><01>ݔ<81>I4<11>'2<>JkZ<16>]<5D><><BD>H<>i|0/<2F>fW?*<2A>F>T<>x{<7B><>4<C9><<3C><>ڋ"<22><>G<85>]<5D>M:<12>`<60><><E3><F6> <20>Dk<><6B><FA><F9>3y\<5C><>)*<2A>O.^<5E><><D9><DB><F7><90>,Z<><5A>G<D5>^<5E><1C>p<9A>΃t/<19><><D5><F6>{ɨ<><C9A8><11><>l<>y<DE><18><>(<28><><B3>Ľd\<5C><>.,K$<17><>{<7B><><89><C1>k<F9><6B>{<7B><><89><A1>w<F3><77>QM<51><4D><B7><BD>ʺ<88><CABA><ED>`<60><0E> <0B>-<2D>k<92><05>%<25>Ś<B6>Z<8D><1F>;<3B>Յ<C6>Bi<42>s<A7><73>i(<28> <0C><>V<AE><56>c<D4><63><B8>u<><75>񗠩3<F197A0A9>*<2A><03>s,G<>=<3D>ds<64><73>E<><45>U<C3>mPzy\o<>V<83><56><CD><E7>%<25><><A6><80>ǡ<85>
+<2B>J<B9><00>[<5B>U<C4><14>8<EF>P<><50><86><8E>/`<04>8<1C><><04>J<><4A>|SJ<53><4A>3<13><> r{"<22>R ǔq<C794><71>9<E6><39><A6><9C>m&q}<14>$<24><>K&<26>L<CB>z9<7A><39><A0>;<3B> *<2A><>
+<2B><<3C>Q<CE>K3<4B>맍 X<0E><><A8>Q|<1E><><C0>*<2A><>C<F7><03><02><><AA>7<EE>`<60><05>qp*<2A><>4j<><6A>4<8A>.<07><>Z<80><5A>B<F7><42><F1>A Հ:<1E>c:<3A><>h<F2><68><BB><0E>u\<5C><>~<7E><><97><ED>>I<><49>3<CE><33>e<9D>;R-=@<40>H<EC>jّ<6A>ײ#U<><55><FD><0E>!v<>*<2A>C<DF>H<EC>C<DD>H<EC><H<>H<EC>C<95>J<CE>ԟ&v$j/<2F>#<23>bˎT <0B>Ŋ<7F>j<A4><6A>H5˲<35><CBB2>;8oّz1<7A>CW<43><1D>ؑ<>vbO<><4F>\&Q <09>z>ؑz<0F><><B1>:B<>H<EC>J<DD>H<14>`<07>nّ<6E><D991>ؑ<97><1D> ؑ<><00>#<23>ؑ<>bG<62>eĎ<65><07><16><>L<8F>2<A0>-R<>t<EF>L<D0><4C>i=ʉ<1D><>4F<34>㠖ؑ<E3A096>A,<2C>Z<19>tp<74><70> <09>:<3A>ھ<><DABE>]<5D>_@<40>.ɎPK,;B<><42><AD>ώP<CF8E><50><89><1C><>U<><55><B6><11><><BA>*i׎Pٖ<1D><><11><><BA>j<>eG<65><47><A8><1D><>,;<3B><><10><>ߖ<1D><><9C><08><>ء<88><D8A1><AB>p<8E><08><0E>`׎p<D78E><70><EC><D0><F3>л<8E><1D><>eG<65>Ď<>w;xwˎp<CB8E><08><0E><06>ǎ<>K<D0><1D><><11><1D>֎<E1>k-(i<>z<><7A>&bG8v<38>=,<2C>;±C-<2D>;<3B><>6<>h<BB><68><87><03><04><0E>}<7D>_k<5F><6B><FB>k2<6B><32><02><1F>nuWS<57>F<D7>B<DD>Z<EA><5A><A8><AB><A1><AE><<3C><>I<B0><49>r= H<>u}<7D><>R<F5><52><B7><92><BA>%<25><><A9><AB><A7><AE>"같<><EAB099>J= <08>u}<7D><>R<F5>N<D7>"<22><><EA>%<25>+<2B><><A3>:l:9<><39>6<A3><14><><D7> <20>1<C5> (AJЀ4<> (AJЀ4<><34>Pf<19>ǛA<C79B>aH R<><52><82><86>!%hH R<><52><82><86>!%hH ;<3B><>2Y/0<> *A<>JР4<> *A<>JР4<> *a<07>Y<95>O jT<<16>X<F1>c<11><><CB><F7>^JS\<5C><><B5>kKq<4B>+<2B>31<33>zP<7A>kF<6B>xR<78>^<5E><0F>}/<2F><><10>e<F0>p<C1>@%<25>/ <20><> *.|<7C><>*<\<1D><>_<>`<08><11> )O͚dj&<26>Lͮ<4C>Ԍ<BE><D48C><A3>i<10>]#D+ X<>f<AF><66><87>W<AD><57>{<7B>
+<1E>Ĥ<D6><C4A4>^VϤ<56><CFA4><A5>N<B2>l'<27><>
+<2B><>C 2<>\-K<><4B>djN<6A><4E><B7>y_j<5F><6A>*p<>+h<><68>#4<1A>5/ކ<><DE86>v$<24><><F3><1B><>$<08><<16>$<1D><>L<90>J<C9>2<A7><32><BD><12><><F4>x<><7F><16>Lij<1D><><B5>V[j<><6A>J<ED><4A>ڨ<><DAA8><F3>k<B7>u<BF>
+[<5B><>߇w{<7B><><BF><12>q<A8>`X%<25>f<90>
+bXO<58><4F><90>Z<F0>+<2B> DR<44><52>fZ <0C><>ZX<5A><58><B9>՜L<D59C><4C><AD><F0>Uߗ<55><03><> <0A>h~w<> <0B><><BB><02>7D<37>=<3D>fY<66><59><E3>ፔ<12><>d<DF><64>\J<>~;<3B><>sثS[<5B><><B7>1<00>h!<><7F>rJ2<4A>g<95>S<DA><53>/<2F><>(<28>'}<7D><01><><F4><85><8D><12>{<7B><>Ah?<3F>q<A9><71><BB>^c<07><><E0><F6>]<5D><0E><>X~<7E>
+<2B>Yjw<6A> x»޻<>N<F0><4E>5<F7><35><BC>=<3D>`<60>xG<78><47>#<23>.<2E><><F1><EE>R<F7><52><12><16><>x<17>{2ޡ <09>M0p<30><70> <0C>`<60><03><>A<FB>
+fQ0<51><30><8F><14><>`5<05>)XQ<58><51>
+VU<56><55>R^V<><56>J<DD>])lN<6C>K<06><> <0C><><01>x<><78>{<08>Q<DE><51><F0>w<1B><><82><F9><08>L<04><><A3><16><><DE><C5>F<9E>8<B0><38><BC><E3><0F><>xo$X%<25>: VJ<56>V<B0><56><12><17><>x_&<26>4<D8><34><C1>.N0u<30><75>L<>`S(<28>D<98>4J<34>H)_)<29>4<E5><34><A5>9);**<2A>5]iN<15><><BA>}<7D><>ky_<79><5F>:?<3F><><94><05><>@<40><08>c<BC><63><03>&s<>{ <0A>y<DE>><3E>w%<25>IL<>`bS#<23><1C><><C1><1E>wD<77>A <13><>;%<25>+<2B>n <09>K<F6>c<B0>=요<EC9A94>rtRO<><4F><CA><F5>2<93><32><82>:<3A>l<C3>z<CB><7A><98><15>8<0E>Q<C9>B<C6><42>!1<>Zh-o2<6F><32>9<03><>S0'x)7a<37>`<18>:<3A><>H<E2>N<E0><17>|<7C>9<82>9Hy <09><><C3><08><>?wr<77><72><AE><C0><12> <09>A<BE>I6F8<0E><><11><><BE><05>/<2F>}<7D><>Ko_<6F><5F><88><T<><54>h<BE>%|<7C><>}<7D><><81>}_<>/<2F>[<03>(<28><><F0>7<11><><<3C><>9"x<12><><C1><A3><F0>70<37><30><11> ow<04>#<23>!<21> nIpO<70><4F>B<9B>ʶإ<CAB6>r<A1>u<F5><75>j}<7D><>+^_<><5F>j8ǾV<C7BE><56>s(<28>}]<5D><>l_s<5F><12>W<DC><57>><3E>պ<F7><D5BA>C)J<>P<FB><50><EA>?X<01><1A>N<F0><4E> <0A><>l<05>2<04>!<21><10><>&E0-<2D><>AE<41><45>(<28>`<60><><F4>/&}i<> M_v<5F>"4Ԥ<34>D<BE>k<>_}9<><39>[_<><5F><EA><86>¾,<2C>E<F6>/<2F>C*<2A>Pa<50><61>;T<><54>"<22><05>/<2F>C<D7><1E>y_܇Z?<3F><><D4> <08>@<40>
+<2B>w>
+c싾ѿ<EC8BBE><D1BF>ѿ<BE><D1BF><A9><BE>d <01>1
\ No newline at end of file
diff -Naur mxml-2.6/doc/docset.css mxml-2.6-haiku/doc/docset.css
--- mxml-2.6/doc/docset.css 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/docset.css 2008-11-28 10:56:50.000000000 +0000
@@ -0,0 +1,114 @@
+body {
+ background: white;
+ color: black;
+ font-family: lucida grande, geneva, helvetica, arial, sans-serif;
+}
+
+h1, h2, h3, h4, h5, h6, p, td, th {
+ font-family: lucida grande, geneva, helvetica, arial, sans-serif;
+}
+
+kbd {
+ color: #006600;
+ font-family: monaco, courier, monospace;
+ font-weight: bold;
+}
+
+pre {
+ font-family: monaco, courier, monospace;
+}
+
+pre.example {
+ background: white;
+ border: dotted thin #999999;
+ margin-left: 36pt;
+ padding: 10px;
+}
+
+pre.example em {
+ color: #3f0000;
+ font-family: lucida grande, geneva, helvetica, arial, sans-serif;
+}
+
+div.summary table {
+ border: solid thin #999999;
+ border-collapse: collapse;
+ border-spacing: 0;
+ margin: 10px;
+ width: 33%;
+}
+
+div.summary table td, div.summary table th {
+ background: white;
+ border: solid thin #999999;
+ border-spacing: 0;
+ padding: 5px;
+ text-align: left;
+ vertical-align: top;
+}
+
+div.summary table thead th {
+ background: #f0f0f0;
+}
+
+div.body h1 {
+ margin: 0;
+}
+div.body h2 {
+ margin-top: 1.5em;
+}
+div.body h3, div.body h4, div.body h5 {
+ margin-bottom: 0.5em;
+ margin-top: 1.5em;
+}
+.class, .enumeration, .function, .struct, .typedef, .union {
+ border-bottom: solid thin #999999;
+ margin-bottom: 0;
+ margin-top: 2em;
+}
+.description {
+ margin-top: 0.5em;
+}
+code, p.code, pre, ul.code li {
+ font-family: monaco, courier, monospace;
+ font-size: 90%;
+}
+ul.code, ul.contents, ul.subcontents {
+ list-style-type: none;
+ margin: 0;
+ padding-left: 0;
+}
+ul.code li {
+ margin: 0;
+}
+ul.contents > li {
+ margin-top: 1em;
+}
+ul.contents li ul.code, ul.contents li ul.subcontents {
+ padding-left: 2em;
+}
+div.body dl {
+ margin-left: 0;
+ margin-top: 0;
+}
+div.body dt {
+ font-style: italic;
+ margin-left: 0;
+ margin-top: 0;
+}
+div.body dd {
+ margin-bottom: 0.5em;
+}
+span.info {
+ background: black;
+ border: thin solid black;
+ color: white;
+ font-size: 80%;
+ font-style: italic;
+ font-weight: bold;
+ white-space: nowrap;
+}
+h2 span.info, h3 span.info, h4 span.info {
+ float: right;
+ font-size: 100%;
+}
diff -Naur mxml-2.6/doc/docset.header mxml-2.6-haiku/doc/docset.header
--- mxml-2.6/doc/docset.header 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/docset.header 2008-11-28 10:56:50.000000000 +0000
@@ -0,0 +1,16 @@
+<h1>Mini-XML API Reference</h1>
+
+<div class='summary'><table summary='General Information'>
+<thead>
+<tr>
+ <th>Header</th>
+ <th>mxml.h</th>
+</tr>
+</thead>
+<tbody>
+<tr>
+ <th>Library</th>
+ <td>-lmxml</td>
+</tr>
+</tbody>
+</table></div>
diff -Naur mxml-2.6/doc/docset.intro mxml-2.6-haiku/doc/docset.intro
--- mxml-2.6/doc/docset.intro 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/docset.intro 2008-11-28 10:56:50.000000000 +0000
@@ -0,0 +1,155 @@
+<h2 class='title'><a name='INTRODUCTION'>Introduction</a></h2>
+
+<p>Mini-XML is a small XML parsing library that you can use to read XML and
+XML-like data files in your application without requiring large non-standard
+libraries. Mini-XML only requires an ANSI C compatible compiler (GCC works,
+as do most vendors' ANSI C compilers) and a "make" program.</p>
+
+<p>Mini-XML provides the following functionality:</p>
+
+<ul>
+
+ <li>Reading of UTF-8 and UTF-16 and writing of UTF-8 encoded XML files
+ and strings.</li>
+
+ <li>Data is stored in a linked-list tree structure, preserving the XML
+ data hierarchy.</li>
+
+ <li>Supports arbitrary element names, attributes, and attribute values
+ with no preset limits, just available memory.</li>
+
+ <li>Supports integer, real, opaque ("cdata"), and text data types in
+ "leaf" nodes.</li>
+
+ <li>Functions for creating, indexing, and managing trees of data.</li>
+
+ <li>"Find" and "walk" functions for easily locating and navigating trees
+ of data.</li>
+
+</ul>
+
+<p>Mini-XML doesn't do validation or other types of processing on the data based
+upon schema files or other sources of definition information, nor does it
+support character entities other than those required by the XML
+specification.</p>
+
+<h2 class='title'><a name='USING'>Using Mini-XML</a></h2>
+
+<p>Mini-XML provides a single header file which you include:</p>
+
+<pre class='example'>
+#include &lt;mxml.h&gt;
+</pre>
+
+<p>Nodes are defined by the "<a href='#mxml_node_s'>mxml_node_t</a>" structure;
+the "type" member defines the node type (element, integer, opaque, real, or
+text) which determines which value you want to look at in the "value" union.
+New nodes can be created using the
+"<a href='#mxmlNewElement'>mxmlNewElement()</a>",
+"<a href='#mxmlNewInteger'>mxmlNewInteger()</a>",
+"<a href='#mxmlNewOpaque'>mxmlNewOpaque()</a>",
+"<a href='#mxmlNewReal'>mxmlNewReal()</a>", and
+"<a href='#mxmlNewText'>mxmlNewText()</a>" functions. Only elements can have
+child nodes, and the top node must be an element, usually "?xml".</p>
+
+<p>You load an XML file using the "mxmlLoadFile()" function:</p>
+
+<pre class='example'>
+FILE *fp;
+mxml_node_t *tree;
+
+fp = fopen("filename.xml", "r");
+tree = mxmlLoadFile(NULL, fp, MXML_NO_CALLBACK);
+fclose(fp);
+</pre>
+
+<p>Similarly, you save an XML file using the
+"<a href='#mxmlSaveFile'>mxmlSaveFile()</a>" function:
+
+<pre class='example'>
+FILE *fp;
+mxml_node_t *tree;
+
+fp = fopen("filename.xml", "w");
+mxmlSaveFile(tree, fp, MXML_NO_CALLBACK);
+fclose(fp);
+</pre>
+
+<p>The "<a href='#mxmlLoadString'>mxmlLoadString()</a>",
+"<a href='#mxmlSaveAllocString'>mxmlSaveAllocString()</a>", and
+"<a href='#mxmlSaveString'>mxmlSaveString()</a>" functions load XML node trees
+from and save XML node trees to strings:</p>
+
+<pre class='example'>
+char buffer[8192];
+char *ptr;
+mxml_node_t *tree;
+
+...
+tree = mxmlLoadString(NULL, buffer, MXML_NO_CALLBACK);
+
+...
+mxmlSaveString(tree, buffer, sizeof(buffer),
+ MXML_NO_CALLBACK);
+
+...
+ptr = mxmlSaveAllocString(tree, MXML_NO_CALLBACK);
+</pre>
+
+<p>You can find a named element/node using the
+"<a href='#mxmlFindElement'>mxmlFindElement()</a>" function:</p>
+
+<pre class='example'>
+mxml_node_t *node = mxmlFindElement(tree, tree, "name",
+ "attr", "value",
+ MXML_DESCEND);
+</pre>
+
+<p>The "name", "attr", and "value" arguments can be passed as
+<code>NULL</code> to act as wildcards, e.g.:</p>
+
+<pre class='example'>
+/* Find the first "a" element */
+node = mxmlFindElement(tree, tree, "a", NULL, NULL,
+ MXML_DESCEND);
+
+/* Find the first "a" element with "href" attribute */
+node = mxmlFindElement(tree, tree, "a", "href", NULL,
+ MXML_DESCEND);
+
+/* Find the first "a" element with "href" to a URL */
+node = mxmlFindElement(tree, tree, "a", "href",
+ "http://www.easysw.com/~mike/mxml/",
+ MXML_DESCEND);
+
+/* Find the first element with a "src" attribute*/
+node = mxmlFindElement(tree, tree, NULL, "src", NULL,
+ MXML_DESCEND);
+
+/* Find the first element with a "src" = "foo.jpg" */
+node = mxmlFindElement(tree, tree, NULL, "src",
+ "foo.jpg", MXML_DESCEND);
+</pre>
+
+<p>You can also iterate with the same function:</p>
+
+<pre class='example'>
+mxml_node_t *node;
+
+for (node = mxmlFindElement(tree, tree, "name", NULL,
+ NULL, MXML_DESCEND);
+ node != NULL;
+ node = mxmlFindElement(node, tree, "name", NULL,
+ NULL, MXML_DESCEND))
+{
+ ... do something ...
+}
+</pre>
+
+<p>Finally, once you are done with the XML data, use the
+"<a href='#mxmlDelete'>mxmlDelete()</a>" function to recursively free the
+memory that is used for a particular node or the entire tree:</p>
+
+<pre class='example'>
+mxmlDelete(tree);
+</pre>
diff -Naur mxml-2.6/doc/footer.man mxml-2.6-haiku/doc/footer.man
--- mxml-2.6/doc/footer.man 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/footer.man 2008-01-29 05:28:31.000000000 +0000
@@ -0,0 +1,4 @@
+.SH SEE ALSO
+mxmldoc(1), Mini-XML Programmers Manual, http://www.minixml.org/
+.SH COPYRIGHT
+Copyright 2003-2008 by Michael Sweet.
diff -Naur mxml-2.6/doc/install.html mxml-2.6-haiku/doc/install.html
--- mxml-2.6/doc/install.html 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/install.html 2007-04-26 22:21:37.000000000 +0000
@@ -0,0 +1,119 @@
+<html>
+<body>
+
+<h1 align='right'><a name='INSTALL'><img src="1.gif" align="right"
+hspace="10" width="100" height="100" alt="1"></a>Building,
+Installing, and Packaging Mini-XML</h1>
+
+<p>This chapter describes how to build, install, and package
+Mini-XML on your system from the source archive. You will need an
+ANSI/ISO-C compatible compiler to build Mini-XML - GCC works, as
+do most vendors' C compilers. If you are building Mini-XML on
+Windows, we recommend using the Visual C++ environment with the
+supplied solution file. For other operating systems, you'll need a
+POSIX-compatible shell and <tt>make</tt> program in addition to
+the C compiler.</p>
+
+<h2>Compiling Mini-XML</h2>
+
+<p>Mini-XML comes with both an autoconf-based configure script
+and a Visual C++ solution that can be used to compile the library
+and associated tools.</p>
+
+<h3>Compiling with Visual C++</h3>
+
+<p>Open the <VAR>mxml.sln</VAR> solution in the <VAR>vcnet</VAR>
+folder. Choose the desired build configuration, "Debug" (the
+default) or "Release", and then choose <VAR>Build Solution</VAR>
+from the <VAR>Build</VAR> menu.</p>
+
+<h3>Compiling with Command-Line Tools</h3>
+
+<p>Type the following command to configure the Mini-XML source
+code for your system:</p>
+
+<pre>
+ <kbd>./configure ENTER</kbd>
+</pre>
+
+<p>The default install prefix is <var>/usr/local</var>, which
+can be overridden using the <kbd>--prefix</kbd> option:</p>
+
+<pre>
+ <kbd>./configure --prefix=/foo ENTER</kbd>
+</pre>
+
+<p>Other configure options can be found using the
+<kbd>--help</kbd> option:</p>
+
+<pre>
+ <kbd>./configure --help ENTER</kbd>
+</pre>
+
+<p>Once you have configured the software, use the
+<tt>make(1)</tt> program to do the build and run the test
+program to verify that things are working, as follows:</p>
+
+<pre>
+ <kbd>make ENTER</kbd>
+</pre>
+
+
+<h2>Installing Mini-XML</h2>
+
+<p>If you are using Visual C++, copy the <VAR>mxml.lib</VAR> and
+and <VAR>mxml.h</VAR> files to the Visual C++ <VAR>lib</VAR> and
+<VAR>include<VAR> directories, respectively.</p>
+
+<p>Otherwise, use the <tt>make</tt> command with the
+<kbd>install</kbd> target to install Mini-XML in the configured
+directories:</p>
+
+<pre>
+ <kbd>make install ENTER</kbd>
+</pre>
+
+
+<h2>Creating Mini-XML Packages</h2>
+
+<p>Mini-XML includes two files that can be used to create binary
+packages. The first file is <var>mxml.spec</var> which is used
+by the <tt>rpmbuild(8)</tt> software to create Red Hat Package
+Manager ("RPM") packages which are commonly used on Linux. Since
+<tt>rpmbuild</tt> wants to compile the software on its own, you
+can provide it with the Mini-XML tar file to build the
+package:</p>
+
+<pre>
+ <kbd>rpmbuild -ta mxml-<i>version</i>.tar.gz ENTER</kbd>
+</pre>
+
+<p>The second file is <var>mxml.list</var> which is used by the
+<tt>epm(1)</tt> program to create software packages in a variety
+of formats. The <tt>epm</tt> program is available from the
+following URL:</p>
+
+<pre>
+ <a href='http://www.easysw.com/epm/'>http://www.easysw.com/epm/</a>
+</pre>
+
+<p>Use the <tt>make</tt> command with the <kbd>epm</kbd> target
+to create portable and native packages for your system:</p>
+
+<pre>
+ <kbd>make epm ENTER</kbd>
+</pre>
+
+<p>The packages are stored in a subdirectory named
+<var>dist</var> for your convenience. The portable packages
+utilize scripts and tar files to install the software on the
+target system. After extracting the package archive, use the
+<var>mxml.install</var> script to install the software.</p>
+
+<p>The native packages will be in the local OS's native format:
+RPM for Red Hat Linux, DPKG for Debian Linux, PKG for Solaris,
+and so forth. Use the corresponding commands to install the
+native packages.</p>
+
+</body>
+</html>
diff -Naur mxml-2.6/doc/intro.html mxml-2.6-haiku/doc/intro.html
--- mxml-2.6/doc/intro.html 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/intro.html 2009-05-17 06:04:58.000000000 +0000
@@ -0,0 +1,197 @@
+<html>
+<head>
+ <title>Mini-XML Programmers Manual, Version 2.6</title>
+ <meta name='copyright' content='Copyright 2003-2009'>
+ <meta name='author' content='Michael R. Sweet'>
+ <meta name='keywords' content='XML, C, C++, library'>
+</head>
+<body>
+
+<h1 align='right'><a name='INTRO'><img src="0.gif" align="right"
+hspace="10" width="100" height="100" alt="0"></a>Introduction</h1>
+
+<p>This programmers manual describes Mini-XML version 2.6, a small
+XML parsing library that you can use to read and write XML data
+files in your C and C++ applications.</p>
+
+<p>Mini-XML was initially developed for the <a
+href='http://gutenprint.sf.net/'>Gutenprint</a> project to replace
+the rather large and unwieldy <tt>libxml2</tt> library with
+something substantially smaller and easier-to-use. It all began one
+morning in June of 2003 when Robert posted the following sentence to
+the developer's list:</p>
+
+<blockquote><em>It's bad enough that we require libxml2, but rolling
+our own XML parser is a bit more than we can
+handle.</em></blockquote>
+
+<p>I then replied with:</p>
+
+<blockquote><em>Given the limited scope of what you use in XML, it
+should be trivial to code a mini-XML API in a few hundred lines of
+code.</em></blockquote>
+
+<p>I took my own challenge and coded furiously for two days to
+produced the initial public release of Mini-XML, total lines of
+code: 696. Robert promptly integrated Mini-XML into Gutenprint
+and removed libxml2.</p>
+
+<p>Thanks to lots of feedback and support from various
+developers, Mini-XML has evolved since then to provide a more
+complete XML implementation and now stands at a whopping 3,441
+lines of code, compared to 103,893 lines of code for libxml2
+version 2.6.9.</p>
+
+<p>Aside from Gutenprint, Mini-XML is used for the
+following projects/software applications:</p>
+
+<ul>
+
+ <li><a href='http://www.cups.org/'>Common UNIX Printing
+ System</a></li>
+
+ <li><a
+ href='http://zynaddsubfx.sourceforge.net'>ZynAddSubFX</a></li>
+
+</ul>
+
+<p>Please email me (mxml @ easysw . com) if you would like your
+project added or removed from this list, or if you have any
+comments/quotes you would like me to publish about your
+experiences with Mini-XML.</p>
+
+<!-- NEED 1in -->
+<h2>Organization of This Document</h2>
+
+<p>This manual is organized into the following chapters and
+appendices:</p>
+
+<ul>
+
+ <li>Chapter 1, "<a href='#INSTALL'>Building,
+ Installing, and Packaging Mini-XML</a>", provides
+ compilation, installation, and packaging instructions for
+ Mini-XML.</li>
+
+ <li>Chapter 2, "<a href='#BASICS'>Getting
+ Started with Mini-XML</a>", shows how to use the
+ Mini-XML library in your programs.</li>
+
+ <li>Chapter 3, "<a href='#ADVANCED'>More
+ Mini-XML Programming Techniques</a>", shows additional
+ ways to use the Mini-XML library.</li>
+
+ <li>Chapter 4, "<a href='#MXMLDOC'>Using the
+ mxmldoc Utility</a>", describes how to use the
+ <tt>mxmldoc(1)</tt> program to generate software
+ documentation.</li>
+
+ <li>Appendix A, "<a href='#LICENSE'>Mini-XML License</a>",
+ provides the terms and conditions for using and distributing
+ Mini-XML.</li>
+
+ <li>Appendix B, "<a href='#RELNOTES'>Release Notes</a>",
+ lists the changes in each release of Mini-XML.</li>
+
+ <li>Appendix C, "<a href='#REFERENCE'>Library
+ Reference</a>", contains a complete reference for
+ Mini-XML, generated by <tt>mxmldoc</tt>.</li>
+
+ <li>Appendix D, "<a href='#SCHEMA'>XML Schema</a>", shows
+ the XML schema used for the XML files produced by
+ <tt>mxmldoc</tt>.</li>
+
+</ul>
+
+<!-- NEED 10 -->
+<h2>Notation Conventions</h2>
+
+<p>Various font and syntax conventions are used in this guide.
+Examples and their meanings and uses are explained below:</p>
+
+<dl>
+
+ <dt><code>mxmldoc</code><br>
+ <code>mxmldoc(1)</code></dt>
+
+ <dd>The names of commands; the first mention of a command
+ or function in a chapter is followed by a manual page
+ section number.<br><br></dd>
+
+ <dt><var>/var</var><br>
+ <var>/etc/hosts</var></dt>
+
+ <dd>File and directory names.<br><br></dd>
+
+ <dt><tt>Request ID is Printer-123</tt></dt>
+
+ <dd>Screen output.<br><br></dd>
+
+ <dt><kbd>lp -d printer filename ENTER</kbd></dt>
+
+ <dd>Literal user input; special keys like
+ <kbd>ENTER</kbd> are in ALL CAPS.<br><br></dd>
+
+ <dt>12.3</dt>
+
+ <dd>Numbers in the text are written using the period (.)
+ to indicate the decimal point.<br><br></dd>
+
+</dl>
+
+<!-- NEED 10 -->
+<h2>Abbreviations</h2>
+
+<p>The following abbreviations are used throughout this
+manual:</p>
+
+<dl>
+
+ <dt>Gb</dt>
+ <dd>Gigabytes, or 1073741824 bytes<br><br></dd>
+
+ <dt>kb</dt>
+ <dd>Kilobytes, or 1024 bytes<br><br></dd>
+
+ <dt>Mb</dt>
+ <dd>Megabytes, or 1048576 bytes<br><br></dd>
+
+ <dt>UTF-8, UTF-16</dt>
+ <dd>Unicode Transformation Format, 8-bit or 16-bit<br><br></dd>
+
+ <dt>W3C</dt>
+ <dd>World Wide Web Consortium<br><br></dd>
+
+ <dt>XML</dt>
+ <dd>Extensible Markup Language<br><br></dd>
+
+</dl>
+
+<!-- NEED 12 -->
+<h2>Other References</h2>
+
+<dl>
+
+ <dt>The Unicode Standard, Version 4.0, Addison-Wesley,
+ ISBN 0-321-18578-1</dt>
+
+ <dd>The definition of the Unicode character set which is
+ used for XML.<br><br></dd>
+
+ <dt><a
+ href='http://www.w3.org/TR/2004/REC-xml-20040204/'>Extensible
+ Markup Language (XML) 1.0 (Third Edition)</a></dt>
+
+ <dd>The XML specification from the World Wide Web
+ Consortium (W3C)<br><br></dd>
+
+</dl>
+
+<!-- NEED 6 -->
+<h2>Legal Stuff</h2>
+
+<p>The Mini-XML library is copyright 2003-2009 by Michael Sweet. License terms
+are described in <a href='#LICENSE'>Appendix A - Mini-XML License</a>.</p>
+
+</body>
+</html>
diff -Naur mxml-2.6/doc/intro.man mxml-2.6-haiku/doc/intro.man
--- mxml-2.6/doc/intro.man 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/intro.man 2008-01-29 05:28:31.000000000 +0000
@@ -0,0 +1,150 @@
+.SH INCLUDE FILE
+#include <mxml.h>
+.SH LIBRARY
+\-lmxml
+.SH DESCRIPTION
+Mini-XML is a small XML parsing library that you can use to
+read XML and XML-like data files in your application without
+requiring large non-standard libraries. Mini-XML only
+requires an ANSI C compatible compiler (GCC works, as do
+most vendors' ANSI C compilers) and a "make" program.
+.PP
+Mini-XML provides the following functionality:
+.IP \(bu 4
+Reading of UTF-8 and UTF-16 and writing of UTF-8 encoded XML files and strings.
+.IP \(bu 4
+Data is stored in a linked-list tree structure,
+preserving the XML data hierarchy.
+.IP \(bu 4
+Supports arbitrary element names, attributes, and attribute
+values with no preset limits, just available memory.
+.IP \(bu 4
+Supports integer, real, opaque ("cdata"), and text data types in
+"leaf" nodes.
+.IP \(bu 4
+Functions for creating, indexing, and managing trees of data.
+.IP \(bu 4
+"Find" and "walk" functions for easily locating and navigating
+trees of data.
+.PP
+Mini-XML doesn't do validation or other types of processing
+on the data based upon schema files or other sources of
+definition information, nor does it support character
+entities other than those required by the XML
+specification.
+.SH USING MINI-XML
+Mini-XML provides a single header file which you include:
+.nf
+
+ #include <mxml.h>
+.fi
+.PP
+Nodes are defined by the "mxml_node_t" structure; the "type"
+member defines the node type (element, integer, opaque,
+real, or text) which determines which value you want to look
+at in the "value" union. New nodes can be created using the
+"mxmlNewElement()", "mxmlNewInteger()", "mxmlNewOpaque()",
+"mxmlNewReal()", and "mxmlNewText()" functions. Only
+elements can have child nodes, and the top node must be an
+element, usually "?xml".
+.PP
+You load an XML file using the "mxmlLoadFile()" function:
+.nf
+
+ FILE *fp;
+ mxml_node_t *tree;
+
+ fp = fopen("filename.xml", "r");
+ tree = mxmlLoadFile(NULL, fp, MXML_NO_CALLBACK);
+ fclose(fp);
+.fi
+.PP
+Similarly, you save an XML file using the "mxmlSaveFile()"
+function:
+.nf
+
+ FILE *fp;
+ mxml_node_t *tree;
+
+ fp = fopen("filename.xml", "w");
+ mxmlSaveFile(tree, fp, MXML_NO_CALLBACK);
+ fclose(fp);
+.fi
+.PP
+The "mxmlLoadString()", "mxmlSaveAllocString()", and
+"mxmlSaveString()" functions load XML node trees from and save
+XML node trees to strings:
+.nf
+
+ char buffer[8192];
+ char *ptr;
+ mxml_node_t *tree;
+
+ ...
+ tree = mxmlLoadString(NULL, buffer, MXML_NO_CALLBACK);
+
+ ...
+ mxmlSaveString(tree, buffer, sizeof(buffer),
+ MXML_NO_CALLBACK);
+
+ ...
+ ptr = mxmlSaveAllocString(tree, MXML_NO_CALLBACK);
+.fi
+.PP
+You can find a named element/node using the "mxmlFindElement()"
+function:
+.nf
+
+ mxml_node_t *node = mxmlFindElement(tree, tree, "name",
+ "attr", "value",
+ MXML_DESCEND);
+.fi
+.PP
+The "name", "attr", and "value" arguments can be passed as
+NULL to act as wildcards, e.g.:
+.nf
+
+ /* Find the first "a" element */
+ node = mxmlFindElement(tree, tree, "a", NULL, NULL,
+ MXML_DESCEND);
+
+ /* Find the first "a" element with "href" attribute */
+ node = mxmlFindElement(tree, tree, "a", "href", NULL,
+ MXML_DESCEND);
+
+ /* Find the first "a" element with "href" to a URL */
+ node = mxmlFindElement(tree, tree, "a", "href",
+ "http://www.easysw.com/~mike/mxml/",
+ MXML_DESCEND);
+
+ /* Find the first element with a "src" attribute*/
+ node = mxmlFindElement(tree, tree, NULL, "src", NULL,
+ MXML_DESCEND);
+
+ /* Find the first element with a "src" = "foo.jpg" */
+ node = mxmlFindElement(tree, tree, NULL, "src",
+ "foo.jpg", MXML_DESCEND);
+.fi
+.PP
+You can also iterate with the same function:
+.nf
+
+ mxml_node_t *node;
+
+ for (node = mxmlFindElement(tree, tree, "name", NULL,
+ NULL, MXML_DESCEND);
+ node != NULL;
+ node = mxmlFindElement(node, tree, "name", NULL,
+ NULL, MXML_DESCEND))
+ {
+ ... do something ...
+ }
+.fi
+.PP
+Finally, once you are done with the XML data, use the
+"mxmlDelete()" function to recursively free the memory that
+is used for a particular node or the entire tree:
+.nf
+
+ mxmlDelete(tree);
+.fi
diff -Naur mxml-2.6/doc/license.html mxml-2.6-haiku/doc/license.html
--- mxml-2.6/doc/license.html 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/license.html 2009-05-17 06:04:58.000000000 +0000
@@ -0,0 +1,598 @@
+<html>
+<body>
+
+<h1 align='right'><a name='LICENSE'><img src="A.gif" align="right"
+hspace="10" width="100" height="100" alt="A"></a>Mini-XML
+License</h1>
+
+<p>The Mini-XML library and included programs are provided under
+the terms of the GNU Library General Public License (LGPL) with
+the following exceptions:</p>
+
+<ol>
+
+ <li>Static linking of applications to the Mini-XML
+ library does not constitute a derivative work and does
+ not require the author to provide source code for the
+ application, use the shared Mini-XML libraries, or link
+ their applications against a user-supplied version of
+ Mini-XML.
+
+ <p><i>If you link the application to a modified version
+ of Mini-XML, then the changes to Mini-XML must be
+ provided under the terms of the LGPL in sections 1, 2,
+ and 4.</i></p>
+ </li>
+
+ <li>You do not have to provide a copy of the Mini-XML
+ license with programs that are linked to the Mini-XML
+ library, nor do you have to identify the Mini-XML license
+ in your program or documentation as required by section 6
+ of the LGPL.</li>
+
+</ol>
+
+<!-- NEW PAGE -->
+<p align=center><b>GNU LIBRARY GENERAL PUBLIC LICENSE</b></p>
+<p align='center'>Version 2, June 1991
+<br />Copyright (C) 1991 Free Software Foundation, Inc.
+<br />59 Temple Place - Suite 330, Boston, MA 02111-1307, USA
+<br />Everyone is permitted to copy and distribute verbatim copies of
+this license document, but changing it is not allowed.
+<br />[This is the first released version of the library GPL. It is
+numbered 2 because it goes with version 2 of the ordinary GPL.]</p>
+
+<p><b>Preamble</b></p>
+
+<p>The licenses for most software are designed to take away your freedom
+to share and change it. By contrast, the GNU General Public Licenses
+are intended to guarantee your freedom to share and change free
+software--to make sure the software is free for all its users.</p>
+
+<p>This license, the Library General Public License, applies to some
+specially designated Free Software Foundation software, and to any
+other libraries whose authors decide to use it. You can use it for
+your libraries, too.</p>
+
+<p>When we speak of free software, we are referring to freedom,
+not price. Our General Public Licenses are designed to make sure
+that you have the freedom to distribute copies of free software
+(and charge for this service if you wish), that you receive
+source code or can get it if you want it, that you can change
+the software or use pieces of it in new free programs; and that
+you know you can do these things.</p>
+
+<p>To protect your rights, we need to make restrictions that
+forbid anyone to deny you these rights or to ask you to
+surrender the rights. These restrictions translate to certain
+responsibilities for you if you distribute copies of the
+library, or if you modify it.</p>
+
+<p>For example, if you distribute copies of the library, whether
+gratis or for a fee, you must give the recipients all the rights
+that we gave you. You must make sure that they, too, receive or
+can get the source code. If you link a program with the library,
+you must provide complete object files to the recipients so that
+they can relink them with the library, after making changes to
+the library and recompiling it. And you must show them these
+terms so they know their rights.</p>
+
+<p>Our method of protecting your rights has two steps: (1)
+copyright the library, and (2) offer you this license which
+gives you legal permission to copy, distribute and/or modify the
+library.</p>
+
+<p>Also, for each distributor's protection, we want to make
+certain that everyone understands that there is no warranty for
+this free library. If the library is modified by someone else
+and passed on, we want its recipients to know that what they
+have is not the original version, so that any problems
+introduced by others will not reflect on the original authors'
+reputations.</p>
+
+<p>Finally, any free program is threatened constantly by
+software patents. We wish to avoid the danger that companies
+distributing free software will individually obtain patent
+licenses, thus in effect transforming the program into
+proprietary software. To prevent this, we have made it clear
+that any patent must be licensed for everyone's free use or not
+licensed at all.</p>
+
+<p>Most GNU software, including some libraries, is covered by
+the ordinary GNU General Public License, which was designed for
+utility programs. This license, the GNU Library General Public
+License, applies to certain designated libraries. This license
+is quite different from the ordinary one; be sure to read it in
+full, and don't assume that anything in it is the same as in the
+ordinary license.</p>
+
+<p>The reason we have a separate public license for some
+libraries is that they blur the distinction we usually make
+between modifying or adding to a program and simply using it.
+Linking a program with a library, without changing the library,
+is in some sense simply using the library, and is analogous to
+running a utility program or application program. However, in a
+textual and legal sense, the linked executable is a combined
+work, a derivative of the original library, and the ordinary
+General Public License treats it as such.</p>
+
+<p>Because of this blurred distinction, using the ordinary
+General Public License for libraries did not effectively promote
+software sharing, because most developers did not use the
+libraries. We concluded that weaker conditions might promote
+sharing better.</p>
+
+<p>However, unrestricted linking of non-free programs would
+deprive the users of those programs of all benefit from the free
+status of the libraries themselves. This Library General Public
+License is intended to permit developers of non-free programs to
+use free libraries, while preserving your freedom as a user of
+such programs to change the free libraries that are incorporated
+in them. (We have not seen how to achieve this as regards
+changes in header files, but we have achieved it as regards
+changes in the actual functions of the Library.) The hope is
+that this will lead to faster development of free libraries.</p>
+
+<p>The precise terms and conditions for copying, distribution
+and modification follow. Pay close attention to the difference
+between a &quot;work based on the libary&quot; and a &quot;work
+that uses the library&quot;. The former contains code derived
+from the library, while the latter only works together with the
+library.</p>
+
+<p>Note that it is possible for a library to be covered by the
+ordinary General Public License rather than by this special
+one.</p>
+
+<p align='center'><b>TERMS AND CONDITIONS FOR COPYING,
+DISTRIBUTION AND MODIFICATION</b></p>
+
+<p><strong>0.</strong> This License Agreement applies to any
+software library which contains a notice placed by the copyright
+holder or other authorized party saying it may be distributed
+under the terms of this Library General Public License (also
+called &quot;this License&quot;). Each licensee is addressed as
+&quot;you&quot;.
+
+<p>A &quot;library&quot; means a collection of software
+functions and/or data prepared so as to be conveniently linked
+with application programs (which use some of those functions and
+data) to form executables.</p>
+
+<p>The &quot;Library&quot;, below, refers to any such software
+library or work which has been distributed under these terms. A
+&quot;work based on the Library&quot; means either the Library
+or any derivative work under copyright law: that is to say, a
+work containing the Library or a portion of it, either verbatim
+or with modifications and/or translated straightforwardly into
+another language. (Hereinafter, translation is included without
+limitation in the term &quot;modification&quot;.)</p>
+
+<p>&quot;Source code&quot; for a work means the preferred form
+of the work for making modifications to it. For a library,
+complete source code means all the source code for all modules
+it contains, plus any associated interface definition files,
+plus the scripts used to control compilation and installation of
+the library.</p>
+
+<p>Activities other than copying, distribution and modification
+are not covered by this License; they are outside its scope. The
+act of running a program using the Library is not restricted,
+and output from such a program is covered only if its contents
+constitute a work based on the Library (independent of the use
+of the Library in a tool for writing it). Whether that is true
+depends on what the Library does and what the program that uses
+the Library does.</p>
+
+<p><strong>1.</strong> You may copy and distribute verbatim
+copies of the Library's complete source code as you receive it,
+in any medium, provided that you conspicuously and appropriately
+publish on each copy an appropriate copyright notice and
+disclaimer of warranty; keep intact all the notices that refer
+to this License and to the absence of any warranty; and
+distribute a copy of this License along with the Library.</p>
+
+<p>You may charge a fee for the physical act of transferring a
+copy, and you may at your option offer warranty protection in
+exchange for a fee.</p>
+
+<p><strong>2.</strong> You may modify your copy or copies of the
+Library or any portion of it, thus forming a work based on the
+Library, and copy and distribute such modifications or work
+under the terms of Section 1 above, provided that you also meet
+all of these conditions:</p>
+
+<ul>
+
+ <p><strong>a)</strong> The modified work must itself be
+ a software library.
+
+ <p><strong>b)</strong> You must cause the files modified
+ to carry prominent notices stating that you changed the
+ files and the date of any change.</p>
+
+ <p><strong>c)</strong> You must cause the whole of the
+ work to be licensed at no charge to all third parties
+ under the terms of this License.</p>
+
+ <p><strong>d)</strong> If a facility in the modified
+ Library refers to a function or a table of data to be
+ supplied by an application program that uses the
+ facility, other than as an argument passed when the
+ facility is invoked, then you must make a good faith
+ effort to ensure that, in the event an application does
+ not supply such function or table, the facility still
+ operates, and performs whatever part of its purpose
+ remains meaningful.</p>
+
+ <p>(For example, a function in a library to compute
+ square roots has a purpose that is entirely well-defined
+ independent of the application. Therefore, Subsection 2d
+ requires that any application-supplied function or table
+ used by this function must be optional: if the
+ application does not supply it, the square root function
+ must still compute square roots.)</p>
+
+</ul>
+
+<p>These requirements apply to the modified work as a whole. If
+identifiable sections of that work are not derived from the
+Library, and can be reasonably considered independent and
+separate works in themselves, then this License, and its terms,
+do not apply to those sections when you distribute them as
+separate works. But when you distribute the same sections as
+part of a whole which is a work based on the Library, the
+distribution of the whole must be on the terms of this License,
+whose permissions for other licensees extend to the entire
+whole, and thus to each and every part regardless of who wrote
+it.</p>
+
+<p>Thus, it is not the intent of this section to claim rights or
+contest your rights to work written entirely by you; rather, the
+intent is to exercise the right to control the distribution of
+derivative or collective works based on the Library.</p>
+
+<p>In addition, mere aggregation of another work not based on
+the Library with the Library (or with a work based on the
+Library) on a volume of a storage or distribution medium does
+not bring the other work under the scope of this License.</p>
+
+<p><strong>3.</strong> You may opt to apply the terms of the
+ordinary GNU General Public License instead of this License to a
+given copy of the Library. To do this, you must alter all the
+notices that refer to this License, so that they refer to the
+ordinary GNU General Public License, version 2, instead of to
+this License. (If a newer version than version 2 of the ordinary
+GNU General Public License has appeared, then you can specify
+that version instead if you wish.) Do not make any other change
+in these notices.</p>
+
+<p>Once this change is made in a given copy, it is irreversible
+for that copy, so the ordinary GNU General Public License
+applies to all subsequent copies and derivative works made from
+that copy.</p>
+
+<p>This option is useful when you wish to copy part of the code
+of the Library into a program that is not a library.</p>
+
+<p><strong>4.</strong> You may copy and distribute the Library
+(or a portion or derivative of it, under Section 2) in object
+code or executable form under the terms of Sections 1 and 2
+above provided that you accompany it with the complete
+corresponding machine-readable source code, which must be
+distributed under the terms of Sections 1 and 2 above on a
+medium customarily used for software interchange.</p>
+
+<p>If distribution of object code is made by offering access to
+copy from a designated place, then offering equivalent access to
+copy the source code from the same place satisfies the
+requirement to distribute the source code, even though third
+parties are not compelled to copy the source along with the
+object code.</p>
+
+<p><strong>5.</strong> A program that contains no derivative of
+any portion of the Library, but is designed to work with the
+Library by being compiled or linked with it, is called a
+&quot;work that uses the Library&quot;. Such a work, in
+isolation, is not a derivative work of the Library, and
+therefore falls outside the scope of this License.</p>
+
+<p>However, linking a &quot;work that uses the Library&quot;
+with the Library creates an executable that is a derivative of
+the Library (because it contains portions of the Library),
+rather than a &quot;work that uses the library&quot;. The
+executable is therefore covered by this License. Section 6
+states terms for distribution of such executables.</p>
+
+<p>When a &quot;work that uses the Library&quot; uses material
+from a header file that is part of the Library, the object code
+for the work may be a derivative work of the Library even though
+the source code is not. Whether this is true is especially
+significant if the work can be linked without the Library, or if
+the work is itself a library. The threshold for this to be true
+is not precisely defined by law.</p>
+
+<p>If such an object file uses only numerical parameters, data
+structure layouts and accessors, and small macros and small
+inline functions (ten lines or less in length), then the use of
+the object file is unrestricted, regardless of whether it is
+legally a derivative work. (Executables containing this object
+code plus portions of the Library will still fall under Section
+6.)</p>
+
+<p>Otherwise, if the work is a derivative of the Library, you
+may distribute the object code for the work under the terms of
+Section 6. Any executables containing that work also fall under
+Section 6, whether or not they are linked directly with the
+Library itself.</p>
+
+<p><strong>6.</strong> As an exception to the Sections above,
+you may also compile or link a &quot;work that uses the
+Library&quot; with the Library to produce a work containing
+portions of the Library, and distribute that work under terms of
+your choice, provided that the terms permit modification of the
+work for the customer's own use and reverse engineering for
+debugging such modifications.</p>
+
+<p>You must give prominent notice with each copy of the work
+that the Library is used in it and that the Library and its use
+are covered by this License. You must supply a copy of this
+License. If the work during execution displays copyright
+notices, you must include the copyright notice for the Library
+among them, as well as a reference directing the user to the
+copy of this License. Also, you must do one of these things:</p>
+
+<ul>
+
+ <strong>a)</strong> Accompany the work with the complete
+ corresponding machine-readable source code for the
+ Library including whatever changes were used in the work
+ (which must be distributed under Sections 1 and 2
+ above); and, if the work is an executable linked with
+ the Library, with the complete machine-readable
+ &quot;work that uses the Library&quot;, as object code
+ and/or source code, so that the user can modify the
+ Library and then relink to produce a modified executable
+ containing the modified Library. (It is understood that
+ the user who changes the contents of definitions files
+ in the Library will not necessarily be able to recompile
+ the application to use the modified definitions.)
+
+ <p><strong>b)</strong> Accompany the work with a written
+ offer, valid for at least three years, to give the same
+ user the materials specified in Subsection 6a, above,
+ for a charge no more than the cost of performing this
+ distribution.</p>
+
+ <p><strong>c)</strong> If distribution of the work is
+ made by offering access to copy from a designated place,
+ offer equivalent access to copy the above specified
+ materials from the same place.</p>
+
+ <p><strong>d)</strong> Verify that the user has already
+ received a copy of these materials or that you have
+ already sent this user a copy.</p>
+
+</ul>
+
+<p>For an executable, the required form of the &quot;work that
+uses the Library&quot; must include any data and utility
+programs needed for reproducing the executable from it. However,
+as a special exception, the source code distributed need not
+include anything that is normally distributed (in either source
+or binary form) with the major components (compiler, kernel, and
+so on) of the operating system on which the executable runs,
+unless that component itself accompanies the executable.</p>
+
+<p>It may happen that this requirement contradicts the license
+restrictions of other proprietary libraries that do not normally
+accompany the operating system. Such a contradiction means you
+cannot use both them and the Library together in an executable
+that you distribute.</p>
+
+<p><strong>7.</strong> You may place library facilities that are
+a work based on the Library side-by-side in a single library
+together with other library facilities not covered by this
+License, and distribute such a combined library, provided that
+the separate distribution of the work based on the Library and
+of the other library facilities is otherwise permitted, and
+provided that you do these two things:</p>
+
+<ul>
+
+ <strong>a)</strong> Accompany the combined library with
+ a copy of the same work based on the Library, uncombined
+ with any other library facilities. This must be
+ distributed under the terms of the Sections above.
+
+ <p><strong>b)</strong> Give prominent notice with the
+ combined library of the fact that part of it is a work
+ based on the Library, and explaining where to find the
+ accompanying uncombined form of the same work.</p>
+
+</ul>
+
+<p><strong>8.</strong> You may not copy, modify, sublicense,
+link with, or distribute the Library except as expressly
+provided under this License. Any attempt otherwise to copy,
+modify, sublicense, link with, or distribute the Library is
+void, and will automatically terminate your rights under this
+License. However, parties who have received copies, or rights,
+from you under this License will not have their licenses
+terminated so long as such parties remain in full
+compliance.</p>
+
+<p><strong>9.</strong> You are not required to accept this
+License, since you have not signed it. However, nothing else
+grants you permission to modify or distribute the Library or its
+derivative works. These actions are prohibited by law if you do
+not accept this License. Therefore, by modifying or distributing
+the Library (or any work based on the Library), you indicate
+your acceptance of this License to do so, and all its terms and
+conditions for copying, distributing or modifying the Library or
+works based on it.</p>
+
+<p><strong>10.</strong> Each time you redistribute the Library
+(or any work based on the Library), the recipient automatically
+receives a license from the original licensor to copy,
+distribute, link with or modify the Library subject to these
+terms and conditions. You may not impose any further
+restrictions on the recipients' exercise of the rights granted
+herein. You are not responsible for enforcing compliance by
+third parties to this License.</p>
+
+<p><strong>11.</strong> If, as a consequence of a court judgment
+or allegation of patent infringement or for any other reason
+(not limited to patent issues), conditions are imposed on you
+(whether by court order, agreement or otherwise) that contradict
+the conditions of this License, they do not excuse you from the
+conditions of this License. If you cannot distribute so as to
+satisfy simultaneously your obligations under this License and
+any other pertinent obligations, then as a consequence you may
+not distribute the Library at all. For example, if a patent
+license would not permit royalty-free redistribution of the
+Library by all those who receive copies directly or indirectly
+through you, then the only way you could satisfy both it and
+this License would be to refrain entirely from distribution of
+the Library.</p>
+
+<p>If any portion of this section is held invalid or
+unenforceable under any particular circumstance, the balance of
+the section is intended to apply, and the section as a whole is
+intended to apply in other circumstances.</p>
+
+<p>It is not the purpose of this section to induce you to
+infringe any patents or other property right claims or to
+contest validity of any such claims; this section has the sole
+purpose of protecting the integrity of the free software
+distribution system which is implemented by public license
+practices. Many people have made generous contributions to the
+wide range of software distributed through that system in
+reliance on consistent application of that system; it is up to
+the author/donor to decide if he or she is willing to distribute
+software through any other system and a licensee cannot impose
+that choice.</p>
+
+<p>This section is intended to make thoroughly clear what is
+believed to be a consequence of the rest of this License.</p>
+
+<p><strong>12.</strong> If the distribution and/or use of the
+Library is restricted in certain countries either by patents or
+by copyrighted interfaces, the original copyright holder who
+places the Library under this License may add an explicit
+geographical distribution limitation excluding those countries,
+so that distribution is permitted only in or among countries not
+thus excluded. In such case, this License incorporates the
+limitation as if written in the body of this License.</p>
+
+<p><strong>13.</strong> The Free Software Foundation may publish
+revised and/or new versions of the Library General Public
+License from time to time. Such new versions will be similar in
+spirit to the present version, but may differ in detail to
+address new problems or concerns.</p>
+
+<p>Each version is given a distinguishing version number. If the
+Library specifies a version number of this License which applies
+to it and &quot;any later version&quot;, you have the option of
+following the terms and conditions either of that version or of
+any later version published by the Free Software Foundation. If
+the Library does not specify a license version number, you may
+choose any version ever published by the Free Software
+Foundation.</p>
+
+<p><strong>14.</strong> If you wish to incorporate parts of the
+Library into other free programs whose distribution conditions
+are incompatible with these, write to the author to ask for
+permission. For software which is copyrighted by the Free
+Software Foundation, write to the Free Software Foundation; we
+sometimes make exceptions for this. Our decision will be guided
+by the two goals of preserving the free status of all
+derivatives of our free software and of promoting the sharing
+and reuse of software generally.</p>
+
+<p align='center'><b>NO WARRANTY</b></p>
+
+<p><strong>15.</strong> BECAUSE THE LIBRARY IS LICENSED FREE OF
+CHARGE, THERE IS NO WARRANTY FOR THE LIBRARY, TO THE EXTENT
+PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN
+WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE
+LIBRARY &quot;AS IS&quot; WITHOUT WARRANTY OF ANY KIND, EITHER
+EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED
+WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR
+PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF
+THE LIBRARY IS WITH YOU. SHOULD THE LIBRARY PROVE DEFECTIVE, YOU
+ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR
+CORRECTION.</p>
+
+<p><strong>16.</strong> IN NO EVENT UNLESS REQUIRED BY
+APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT
+HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR REDISTRIBUTE
+THE LIBRARY AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES,
+INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL
+DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE LIBRARY
+(INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING
+RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES
+OR A FAILURE OF THE LIBRARY TO OPERATE WITH ANY OTHER SOFTWARE),
+EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE
+POSSIBILITY OF SUCH DAMAGES.</p>
+
+<p align='center'><b>END OF TERMS AND CONDITIONS</b></p>
+
+<p><b>How to Apply These Terms to Your New Libraries</b></p>
+
+<p>If you develop a new library, and you want it to be of the
+greatest possible use to the public, we recommend making it free
+software that everyone can redistribute and change. You can do so
+by permitting redistribution under these terms (or, alternatively,
+under the terms of the ordinary General Public License).
+
+<p>To apply these terms, attach the following notices to the
+library. It is safest to attach them to the start of each source
+file to most effectively convey the exclusion of warranty; and each
+file should have at least the "copyright" line and a pointer to
+where the full notice is found.
+
+<ul>
+
+<p><var>one line to give the library's name and an idea of what it
+does.</var><br>
+Copyright (C) <var>year</var> <var>name of author</var>
+
+<p>This library is free software; you can redistribute it and/or
+modify it under the terms of the GNU Lesser General Public License
+as published by the Free Software Foundation; either version 2.1 of
+the License, or (at your option) any later version.
+
+<p>This library is distributed in the hope that it will be useful,
+but WITHOUT ANY WARRANTY; without even the implied warranty of
+MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
+Lesser General Public License for more details.
+
+<p>You should have received a copy of the GNU Lesser General Public
+License along with this library; if not, write to the Free Software
+Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA
+02111-1307 USA
+
+</ul>
+
+<p>Also add information on how to contact you by electronic and paper mail.
+
+<p>You should also get your employer (if you work as a programmer)
+or your school, if any, to sign a "copyright disclaimer" for the
+library, if necessary. Here is a sample; alter the names:
+
+<ul>
+
+<p>Yoyodyne, Inc., hereby disclaims all copyright interest in the
+library `Frob' (a library for tweaking knobs) written by James
+Random Hacker.
+
+<p><var>signature of Ty Coon</var>, 1 April 1990 Ty Coon, President
+of Vice
+
+</ul>
+
+<p>That's all there is to it!
+
+</body>
+</html>
diff -Naur mxml-2.6/doc/logo.gif mxml-2.6-haiku/doc/logo.gif
--- mxml-2.6/doc/logo.gif 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/logo.gif 2007-04-26 22:21:37.000000000 +0000
@@ -0,0 +1,54 @@
+GIF87a,,<01>L
+
+
+  !!!"""###$$$%%%&&&'''((()))***+++,,,---...///000111222333444555666777888999:::;;;<<<===>>>???@@@AAABBBCCCDDDEEEFFFGGGHHHIIIJJJKKKLLLMMMNNNOOOPPPQQQRRRSSSTTTUUUVVVWWWXXXYYYZZZ[[[\\\]]]^^^___```aaabbbcccdddeeefffggghhhiiijjjkkklllmmmnnnooopppqqqrrrssstttuuuvvvwwwxxxyyyzzz{{{|||}}}~~~<7F><7F><80><80><80><81><81><81><82><82><82><83><83><83><84><84><84><85><85><85><86><86><86><87><87><87><88><88><88><89><89><89><8A><8A><8A><8B><8B><8B><8C><8C><8C><8D><8D><8D><8E><8E><8E><8F><8F><8F><90><90><90><91><91><91><92><92><92><93><93><93><94><94><94><95><95><95><96><96><96><97><97><97><98><98><98><99><99><99><9A><9A><9A><9B><9B><9B><9C><9C><9C><9D><9D><9D><9E><9E><9E><9F><9F><9F><A0><A0><A0><A1><A1><A1><A2><A2><A2><A3><A3><A3><A4><A4><A4><A5><A5><A5><A6><A6><A6><A7><A7><A7><A8><A8><A8><A9><A9><A9><AA><AA><AA><AB><AB><AB><AC><AC><AC><AD><AD><AD><AE><AE><AE><AF><AF><AF><B0><B0><B0><B1><B1><B1><B2><B2><B2><B3><B3><B3><B4><B4><B4><B5><B5><B5><B6><B6><B6><B7><B7><B7><B8><B8><B8><B9><B9><B9><BA><BA><BA><BB><BB><BB><BC><BC><BC><BD><BD><BD><BE><BE><BE><BF><BF><BF><C0><C0><C0><C1><C1><C1><C2><C2><C2><C3><C3><C3><C4><C4><C4><C5><C5><C5><C6><C6><C6><C7><C7><C7><C8><C8><C8><C9><C9><C9><CA><CA><CA><CB><CB><CB><CC><CC><CC><CD><CD><CD><CE><CE><CE><CF><CF><CF><D0><D0><D0><D1><D1><D1><D2><D2><D2><D3><D3><D3><D4><D4><D4><D5><D5><D5><D6><D6><D6><D7><D7><D7><D8><D8><D8><D9><D9><D9><DA><DA><DA><DB><DB><DB><DC><DC><DC><DD><DD><DD><DE><DE><DE><DF><DF><DF><E0><E0><E0><E1><E1><E1><E2><E2><E2><E3><E3><E3><E4><E4><E4><E5><E5><E5><E6><E6><E6><E7><E7><E7><E8><E8><E8><E9><E9><E9><EA><EA><EA><EB><EB><EB><EC><EC><EC><ED><ED><ED><EE><EE><EE><EF><EF><EF><F0><F0><F0><F1><F1><F1><F2><F2><F2><F3><F3><F3><F4><F4><F4><F5><F5><F5><F6><F6><F6><F7><F7><F7><F8><F8><F8><F9><F9><F9><FA><FA><FA><FB><FB><FB><FC><FC><FC><FD><FD><FD><FE><FE><FE><FF>,,,@<08><00> H<><48><B0><A0>*D<>N<F8>)Dl<44><6C>p<FC><70>B<81>2j<32>ȱ<DC>Ǐ C<>I<><49>ɓ%4<><34><A0><F0>*l<10>R<9D>n<F6>͛8s<38><73>I<DC><49># (<28>
+J<><4A>ѣH<D1A3><1E><><D0>ϧP<13>â<CE><C3A2>իX<D5AB>j͊e^ԯ{5<>J<D8><4A>ٳh<D9B3>6<D1>6<><36><A1>p<B4>ʝK<17><><A5><98><A8><8E><EA>˷o\G6׍<36>K8+<2B>È'.Lԇ<4C>LJ<E2><C787>m<F0><6D> Ƙ<><C698><AF>4<>MV<4D><56>Tƹ<54><C6B9>Ө5*<2A><><A3><E0><97> l<>
+T<><54><95>l<91><6C>Nn<1E><>f<04>n<A9>3<FF><33><E7>g<A4><67> <0B>n<B3>3<13><>6<90><36>\Vd<>v8 <0A><>-<2D>7<B2>{<7B>E<97>v<FE><76><80><96><F3><C9> <0B><><93><A7>]a<><61><97>‚<>y<FF>M<FB><4D>z?<3F>z<A1><7A>!<21><>zi<7A><69>P<16>!<21>`z<>ل<F6>MvV<76>H4 <20>gxP<78>%UhЅ!yX<10>q<17><>q<><71>B$n$"A-b<><15><05>xބ<1D><18><> <20>H<D1><48>9*H<><48>2<8E><32><9A>@@<40>H<86><48>B<90><42><8A>GG
+<2B><><94>M<02>d<B8>Xf<58><66><A9>\v<><76><E9>`<60>)<29><>d<98>i<96><69>h<99><68><A6><A9>/䣓E<><45>N<><4E>`eT<65><1C><>W1j<14><>k<94>5<EE>?9<>RR"9<><39>B<D3>_<90>1m<><6D>џ<99>L<19>\[<5B>ԎY<>N<><4E><F5>N<>(<28><>'=<3D><>Bx<42><78> <20><><84>fF<66>p<87><70>pԋ0<1E><>t u@<40>1
+Qq<00>Iz<00><><A5><96>W#;<3B><>kU<6B>
+<2B>
+<2B>#
+ <09>Q<A2><51><18><><8B><AC><B2><99>Iq;<3B>
+<2B><>Q<14>qd<64><EEABBE><81>91<39>'9 BԻ<1D><>P#a@(B<>x<DF>ow8%+<2B>Vi<56><69><E4>`<1F><>ON<4F><4E><89>"H<>@<40><0F><06><>[<5B>g<C2><67><B2>:i+<2B>0:A<>d<C2><1E><><B1>J^<5E><11><>!<14>^<5E>Ų<B1><C5B2><<3C> A<05>,4<><34>$dOuC'}<7D><07><><14><>Po)<29>m<DA><6D><10>՜<F5><D59C>U<E0> <0B>2<01>`<60>5<9B><35>\ <08><><84>H<08><>k<C1>p<70>M#A(<28>v<B0>
+<04>H<D1><48>q<D1><71><F7>:<3A><>pw<70>;TR<54>߈/ ҃7<D283><37>?'<27><>*;n<>P <0A>"<22>@T]<5D><>VX<56>vLڟ<4C><DA9F><02><>ĉ<E6><C489><E9><AC>/B<00><><B7>}]Fk<46>Y<EC>ԇ<>A=<3D><><89><A5><ED><85><F5><F1>}<7D>y<FD>F@<40>&N<><11><06><><96>S2C <0C><>̰nt+<13>ԍ<17><>|a<><17>y<BF><79>5<B4><10><>$8<> <0C><>g=<12>dNW<4E>/3G<33>sD<73><44>(<28><>MN<01><><BF>/{<7B>2`<02><>><3E><>/!
+<2B><><FB>b?<3F><>)<29>.<2E>_<DA>X<C7><58><F6>m䂣<6D>`G&x5G<>#DaF<<3C>'ZL@d<><01>uBީ<>;<3B><1D>h(><15><>w<90>@ <0C><10>H<87>"<1A><>HL<48><12><><97>@<40>B'<27><08>tb<74><18>$/D<> <0B><08>&& 9<><39><C1>>"<22><>x<9C><78>m CPN o<><6F><81>y7蔂 <0C>&<26>(ʻ<><CABB><BC><19><>
+<2B><><E9>N<C1>F8z$<03><>
+#<23>¯<08>#!<21>p<F8>H4<48><34>5dd<64>=*<2A>!=<3D>m<><6D>+<2B><>2B<03>H<85>#oPH&2<><32>cir<69><0F>F<D8>ԑ<01>`<60><00>J)6Rʄ #<23><><85><1C><>tdj7i$$3A(<28><0E>J<BB><<3C><><C6>Q҅c<D285>@_ Ѝ<><D08D><9C>$PGN<47><4E>M+<2B>$<24><><C1>
+n<><6E>L<C3><4C>fz<66><7A>;<3B>><3E>D
+G<><47>MN<4D>1 Z<>#<23>y%0m<30><6D>w³.5<F9>G<FA>6<C9><D0>In<A8><A1><10><>M<D6><11><>2QNQ<4E><51> ,Dģo<C4A3><6F>&GæJ<1A> <20><><8C>H<DC><48>l<><6C>j<94>`<60>JO<4A><4F>Fl<46><6C>8%H;T<>̔,*@<40>*<2A><>Ӣ<0E><1E>x<9C>OK<4F>N4ͨe;F<0E>ڥ<1C><0E>9I<39>F<C6>z&<13><11>Y<>2<C6>
+.,#<23><><A7>Y<><59><87>OlNc]+<2B>8 <0E>%C<>r [<03>
+x<>4<C8><34><AF><8D><F3>v
+<2B><>:<3A><>ay<61>;<3B><>b<F8>D<B1>EB޷D<16><><AE>tفA<D981>!R%Z65<36><35><98><02><><88>sl<73><6C><F2> m]<5D>!<21><>BV<42>!<21><>"<22><><BE>0<14><13>P(qt<>$ <20><>,Q<>U<8A>~<7E> <0B><>%`<60><0F>0<96>*F<><46>?<3F>jU"\<5C><1C>/ ҃J2j<32><14><>O1P<>Y6<>`Y<><0E><>N<D8><4E> <20>{<7B><>pα<<3C>P<E1><50>9t<39><74>lB ~<7E><> <'a<><61>ߧ|<7C>r<><72><17>0<E8>DB<44><1D><>C<18><00>N<87>c'7h`B<><42><B8>v<93>"f<><66><18>p
+q<><71>$Q<><51>(<15><><8E><01><><D9>?<3F>@\c<>"F<08>ҹ<><D2B9>'X<><58>Kx<4B><78><93>p!<21>x<DA><78><A1>|<7C>!<17>B<> A%<25>垙0<E59E99>S~<7E><>A<92>^l<><6C>C<F9>D<E6><44> <17>A.<2E>W<D7>2t<32><0E><><AF><10><><BE>]<5D>ٗc<D997>J7<4A><37><8F>svg<76><67>ygVZh{N󈤬f9 x<><78><87><83><A6>:<3A><>%ze<7A><65>g<F6>Pf2zј<7A>3<8E>=<3D><>\<5C>Y<89>d4<><34><94><CC><<3C>Ѭf'<27>C<AA><43><00>o<AF><6F><C0><91><FE><B4>\<5C><>]<5D><>a>3<>}kH+<2B><>x><3E>%<25><><FB>f;<3B><>Ў<D9><D08E><B6>M<A7>j[<5B><><FB>ζ<D8><CEB6><B6><B7>n{<1B>`؉<1A>"<01><><D6> <0A><><9A><86><8A>B<8C><42>=ō<><C58D>]<04><><C0>E <0C>7 l<><k(<08>TT<54>M<E0>"<22>A'<27>8<AB><38>qb<71>VG%<25>DyX<08>k$r<>9Y<06>;_<>`C<><43>Ή<C2><CE89><B5><FE>ĉ[<5B>F<B9><46>DN<44><4E><C8><F1>0<8E><30>8y<38><79><15>S<06>4<><34><FF><E7><AA><E3><15><>&<26><><F4> ~<7E>i,`(<28>
+]B<>e<D4>;(<28><15><><B7>0<1B>_<AA>T<9C><54><C1>Z<AE>Bv<42><76><E9>cX:<3A><>@7<><37>|CE F<><46><BA><C7><FC>$<24><>
+<2B>1؃9v<39>"<22>PA0#G)<29>g<89><67>
+<2B><>Z<87><5A>=<3D>3T<33><54><BF><B6> M<>5zds:?<3F>3<96>MOݢ. <20>N<BA><4E><FA><F1>I<17><>H7<13>C+{Ru<52>#)nc<6E>[<5B><>}<7D><>/<14>c<C2>g<D3><67><FA>Wb<57>pB<70>[<5B><>z {8<14>oQ($<>><3E>+ oD<6F>ߤ̈3q"<22><>w}<7D>
+<2B>$%<25>I<08><>a<B8><61><83>=a<>߅<D0>#<23>q<>NP<4E><50>]sdF:<3A><>B<>[<5B><>^<5E>r<EB><72>[<5B>##<23>T7<54> iw<77>6P<>:8kb7<62><37><80><90><18><>U <0A>y{<03><>Qt s8<05><>~q<<3C>M<F1>ƀ<B2>WT<57>C?@@u<>N81nD<01>7<83> <0C><>g<E5>wJ<><13><>o<D1>Fg9<67><39>s<82>z2<><32>7<81><0F>eu<>V~<7E><>8!X,'w>BM0><3E>m<F5><6D><05><>^<5E>5Apy4<79>`<60>1 <09>Th<54>4/p<13>m<>3pS<70>7Us<55>,9`v:<3A>3y<33>&<26>#<1B><><8B>c<87>Rp<52> <0C>_C<5F>Z2gu><3E>p<9F><70><83>
+<2B>VE%<0E><17>}auVo<><6F>p!ʼn9<C589><0F><>Z<E0><5A>!
+|H<>m<8A> Y<><B0>x <0A><05><><92>Pu<0E><>M<><4D><80>M<><07>`n<>X<B8><03><><A1><8B><BC><E8><06><>H<C2><48>UsS7<53><37>7{<7B><><F3><03><><8B><B2><98>x<B5><78>S5<7F>"QSv؍8a<38><61><08>B<8E><42><B1>H<AD>q6<71><36><FF>D<8E>6<D1>E<83><45><08>e!<21>ݘR<DD98><52><16>ȉ<86><C889><96>s<8F><73>X<89>5<00>c<>V<83>X<90>q1<71>R
+Y%<25>9<B5><39><88><F8><90><99>~S5iZ7<><37><83><98>яm<D18F>Q<1E>%~8<><12>P<88>4(I ȴ<13><><FD><80>-)#{<7B>5<>Y<93>Q8<11>8<87>%uxGӓ[<5B>46<34><36>B<86>%oxlGY; q<><71><86>j<A5><6A>ld<6C><64>4L<34>Z<84><5A>jp<6A>7!<21>H<86><48><84><95><A6>iQ<69><04>PW <09>E"<22>iaR<61>ЅM<04><><96><A5>h<01>q<>o<92><6F>2"<22>h9E<39><45>a<94><61><B2><85><F3>d<97>.(<28>br
+"<22>u<10><>1<88>!<02>0| <09><0E>`<04><> ԰<10><> 8<14><>$<24><><B1><98><1E><02>`O<>y
+QP<51>%<25><18>)<19><><06><>`ޥ=@o<<3C> -<2D>S<>b;<3B><0F>Л<98><D09B>h@<40>E<02><13>`+3<>k|<7C><03><><17>sq<>^O<> <0C><><89><00> <1B><01>Yl<59>y <20><>{m18<>~<7E><><1F><>q<8D>'<27><><8F>O<8E>ZW3<57>R<12><>flW3&x}й<17><><EE><F9>h}ik<0E>k
+<2B><><81><9D> !g<>k6<6B>G7<12>yR<79><52><93><E0>6j9 J<>q <07><><13><>x<>n<>g@eq<>q Qp<51> <1F>ߘ|(8c91
+$!<21>9<85> P<><02> *Z,:<10><><F4>wr<00><>#/<2F><>&<26>X <0B> &<01><>Y"x<>{71'A˙gDk<19>k7<6B> '<27><05>Gy#<23><><A1>V<9B> Q B<>(<28>&<26><><95>'2ؠ<02> <0B><>-CJE<>nA<6E><05>>d<><64><A7>k'X<>d<A6><64><FA>f<A9><66><9C><82><A6><94><84><96>'<27>;<3B><> <0B><>>(<28><><82><80>;Wqz꧋:l
+<2B><><A9><9F><FA>z<93><01><><19><><A9>l<BA><6C>0<B6>
+<2B><>j<AD>Y<A3>?[<5B>B<05><><87>*<2A><>
+k<><6B><B9><9A><A8><BB>Jljl<6A><6C><C8><F9>J<98>Ɋ<AB><C98A>z<BF><7A>
+<2B><>ڨ<A2><DAA8><E2><F9>ڧ<C7><DAA7><92><A2><12><>6<94><36>׫<1A><>Ū<>z<DE><7A>Z<E3><5A>׭<CC>ʫ<CB><CAAB><E9><FA><AD>z<8A>*<2A><><19><><AA>4ڪ<34><DAAA><AC><CF>Ѻ<AC><D1BA>ک<D3>j<A4>N6<><36><F5><8A><AE><F7>ˮ<>ڀ<9C><DA80><9E><AA><AB><F9><BA>
+<2B>犃 <0A><><EB><07>)bg<62><67><92>w<AD><77>K<><10><>+Ԯ˗<D4AE><CB97>*<2A><>:<3A><>:<3A><><B2><A5>Q<><51>&<26><> k<>/ˬ"<22><><8B>
+<2B>5k<35><07><><9B>zj㊱<6A><E38AB1><87><AA><B1><E4>.{<7B><>
+<2B>˰볗r<EBB397>˭[<5B><1F><><05><>6[<5B>4k<34>P<B5>Y<><59>\۵\<5C><>%!^;<3B>[k<>&!<21>d<B6><64>fK!i<><69>$<24><>m<B5><6D>B<B5><42>q<B6>k t<1B>wk<77>|۷~<7E><><FB><1B><>;<3B><>[<5B><>{<7B><><B8><88><9B><B8><8A><BB>۸<8C><DBB8><8E><FB><1B><>;<3B><>[<5B><><B9><96> :Q<0E>VݗU<DD97><55>-<08><>E<98>[<5B><>;+Dt<44><13><><EF>C
+<2B><06>
+<2B> Ga <0B>k<A7>';D<><44><13>B<><42>7<8D>$kWG+`r<><72><A8>CD<02><><13><>N&<26>֠)qU<71>6<B5>q E<> ȋ<><C88B><BB>D P 9<><0F>IPs<50>w<D4>O<99><13>y<12>H<F0>;<3B>ݛDƗG0$<10><>³<<3C><>A<A5><07>R<91><52><A4>D$<24><13><>9<><39><08>գ<><<3C>B<><0E><><FF><9B><BC>D67<7F><37>A9<><0E>է6<D5A7>J(A<>̽<><CCBD>D0<>7<A3>(9<> <16><10><><B6>1y(ш<08><><A1><92>L$@8<>dA<> <0B>j<><19><><91>&
+a<0E>7<84>T{D<><44><13><>l<><10><><03>B*<2A><><10>g<12><>u<><75>\<5C><>G<C4>9<>
+ƀ<13><><E4><C0>
+C7<>%<25><> q<0F>v:<3A><>p<02>'v9<76>
+"<03>[<12><><FE><10>Ƹ*<2A>H<C6><00>pq<><14><>
+Q<>!<21><00>W<10>D<CB><44>j<EE>I<C8> `<60>5 Jb
+a #qd<71>Դܪ<D4B4> %.P<> <0A><><E0>M<C9>
+<2B><>!<21><08>GA+<2B><><B4>PG<50><13>`<07>"<22><>U<>.<2E><1B>a<<3C> %<01><><13><><8B><EC>ĕ<07><><1F>2 <09>~<7E> <0C>!<21>̛dl<><6C><C7>#m<>J<1F>6W<36>D[<5B><> G<><47> <20><>8<CA><00>(yj<79>·<10>g<8E><67><CA>ˆ<9A>e<15><><1C><>O<FC>`<60><1B>4<07>ƌ<B3><C68C> G@ZQa<0F><>zDҾZ<D2BE>`<60><>*}Η<><CE97>I<CE>.<2E><12>A8<41><10>{
+<10><01>qC<71><43>ټ<D1>KT81<38>
+QX<51><58>A"<22><>Q<><08>H<><48><8B>wD@<40>6! <16><10>r/̀<><CC80><10><>c 1<>挵<08><>D<D1><0E><10>wм7<D0BC>(|<7C>f5<10><19>~ QE=<3D><><8D>|DI<44>\<5C><12><>6<C2>pk<70><6B><<3C><10>w<9D><07><>i<C9><69><1B><>Et9ё<1B><00><>h<><68>$<24><> <09>
+0<>|J<>j<B0><6A>A<D3>Ősdc<13>й<DD>
+<2B>!q 1{ q<>}<7D><>k<D2>%<25>9<1D><>7<A4>#1
+9<>2<><32><C0><C0>PA <0A><1B>$\<5C>e<B1><00>LK<> <<12>{m<><6D>1<D9><31>;1<06> <0A><>kPH<50><48><14><>zq<7A> <0B>FI<12><><13>Ʃ<><13><><EB><F0><8E><96>/5<>g<DD><02>C p<>8tA<74><41>9Qc<51><63><C3><1E>};'<27>Mq8<71><38>fA><<1E>P7q6;<3B>͒b<>-O<۞-<2D>~m<>'<27><>e<DF>=8d<><13>0<D7>C1t:<3A><>WK<57>AG<><10>P<91><50>M<D0><4D><AD><17>r<A6>g<8E>:! H<><01>}<13><><FD>$<24><11><>0<><30>;~<7E><>]<17><><0F>s<BB>{!<<3C><><A5>{A<>,<2C><>p<E4><70><F1><05> <0B>ՊE<D58A><45>sK<><4B>[<5B>Y!\N<16><><10><15>Z<01><07><>fn<15><>W<><57>G<01>m<07>H:A<>t><14><><13><><9C><A3>(<28>:Q<>W~^<12><><16>8<9F> <20>E<A1>qW<71><57>{U6E<36><45>J7p<37><70>t<E8>8bA<62>k<E7>>i<15>m<E6>R<F5><03><>cTbe<62>fʼnS!<21>]a<>ZŸ^5<><35>c<8B><63><03>!U<>kU<6B><55>>!<21>B<87><14><><91>@<40>T#<23>T<D9> <0B><8[<0E><>ca<63>^6;<3B>ShTC<54><43>F<EC>Q<17>S*<2A>.2A;
\ No newline at end of file
diff -Naur mxml-2.6/doc/logo.xcf.gz mxml-2.6-haiku/doc/logo.xcf.gz
--- mxml-2.6/doc/logo.xcf.gz 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/logo.xcf.gz 2007-05-23 21:38:42.000000000 +0000
@@ -0,0 +1,50 @@
+<1F><03><> xTE<54><45><B6><C7>N<ED> IY <09><><84>@<40>B<C8><42>}<7D> EAGB<>#<23><01><><E3>uԧ8"<22>>Q<>#<23><><8C><A8><A3>".#<23>s@Q<>ٕ}<7D><><89>Ug<55><67><FE>3<AA>D?}<7D><>A<9F><41><CD><F7>Nս<4E><D5BD><B7>ԩS<D4A9>vՔ<76>3<>s'N<>O.<2E>^JD<4A><1B><><AC>x<BF><78><88>_"$<24><>;<3B>D<88><44> Ir<49>r_K<5F>?;<1B>X1cFiy<15>.<2E>P s<>lFɔ<46><C994><D2>Ye<59>B<17><><9D>ʪy<CAAA>K<D3>e<FD>U<E5><55>*K'V<>U<95>W<94>5˝<eb<65><62><C5>Y<8A>\<5C><><83>)J<>E<FC>E<85><45>[<5B>␒<94>G'|ˣōo<C58D><6F>"<22>έ<8F>Y2<59><32>|<7C><><8A><BF><B8>Q9<51><39>*Cu<43><75><81>eUh<55>ĩ<FC><C4A9><A5><D2><15>'W<>V<96><56>?<3F><>*[<5B><>Q<F0>ן<FA><D79F>h<82><68><FE>=<3D>049!CF<43>(+/<2F>ʕ<><CA95><10> S<><53><BD>
+<2B><>׬<F2>]O<><4F><8F><A9><A7><C7><D6>B<E3>u]<5D><>W<CE>Z<EF><5A>{CC~<7E>?<07><>tnU`zɼ<7A>Yu<03>?W<><57>Y<FC><59>1<DE><31><1B>%<25>ZQ<5A><51><8E><AA>fL<66>]<5D>YR^<5E><1F>?<3F>b<A7><62><FA>k<BA>ʲߔ<CAB2><DF94><14>3<D5>?<3F><><AB>f<BD><66>-<2D>.<2E><>
+<2B><>A<91>g _2<5F><32>BjꊸV2<56><32><BD>2T<32>^R>e6\ϟUZ>n<>H<D4><48> %<25><><95>Ie<49><65><B3><AC><CB>W<A7>B<CD><42><E5>q<D9>ͮ<A6>*<2A><<3C>?<3F>T<B1>X<FC><58><BE><B1>4P<34>8<E7><38><81>=<3D>P170<37>bR<62>Ҽ<7F><D2BC>eCU <0A>W<BA><1D>n<7F><01><16><><1A>z<C8>&ȧ <0A> <09>9<07>HF<48>@r!=!<21> <20>C<97>B<A6>Bn<42>,<2C>,<2C><>y <0B> <0A><>#<23><><0F><><CF><FB><0F><><CF><FB><0F><><CF><FB><0F>G&@<40>Bޅl<DE85><6C><87>g+<2B><><82><93>cG<63><47><C1>F G<>=q8<71><38>sČk<C48C>Z%J<>{<7B><>$j<><6A>N<CF>E<EB>v Q<><51>D<19><>?<3F>(<28>><3E>,L<><4C><83>D<D5><10>ڷ<9E><DAB7><82>9<AF><39>:<3A><>|H<>{#Q^7<>^<5E><><A2>!<21>Bp><3E><><EE>
+<2B> <0A>w<14>C<84><43>x<><00>|@<40>q(Q r5Q!<21><><BC><08><>4<04><08>Y<E4><59>eD]`<60>nhw<68>D<>#<23><>4Q??Q<><51>D`<60><01><>Y<08>gO#:7<><37><9D>|<7C> <0B>#<1A><>6Sa<53>5D<35>@<40> _Ht <09><><BE><EB>D<EE><44>!<21>U<1B><>Lj~<7E>q<1B><>8c0<63>zH ѕ<><D195>WN<57><E4<45>At<1E>1{<7B>O<8F><4F>A`<60><>BFC<46> <18><><FF>@<10><>nA\O<><4F><9A><BE>,<2C>'Mߞ<1F>}ީԊ;<3B><>R<81>m<ED>S<D4><53>9pJ<><4A><B5>i<7F>Y<14><>g<C5><18><><9B>6<F7>nj<6E>ig<69>T{= m<><6D>G<DC><47><ED>/@<1A><><F4>о<F6> <0B>nY<6E>nӮC'N믏<4E>߾<EC><DFBE>{<7B>\<12><>,:<1D>s<DE> <0B>9<FB><39><89><83><C1>L<97>4
+F<>x<8D>(<28>Y<FB>B<AF><42>v\t<><74>EO <20>9{-<2D><>O<>+j<1C><>?q<><71><BE><A8>zg<7A>p<D6><70>1<E8><31>o<DA><6F><E0>Ѥ<A8>8΅<38>F<A2><46>-<2D>"Q#I%<25><><FF>E<8B><45>*<2A><>;<3B>A<><41>!<21>"j8<6A><38>5<C1>U<DC>0R<30>Os7Q<37><51>F<04><><B9>RÂ<52>CT<43>ԀSܓO<DC93><4F><AF>w<D2>{qpe}ɽ<>]<5D><><95><B0><8D>z<B0>u8<75>"><3E>޿<A4>bX -<2D>׺ˈ<D7BA><CB88>?C˃G<1C><><07><>Y<9C><59>=<3D><1D><> <0B><><84>~<7E>3<9E><33>:ȡR<><52>q[vkf<6B>SRQwqVw<> R\Na<4E>:<3A>2<8E>O<D1>ɬ<CD><C9AC><9E>lҕܒ<D295>3<D5>Ԏ<E1><D48E>$'<27><>K9<4B>R<A4>r<<3C>#ٔKzT=<3D><>HE<1F>8V<38><1C>'}#7g<37>;R<01><>P<8E>r
+<2B><>α<DE><CEB1>E{<7B>cX<63>B<BF><42><85><A4>6F<36>s9<73>Չf<D589>fA<66>OS'<27> <09>M-B<>,*"<22>u<DC>1<C8>/S<><53>6 <20><><A2> <09>ԋj<D48B><6A>޺<86><DEBA><8E>y<DD><79>:S0<53><30><EF><15><><87><B3><BB><E7>h<CE><68>2w<1B><>]?:q{?<11><16><><EC>,=w<><77>_E<5F><45><DF>퐟T<ED909F>˜<D1><CB9C><CA><00>%7<>~ ùnu<18>&5rg<>z<B0><1D>"<22><>1<FC>but0\Nu<4E><75><D9><CE><ED>s<1C><>*<2A><><0E><><AC><EE><F2>yn<79>p<C6><70><A9>0Xʷ<58>;B<><42>{E<>(<28><><00> *<2A> q<><19>^<5E><>^*<2A>W<D8>ʷN<><4E><A5><F6>+y<1E>+<2B>g<1D><>^ <20>3<06><>K<A4>><3E><><B5>n<90><6E><9D><E5><8A>Mm<4D><6D><F6><8B><FF><B8>s_<73>G<D6>>)\sd<73><64><F5><F5>e<FB><65><B5><8A>[<5B><1F><><CD><EF>gqP<71><50><AF><EC><EE>;<3B>z:<0F>`<60>k5'<27><><B4>$<24><><B4>բ0jAh<41>Bs'e<>[.<2E><>a<B5>4<F0>og<12>Q:<3A><1E><><82>Ȑ'S{V<><56> <0A>X<>+7<>P? .<06>1<B2><11>z<05>
+J,<2C>0藎<30>^{g<><67>Z7 <0C><>*<2A>q2Οr<CE9F>c/<2F><><BE><F7>c<81><63><A7>û<A9>oް<6F><DEB0><1B>-<2D>ړ> <0C>><3E><>c<C9>b1<62>i<<3C>RyF<><46><D2><CF>kۚ <0A><>z<>0L<30>O<9C>z<C6><7A><0E>nœI<C29C>~<7E><><11><>g<CC><67><B7><03> <20><>a<18><>P<18><><A8>*<2A>`<16>Z <03><>Z<E1><5A>("<14>
+ ̆Y<02>b<<3C><><BB><B2>G<C9><47><AC>m<D8><6D><8A><03>0~+z<><7A><1A><><86>ɺ<ED>@}<15><01><><EE>fu$<06>ܛ<A3>4<03>̓<B5>ч<A0><16> <0A><><82>҈p<D288><0E>Xb<58><62>C<D7><01>+<2B>O<FF><4F>薹'/yWKlZ<6C><16>Ic_<63><5F><94>.<2E>궻<DA>e<DF>A0J<30>1<9C>/<2F>u=s=s<>Dá<44><C3A1>Cj<43><6A><E0>*@<40>_+<2B>rl<>NJ<A2>V<><56>K8]M<><C5>y<C9>7<AC>g<C2>d<F4>><3E><><96><C8>#<23>w <0C><>E;,Z<07>jat<61> Z<>|<7C>A<88><41><A9><16> @K<>R}i <09><>)ޏ<>F6<46><36>|<7C>kMݢG¿<47><C2BF>lN<6C><4E>|<08>8<D1><38>!'A<><41>(V~<7E><00><>9<02><><0E>/ELNz<1C> O<>p/<2F><1B>~ح<>y<F0><79>ĵĘ9<>!
+c<><63><DD><15><08><>9<F2><11><><89><B1><E2><F7>]<5D><><96><FB><E3>X<C6>G<><47>#:<3A>~<7E><><81>U><3E>=d,<2C><><F1><08>Y+{3<><33>~<7E>DeJ<65>#<23><><AB>Rb<52>8<F3><38><EE><18><>ňE<C588><45><9B>j<<1F><><FC><E0>ј<FE><D198><D2><DD>uM&<26>Cv߹8 ѣ<>ݏ.<2E><><B5> V<>cj"mAZ+A<><41>X<1B>o<B5>ڨ}<7D>c<9B><63>=<3D><><A1><A8>k<D6><6B><A3>dL4̷6h?h<><68>:<3A>l<9C><6C>om<6F>>o<><6F>Bu<><75><9E>m<><6D>k<9E>ن<D1>c^<1B>_@<40>n<18>ߢ<9E><11>C+<2B>\<5C>v<BE>ί<10><>><3E><><B8><F3><1B>^T5<54>G<AA><47><AA><83><EC>i7y<37>{<7B>%Hxn<78><6E><FE><E0><96>`<60>E<0F>@<40><16>~{<7B>04P<34><50><xQ8:Q<00><>K2!<21>=<3D>@<40><><A1><8D>ژ<CB>랬<D8><EB9EAC>a<86>N<B0><1E>x<82>8{<7B><><87>jc<6A><63><AE>'G<>ЪJSD<>96l<36><6C><DE>@9<>L<87>e<><FE>S<DD><53>K<E5><1B>G<C0><47>k<F4><11><><97><D2> 7<>p."<22>Vޜ7<DE9C><<3C><><F1>/><3E><><89><F0><86><9C>2<F5><32>9@<40>hu2<75><32><A9><84>Ȑ<1F>?
+GD<1A><>#<23><>Td`<60><>C<C2>C<91>C<>ֆ<8E>U<06><>z<>F<9E>"<03>ل <0C>-<2D>i*<2A>4<F1>s:<3A>g-fX(<28> <12> үZ<D2AF><5A>b<C1><62>%<16><><BD>3<86><33><E6>Nj<FF>NCr<16>j<CB><6A><8D> <0A><>u" <16><><B2><1C>H-X<>4P<1F>!#D<>8<BE>@}<11>\1A<31>3<D6><33><81> <20>Ld<4C><64>b<CB><62><99>:<1E>Y<D9>d<92><06> TMu<><75><A0>/<2F><><B4><F8>g@2<>VHR<48><52><93><E5><9A>OZ|<0E>b-<2D>Pd1Ԣ<31><D4A2>F<E2><46>-<2D>Y<D6>c<BC><63><B1>3<E2><33>G,j<><14><><CE><F9>r<C4>WM<57><4D>3<B2><33><E0>Ǒ<F2>~<7E>ԯ<D6>M-<2D>m&<26><>ywn<><6E>"<22>"<22>"<22><>k<C2><6B>g/ _<><5F>dƛ<64><84>E<98><45>M<85>u<D8>E<A2><45><B4> <20>g/<2F> <0A>8<D4><38><EB>I}[4}z<><7A><E6><E4><FE><BF><94><FF>><3E>-o<><6F>ׄ<E6><16>Z<E7>X<E4><58><B4><B6>3h<33><68><F3><B3>ʐ7j<37><18><><B6><B4><08>p?<3F><>b<FF><62>i<BE>}K.<2E>K<F7><4B>ykS<6B><53>M-?<3F>\<5C>:<3A><>F\<5C><19><>}O<>ר<EA>M<C5>i}<7D>TG<54><47>I<FD>b<E5><62><8D><AD><DB><F4><AB><F4>3<E4><33>{<7B><>4<E7><34>hqS/<2F><>-<2D> <0A>YS<59><53>߻*7<>2<EE99BE><32><16>dV<64><56><CF><EA>M<4D><7F>q<A7><71>E<>B<DF>ٰZ)<29><><BB>5<99>v<A2><76>牶V*#<23><06>鳀hҏp<D28F><70><B1><FC><A4>q <0C>2<03>}<7D><><DB><FC><8C>(.<2E><><E4><E6>2Pq<50>Gz<47><7A>r^<5E><>܂T<DC82><54>\<5C><><C0><F1>7PQ<50><51><B2>@z0Рu1g<31>H<>H<FD>롾<BD>x<14><><FE>q8<71>!G^Djw3<77>M<1E>s <0C><>x<E1>E^ֿ7P5<50><35>'<27>ɶ<85>@<40><><B9><07><>^D<><44>E<CF>k<><6B>f<86><66><B9> t<><19><>-<2D>z<86><7A>OxH <12>}V<07><>L<C4>K<D7>8<ED>M<A9><4D><AB>u<DA><75>>$<24><><1C><><A9>e<0F><><FA>:<3A><>zk<7A><6B>1L<31><4C>#<23><><B5><E1><DB>%%<25>[<5B><><E3>R<1B><><F7>^&<26>7K<37>j<ED>\<5C>qJ<71>O<><4F><FA><A5>rC<72>h<A5><68><DD><E5><86><F7>W<CC>.7<A8>.<2E>kԟ<6B><D49F>><3E><> <0B><> /g<>?>]<5D><><F6> -<2D><1B>Z<1F><> <0C>-ڠ<><DAA0>I<03>ϡ4<CFA1><34>q<04>1<16>-6(ݜ<>P<DA>l<A6>T[<5B>1PG<50>V<><56><BA>^v<>Jc?<3F><>y-<2D>\a<><61><B1> <1F>4<>}9APe<50><12><><07>6<EC>m9Qp<51><70><99><1B>\R<>ZC݃<43>3-<2D><03>-T<> <09>CH<43><48>]J<>9<ED><07>ƭ<90><C6AD><8D>?<3F>|W<>I$<24><><FD><84>QmO<6D>]<5D>J<15><><FE><81><D9>}<7D>d<80><0F>ퟤ<D8>f<83>GO<47><4F>@<40>7<9E>.P<>kv<6B><76>mv3(v<><76> җ<>=!<21>y<E7><19>}<7D>n<06><>nE~l7<6C><02><><1F><>><3E>G<A9><47><ED> <15>><3E>a<A7>T<D9><54><DD>J&<26>{ d#<23>5g<35><67><91>@9<>r*g<><67>r
+<2B>#<23>{<15><>[q{<7B>}j<><6A>L?<3F>ɀʨ<C980><CAA8><E1>s<C8>\<03><><89>_y7ĵT<C4B5><54><AB> <0A>(<28><1B>U<97><15><>#<23>; $<24><>q<C6><71><80><06>y<CA><79>s!<21><>Z<9C><5A>N<E5><4E>3PQ<50>r I4<49><34>bҏs4<73>Ҏc<D28E><63>,<1B><15><><B6><89><A3><F0>{]<5D><>@$<24><0F><><B0><8F><BB>`<60><opw'p9<70>{<7B><><90>@<40><><C5>[QO<51>(g5{<7B><17><><A9><AC><AF><D9><D3>|<7C>ϡn<CFA1>c<E4><63>C])<29><>%<06><>Յ<97>XO4P;<3B><08><>FK,<2C><> <09>:'G<>z<97>ѥ<08>t6<74>!<21><>)r<06>Wr<1A>n<EA>E|<><7F><87><AA>rZ<72>
+Vя̗t<04><>E<D2>g<94><67>~<7E>0ms<6D><73><82><B0>O<18><><8A><֛<>p<><70>Q<8F><51>唖<C3>9<><39><B1>+<2B><><87>`<04>x<F5>PG}U툤LY SYϔCM<43><4D><C9>P<E4>W<D3>)ú<><C3BA><16>O<A1><4F>r,<2C>D2"<22>^ҋ<10><><CF>p4u:SN<y7<79><37><C2><F7>P<C3>x<F5>@<17><>eѻ<65><D1BB><E1>T<E6><54>F~t<>K<EB><4B><F0>P<>aN<61><07><>C <09>$<24><><A0><A0>^9<><39>3E<33><45><8F><1F>0<83><30><85>}rb<72><62><C4><FB><13>!<21>HJ<48><4A>ԗ<B0><D497>-<2D>W<01>k<EB>b<A0><62><F5><EA>XK9<4B><39><A0>+<2B><>?<3F><>eX<65>Um<55>Z)<29>rh<72>A9<41>gW/U`W/$<><7F>z<B3><1F><01>^!<21><>]Y<><59>ȩ*<2A>^<5E>d<DD>0LV/<2F>3<D9><33>=<3D>^=X<><58>V<><56><8F><CA>O<BC><4F>u<DA><75><1C>FX<46>z<B7><7A>/<2F>b<FA>,<2C><> W{<7B>m<EE><<3C><>W<F8><57>-<2D><>D<16>/bd<62><64><ED><AB>aRP<7F><50><12>F$<24><><C0><F5>E=-<2D><>(Z<><5A>7ȱ"9<>@/Q}<13>ʆ<C5><CA86>(C,0<> &x<><78>d<E2><64>`KC]<02><15>z%<25><>_ہ<5F>A<E2>;<3B>:<3A><><8F>|<7C><><86>=<03>ԜP<><50><FB>Y<ED><59><80>Y<ED><59>e<E7>0R5<52><35>@<40>=<3D><><C1>0Ê|ˬ<>w<CB>SZ;c<>)<29><>p<E1>LY)<29><>*x<><78><AC><8D>
+N$<24><><E7> <<3C>-<2D>{<7B>˹<A5>tj<74><6A><CB>f<B3><66><02>b<B8><62><9A>9<>:<3A>l<94>'<27>m[<5B>!<21>$8lm.\:UV<55>l<D4><6C>j<DA><6A>s<>^<5E><><C5><F4><0F>p<C9>C}<05>&<26> <0E>d<98><64>A6<41><36>s <09>gS8<53><38><98><80><AE>,ü<> <0B>.<2E>ծ<9E><D5AE>H
+d<><64>)<29><>8V<38><56> <0C><><01><>~<7E> bںE<DABA>ر<98>+s'<27><>c<>,M<><4D><FD><AA><D7><D4>{z[l<07>e<B2><65><BF><DE>~<7E><>B<C5><42><06><><92>c&<26>,*-<2D>4<9E>D<90>Lɲc<><63>b<D8><62>R<81><52><CD>92O <0C>-<2D>H"&<26><><10> <0C>Z<l<>ȕ<>% FX,<2C>Xo <20>K<AD>5<94>$<24>#<23>h<9A>u<F4>WZ<57>zџ<7A><D19F> <20><><89><A1><FB>$V<>Z<>d<AE>m<>˜P<C298>),<15>Hac<61><63>)<29><><9F>ģ䒳G<E492B3> 4%G<><47>t<C8>]<5D>4SJk<4A>J<EA><4A>A<E4><41><F4>)<29><><1A>0ED<45>W<B5>4<A4><34>t<AE><74><1E>+](<28><>u<ED><12>[!<21>D<C2><44><B2><16>6<B9><36>t<AE><74>ԕ<>d<AE>K<93>J<87>lS<6C>榨<EA>}<7D>\R <0C>d<93>,T<>eM*<2A><>'<27>:uRT_[<5B>I1<49><31>k<F4>n<D6><6E>M<D2>p<D6><70>k<>P)!d<><11><><F4><B7><CA><C5>JK<4A><4B>B<E9>q<A5>t1 <0A>1<A6><31>Hv<48><B0><EEB6B6>% ,^r<>a<8C><61><85>ɚ<8B>t<F4><74><8B><FF><14>b<C0>l<9D><6C>a7Y<37><03>|<7C><>0ԝlJ6<4A>b<D5><62>6 [z"i<06><>:<3A>,<2C><><F4><9E><A3><86>fz-<2D><><EE> <0A>ӆH!Mrx<72><78>sr琡<>`2H<32><48>`<60><>F<00>e<E9>2<8C><32>`<60>Z<EF><5A>*<2A><><F3>MHn<1E>B<02> <09>^I.<2E>Q<><51>PA<><41>C<A2>*EEGD(<28><><8A>2t<32>< 2q<32>Q<>qx:<3A><03><>*FEtŔeDAA<41>`r<><72><CF><F9><E7>><3E><01>N<C7>k<97>]<5D><><B4><B0><D6><CE><DE><FB>O<0E>s<FF><73><BF>a<9D>tޭh#3<>>,=4Q<34>
+Eoe'<27>Y<AE>[<5B><><A2>l<EC><6C><B6><F7>2<D4>%<25><14><>ulO<07>fs<66><73>%u<1D><>4<F0><34><93>*<2A><>A<DE><41>I<D7><49>20i<30><69>bt`<60>S6<53>(@<40><>k<1F><><F0><C1>%<25>1<F5>y<>=<3D><>'<27>7|<7C><>~<7E>弽<92><0F>$5<><35><D7> <17><1E><><FA><AE><E0>)h@Bl<42>?<3F>##D<>>(<28>&B=|<7C><>|<7C><><96>T<AA>=<3D><>P<8B>L<9B><4C><84>,uy<75>j<84><6A>(<28> <0A><07>%ݥ<11><><08>)D<><44><10>7/<2F><>x1ùmq<6D><71>ۋ<15><>Q>ȸ<><C8B8>t<1B>u`<60><><9F><F5><D9>Y|v<> ?i<>l°<6C><C2B0><91><E9><8B><FB> <0C>eJ<65><4A>ߔ<06>a<E7><61><15>N<FF><4E>"<22>Ž%<25> <20>:<02><>[<5B><> Ƃ<><C682><ED>سv<><76>v<>@<40>c<9E><63>U<A2>~\0 <0C>h؜<68><D89C>[<5B><04>k <0C>"<22>j<>f<AF>><3E>} k<1F>"<22><><83><DF><C8>a]<5D><><97>+<2B><>I>B<><02><>n<>/<2F><><D9><C1><DC><C2>`y<><79>9D<39> <0A><>hGa<>\;<05>e<BB>W<F6>\<5C><><B0>)ȉ<>-<2D><>4<17><>n+}<7D>{<7B>'K<><4B>q<CA><71>a<18>Sa"9u<01>H<DA><48>i9<69><39>h<8B>9<>M<0E><>6<D0><36>O<C3><4F>j<F1><6A>g<1D><>?Ѷ<>N<DA>nM<6E><1D>{<19> <20>vx?&I<><13><><EC>o<C6>f<8F> <0C>'<06>c!H͠{<7B>fL<66>_ь<5F>4cH<><48>t0Z<30>l<><6C>0oz![<5B>ɖFA<46><41><99>Zg<5A><67>Ѧ<E1>.<2E>s<A6>=?1&*<2A><><1B>7<18>q<E8><71>"M0<4D><30>-<2D>W<F8><57>P<C0><50><B3>a<F2><61><D1><1C>K<EE>_<7F>`w<><77>G<E9>룦<9F><EBA3A6><BF><89><86>"؝h<06>?<3F><>8`<60><>Nf <20><>sL1<4C><31><9D>Ec<><63><B5>3<AE><33><88>9<><39><AE>V@<40><1D><11><><B7><C1>X8K}ۍ<>㨜D<E3A89C><44><C7>6<D1>8~ ?}t}<7D>Ǹ><3E><1E><><E3>1nꮮ<6E><EAAEAE>~uOUW<55><17><>*~J]<5D>#<23>UL<55><4C>N (h<><68><17>cW@<40><18><><03>Z<E6>-<2D>,<2C><><D0>D<E4>v<9A><76>m`<60>9N?M<><4D>!()<29><>4<B3><34><E5>M<><4D><F9><DD><E2>^<5E>)<29><><BF>4<93><34><E5>@0<>i<><69>oZh<5A><68>=^<5E>o<8E>f<9E><66><F5><BE>}v<>z<C9>v<FA>I<EB><49><O<><4F>]<5D><><95>,=<3D>˩<><CBA9>j<AC>7K5y<35><1B><><A8>rN<72>3d<33>0<D3>c-f﫪<66>{<7B>"U<>=n4<6E><34>.<2E>p&<06>?<3F><06><><8D>j<BE><1E>/<2F><>{<7B>d<DC><64>=<3D><><AE><8B><A7>
+KEws<77><73><85><8D>%<25><><9A><BC>VM<56><4D><06>&<26><>s&U<><18><><F0><F1>6<<3C>-&7/QU<51><55><DE>xm<78>l<02>ii:<3A>{D<><44><9B><CE>'<27>X<F7><58><84>M<AA><4D><A7>;<3B>M 6<><36><91>4<AF><34>ݥM<DDA5>qC<71><43><B4>sb<73>旣<BF><E697A3><ED>C]<5D>wm;<3B>+׶<><D7B6><F3><B8>v<1E><>k<D6><00>V<D8><56>P<FD><50><9B><CE><E3><FE><95>w<>6<A3><36><9D>k<E5>)<29><><E7>yM<79><07><>g<08>t7G<37><47><9B>J<E3>=<3D>qN<71><4E><B0>h;<3B>#`<60>i<AF>y\<5C><><85><B6>]<5D>m<AD>qi<71><69><E4>km<6B>zp<7A>4C<34>jk<6A><6B><FA><8D><C1>pSɕE8<45>h<08><>8<F4><38>O<><4F><AE><A2><E9>w <0B>c<DB><63><A0>Cf<43><66>\Nf<4E>2442<34>n<D9><6E>w<><77><97><B4>K<D2>͔<A4><CD94><A6>><3E>t<A8><74><17>T<E8>k<DA><6B>u<D6>^m<>O k1E<31><45>b<10>:<3A>@<40><>1ܷh<<3C>!<21><00><>$5<>w<81>hod<6F><64><93>"<22>|$<24><><EF>><3E><><B8><1D>e<B4>ġ0<C4A1><30> eµ 9<>_<><5F>l9w) cx7<78>/O%%<25>+<2B><>U<87>^$5<><35>|I<>'<1F>)3B<33><42>)<29><><19>L<DE>Gj<47><6A><AF>4<><34>|<06>CR<<3C><><B9>Q/<2F>W:{;HG<48><47>ăݼA<DDBC><41><DB>J<EC><4A>y f<>ڣ<91>2<><0E><><BB>>y<><79> p<70><7F><AE>\<5C>7L<37><16><>3<F0><33>|<7C> <0B><><A1><BB><9F>E<C5>8<F2>IM#<23><16><02>ć<8A><C487><F9><01>\ƫ/<2F><>L<BE><4C><D3>~I<><49><EA><87>O<F2><4F>ۊO<DB8A><4F>껼<F0>cRդ<52><D5A4><96>{R2<52><32>(+<2B><>S<E2>O<F9>2<CA><32><B5>eὓ<65>8e<38><65>:<3A><07><>|0<>_<><5F>kH-!UI<55>R<><52><B5><A4><DA>-<2D>ҹ <0A>؟א<>N<9A>V<1E>lIe<49> <20><><B7>p<EC> <0A>-<2D><><A7><A2>;Z<17>*<2A><><BB><98>Eyɢ<79><C9A2>eH<02>A<AB><1B><>q<B6>B<8C><42><8E><B4>KJ<4B>`<60> &E<>q
+<2B><><C2><C0><BD><B1>n<13><>[lK6۟<10>%<25><15><>WJP<4A><50>U <09><>k<1C>0 <0C>/y(<12><><B2>F<89>;|<7C><><A9>u<F9>r<1C><>ń<DE>ջX)<29>D<8E>dm<64>4 ԩ<>p<D3><70>#?<3F><><E1>
+<1C>^<5E>ă<BF><C483><EA>R?_8<1B>o<B2>/o<>z<86>2O<32><4F>n<F7>:<3A><>bGɐ<47>41<16>(<28>N_<07><><B8><BD>s<19><><B1>v<C3>~<7E>u
+8<1D><>F<E8><03><>8<EE><38>pw<70>C<CB><43><82><DD>3<B6><33><83>]<5D>T<08>c<BF>pc<70>e<9D>2rK<>+wl<77>&ۍ<><DB8D>56<35><36>~<7E><> vW<76><57>L<EE><19>C<1B><>c{PG<50>m{R<><52>9<C9><39>w}[l/jK<6A>mo<6D>[I<>È.<2E><>V<DA><56><EC><EA><A1>wa<77><61>s (<28><><B4><E6><1D><>s<CB>>~<7E>@<40>BmY<6D><59><91> <09><><C6><FE><E6><B2>]<5D><1E>g<8A><67><F5>G<E0>^<0F><0E>O_<4F>yV<><56><FA>E+z$<24><>a<E8><61><B4>IN<49>&f̄h-w<> <0A>> ܭ<>Pe<0E>><3E><>b<00><>$2<><32><C6>:<3A>'<27>x}<7D><><19><><EC>u<C9>z<FD>@bX;B<03>x<>~åo<C3A5>9}<7D>1<81>a<06>W<AD>ƕ<C0>'P
+<2B>$ꉦ<>hd@<40>a<F6>F<93>~Gj<><6A>Xŧ<58><C5A7>.0<ED><A8>V<E4>X<E7><08>w<E3><77><CC><EA><16>Augg<67><67>
+<2B>%<25>I7<><37>N<AA>u^<5E><>,f<>t<F2><74>@<40><0F><><C9>A<9A><41> /<2F><><97>Hs <0B>$czC<>3XR<58>D*H<><48>~<06><>0l=<1E><><A3>]$<03>) Vwe<77><04><>=#<23>?<3F>AA<41><18><><F3><AD><AC><FB>D<18>)<04><>I<DE><49>ً<AA><03><>LH<>N<<3C><><02><0E><>cI <20>;A<>8<FA><38>;<3B>|<7C><><F7><C7>E<C6><45><EF>R<D0>c<ED><63>X <0B>]><3E><>/S[<><7F><83><DA>|<7C><><B5><F5><AB>?<3F>.<2E>-S<><53>$AM<41><4D>j<A9><6A>%<25>-?<0F><><C0><8A>_L<5F><4C>h<A7>7u<37><75>_E[??<3F><1D><>Ԣx<D4A2><78><92>,E<><45>><3E><>U<C7><55> S<>"<22><18><>/<2F><><88>N <0C><><89>t4홊@<40><>i.<03>Oe0BĪ<17><> <20>*<2A> fD<66>&K<><4B>k~Mm<4D><6D><9A>M'<27>k<13><>\<5C><><F5>Z<E7><5A><04><>-<11>8!<21>ͽ<19>h<D0> <0C>Ɲ<8D>҈<CA>F<DB><46><9F><C6>i<C6><69>PK <0A><><10>`<60><><AB><84>DKy <0A>.<2E><>q:W<>l0T<30>#<23>2<DE>{HL<48>570|<7C><18>.<2E><>{c<><63><A4>{<7B><16>8<E0>s<>@<40><>L!<21><11>(<<13><01>)<29><>k<D0>Wԑ<57>鴪rJb<4A>ҟ<12>ɇ<C7>M=x<15><>P<AF>*Aξ"vmP&_<>xW<78><57>}Et<45><74>q<C4>q<>e<><65><F2>?<3F><>+<2B><18><>W(<28><> g_<67>x\be<62><15><><12><><E4><EC>/3<><33><BC>":_<><5F>}!<21>_be<62><15><0F><>_<92><5F><E4><BF><F2><8B><A4>*<2A>W=<3D><>=<3D><10>^<5E><>)<29><>h<AB><68>c<E6>*<2A>|<7C>7-U4^Q{<7B>t<A0><74><EA><D1>r<D1>P4MQo<51><6F><EF> M<>z^<5E>}<7D><><8A>4<D0><34><AE><84>q<A6><71>~l<><6C><99>U<AE>+<2B>=<3D><>F<BF>-<2D>
+<2B><><BC>_j<5F><6A>VE<56><45><A5>k<86> %<25><><89><98><BD>E?V<><56>)a n<><6E> <0C>>!<21>H<A8>uRcu/*<2A><><9A><07>5<9A><35>h<E8>o<94><6F><15>&(<28>ʥ#<23>§MW<4D>G<D4>ˢNi<4E>q<98><71><05>Fh<46>Y+W<><57>{<14>T4QQ<51>&<26><>a<>?<3F>ca<63>=<3D>|<1B><><93>'+<2B><><8E>2M<32>g<>:|F<><46><92>년<><EB8584><93><85><BF><89><DE><E8>ܻ~ˢ3<CBA2>1<F6><31>!><3E><><F0><B0><F0>o!?<V<><56>Lz<><17>ꅱ<BA>PO<50><4F><A3>O<98>з<AF><D0B7><E3><A6>MX<4D>|<7C>ށv<DE81> w<>u<>h<18>2\<5C>s<F1><73>b<8C>pՍ<70>+3<>F<04><1D>X<><58><FF><FC>aZ*h9<68><39>)<29> *<2A>;L./<2F><>'S/L<><4C><E4><85><F7><F9><92><8F><06>_<E8><5F><86>l%<25>*v<><0F><>r<E9><72>I4f><3E><><F9><BE>l<A3>pc<70><63><B6>NG+?<3F><><CF><F8><8F>;<3B>XG<58><47><D9>X<F3>%<25>*<2A> <09><>Ů<04>m<87><6D><B1><97>S<CD><53><94>=J<><4A><1F>/]2<><08><>7<85>;<3B><><08>ZV<5A>s<E4>fm<>D<D1><44><8D><B9>y<15><12><><B4>[<5B><><<3C>h<A0><68>l-6rȧ<72>G5<47>*r<><72><87><A2><FE><9A><89>B3<42>^<5E>=k<><6B>1<A2>R5=<3D>CM<43>]<5D>h<A5><68><AA><A2><9E>$<24><>u<><75><86>'$<24>n<10>`rZ
+v<><76>]<5D>AE<15>JV{N<><4E><B2>iF<69>,<2C>K<A0><4B>%k<><6B><FC><E2>Kc<4B><63>_<9E>$<24><><A6><CE>J<D6><4A>й<>''H
+鲋<><E9B28B><95>B)Mˌ<>"-<2D><>$<24><><C9><E1>~^<5E><><AD><E6><D5><06><><91><FA>n<A8><1D><>yu<0E>>ʫE<>k<FB>0<CC><30><A5><89><AF>/<2F><><B1>B<AC><42><B4><96>D<88>D<91>bŲ*<2A>*<1E>e<A4><65>,<2C><>x<AA>&<26><>g<9C>9%<25>Y<E7><59>y<16>Q<05>4qǷ*<2A><><8B>v,H<><48><BD><7F>j<A3>/<2F><>Z<EE><5A>'<27>Z] <0A><>O<E9>KO<4B>ZMH<4D>]Q_M<1C><>ꏩL<EA8FA9><4C>y<16>ׂ<F4><D782>&9P<39><50>`<60><>+<2B> ,y<>_<A0>hh<>Z*劮V<E58AAE><56>ɡ<AE>ŚqW4 -<2D><>w^]Kw<77>5<E7><35>_]<5D><1F><>Ι#ј,MaJ<61><4A><83>9<ED><39><F0><BF><CF>i<DE>V<>x<><78><C0><AB>(`<60>G_<05>ѣ<B8>B^<01>ȟ6`i<><69>+&<26>p<DF>M3o<33>=]<5D><>{<7B><8F><7F><9F>#<23><><FF><BE><AD><92><BE><FF>'W<57>sq<71><7F><F2>ٸ <0C><08>i<E0><69><C0><96><F3>r%<25>y<EF8CB9>1<B5>Ll<04>x<17>1<F0>Kcn<63>︵5`<60>1<BC>Av<41><76><C6>R@<40>1<95><31>7<03><01> <0A><><x<1D><01><13>c<><63><EE><C4><FF>Lc<4C>9p<>v<B0><00>88<0E>5e~<0E>00<16><0F><<3C><10><><BF>;<1B><>_<00>^<00><01><10>)<29>ɘ<A0><C998><FB><D1><CE>t <02><02>-<2D>c<16><><17>|m<>b<CC><62><F4>v<E2>|@1`$``<1A>n<E0>b<C0>C<00><><B4><DD><00>/<2F><>b<FC>/<2F>|<19><> _<06>2ȗA<C897> <0C>e<F2>/<2F>|<19><> _<06>2ȗA<C897> <0C>e<F2>/<2F>|9<><39>!_<0E>rȗC<C897><1C><><F2>/<2F>|9<><39>!_<0E>rȗC<C897><1C><><F2>/<2F>|<05>+ _<01>
+<2B>W@<40><02><15><><90>|<05>+ _<01>
+<2B>W@<40><02><15><><90>|%<25>+!_ <09>J<F9>WB<57>򕐯<>|%<25>+!_ <09>J<F9>WB<57>򕐯<><F29590AF><12>/<2F><><12>/<2F><><12>/<2F><><12>W<C8><57><A1><8F>GU<47><55>*<2A>Q<15><>
+}T<>>Z<>>Z<>>Z<>>Z<>>Z<>>Z<>>Z<>>Zv<5A>1+<2B><>+<2B><>+<2B><>+<2B><>+<2B><>+<2B>V<01>0vVb<56><62><EC><AC>Y<D8><59><89>s<F3><73>_<9D><18><><F3>Ƭ<FD>4^<5E>ɹ<85><18><>V<00>l<06><04><06>;<3B>)c<1E>y si<73>A<CD>Ic<49> <18><><F3><F4><C3>`<60><><FC>j<> 5<><35>|C <0A><><06>P<DF>o<83><6F>7<C1>K5f=޿<1E><><1E><><1E><><01><>a<00>`<03><>̃ <0A>06`l<><<3C><><07><>و<F6>ݸ<F6>[k<>G<EC>d]V<>c<F2>TV<54>c<FA>?V^eI<65>ɤ,<2C>t"ѽ<><02><><F3>(nx<6E><78><E9>s<D0><73><19><1C><><D8>0<D9>y<8B>8lX<><58>m<ED><6D><9E><9C><EE>ﶖ +<2B>M<DD>eZKO)<29><><90><16><><98>P*<2A>%ؐT6<54><36>}M<>2<D0>f<E7><66>UѶ<18><> <20>b<98>/}<7D><><EA><F7>z<>`<13><>`M<>qn;`}L՛Zo<6a<36><61>fވ<>m <0C><<3C><><85> <20>:<3A><><AD>x<D9>sf<1C> <0C><><E0><8C>-<19><>Zm<5A><18><><AB>h<D9><19>)<29><>) <0C>*l*u<>1<9B><31><FB>t2N|5<14><><A1><19>`<60>1<DB><12>Bc,<2C><><C3> :a@<40><>0N<30>v<FE>MO<4D><4F>F <09>@<40><><9B>I<B0><49>vb<76><62><06><><C7>Y<D1><59>v<CC><76><91>6 <0A><>8l<38>12]"!<21>rۃ<72><DB83><91><8F><1A>(x<><78>b<F6><62>G'<27><>$0<>/!<21>{<7B><08>rh<72>A<8E><41>$-/<2F><>-M<>բ<AB><1D>h<F7><68><1E>Z<F5>4t<34><0E><>f<1B>z<00>g<9E><67>[YH<59>]<5D>nd<6E><64><F7><B1>m<D8>6_<36>+<2B><><C9>.b<><62>k<B0>-<2D><12>b\kJ㶛<4A><E3B69B><8B>& M0<4D>MS<4D>u <0B><>c<04>LS<4C>I<8F>w<CB><77><9E><82><95>4%<25>Z<8D><5A>8<F5>K<C6>iN<1B><>m<FC><6D>Φ9~t<>n<D5>c <1C><> <0A>!<21>4G<34><47>><3E>a<80><61>4'Oz<4F>#<23>&<26>f<DC><16>y<F4> <09>O<C7>d;<3B>d<B3><64>5<98><35><CD>$<24>UB'<27><>͵<D6><CDB5>x.~<7E>*}<10>e'<27><><BA> g/<<3C>D<> Z<><0E>窭<>؆ͤ:LO<4C>[7<>r<CF>li<6C>_<AB>o<9B><6F>g<CC><67>J<DD>M<C6>kQ<6B><51><F5>w<9B><77>m8|<7C>dc3<63>0<02>trh܌ʵ<DC8C> <0A>;<3B><><CD><F3>:
+<2B><>{Ŝc<C59C>\P<><50><BE><BF><89><C5>a<D9><61>;<3B>Ϝ<DA>Ɠ<E6>7<><37>۱<AD><DBB1><F9>EwMW<>-<19>\{<7B><><BA>vm<76><6D>q<8C>d<Z<>!;<1F>3m<>-<2D>[<5B><>Pq<50>4<CF>RC"+ <0A>ut<75>
+<2B>?fQ<66><51>%<25>V<84><56>A0+I1V<31>!<04><> \ /4g<34><67>Z3B((ٞM<D99E><4D>^<5E>/ɛM<C99B>v.<2E><><9F><D4><C3>po:<3A>u<BE><75>$<24> 3<><33><A0><F9><ED><E5>L<D3>ig<69>wW<77><57><8D><11>i<95><69>愤z<><7A><F3>1j"67>3<><33><A5><7F><BB><DA>)m <17><><F4>I<A6><12> 7<>c<>܇U<>aڅko<6B><6F><8E><97><E2>Ƈ<E1><C687><8A><A5><9C>s24h<34><68># <0B><><B3><0F><>Ճ Su<53>bx<62>dK<64> w<><12><>!Ƀ<>UbѥqxI<02><>l!k)<29>Q<D8>Ri<52><69>t<9A>(<28>o<AC><l<>l<B5>&l<><6C><B9>M:a<><61>Y<><59><81><83> <0A> [<5B>&}O<>&<26><>l<>B<D1>&<26>\<5C><>C}<7D><><B1>u9<75><39><DC>t}<7D><>c<><63><A6>K<A5>O[<5B>2s<32><73><E9>ǾٸW<D9B8><13>u<B6><75><93><B0><8B><FB><AD>4<C1><34><C3>i<DD>.<2E><>9p<39><70><9B><E9><C7><E4><E5><FA><A9><86><AA>g<B3><67>j<A1><6A><<3C>PUp<55>)<29>a<94>,k<>e<AD><65><86>0T)<29><>Q2<07><>Y[ugJ<67>^<5E><><A7>P q*7u<37><75><F6>y<91>T<E1>k<C7><6B>a<B4>LgE<67>FC<46><0E>c<D7> <0C><>Yg{<7B>:N'ˌq<CB8C><71>ؠS<17><><D2>s<A6>ì<69>2<E6>l<93><6C><14>5<B2>yx<79>L"w<>ԯv<D4AF>cU.<2E><><B2>$<24><><01>{Z<><5A><C5>V<84>v<B1>Ȋ<A7>ޫ,`<60><><B9> X#s<>y.<2E><0E>6M+Y<>騕<EF><E9A895>{<7B><><B0>{0<>'*<2A><>g <0C><02><>9L<39>X<86>T?^%<25>Pl<50>E<A3><45><D9>J<FE><4A><85> <0A><><8A>G<16>x<B1>s<D9>l<8B>Y<05><><90>&<26>><1C><>D<14>H9**<2A>]1̺<31>0S1R<31>,<2C>(re<72>e<E8>U#<23>#!<21><><D3>Q"#<23>$<24><1D>bB<62>O<>HS[<19><>D<0F><>_<F4><FE>_6n<36>9=<0E> <20>X<E8>=<3D>i{<7B><06>Z=<3D><><D2><1C><>~,'y<><79> <09>{<7B><04>=<3D><>#=<3D>SpBO<42>$<24><>'w6kz<6B>rM<0F><>ia#4-,<2C><>`w<>f<9B>-<2D>l<D3>$<1B>51$+<2B>N<AC><4E><B3><C1><AA><B5>d<CB>ߒߨ<DF92>`<60>5 l<>&<26> <0A>$<24><><B0><A8><04>BO<42><4F>Ճ<8E><D583> <0A>V<><56>_c<5F>8h`<60><><9F>Uh<55>W<EE><57>kk<6B><6B><F5>L=͙ը`<60>5<AB>k<F3><06><>4l<>&<26><>>~n<02>[<5B><11>g4<67>k<FD>ƶ_<C6B6>,0w<30>F<82><46>h<0E>T <0A><>k
+<2B>mb? <20>`h- <09>7h<1E>4<D8><34>T<BF>}<7D> <0B>ݴ<A8>g<9A><1B>8<03>@<40><><19><><A7><F8>=<3D><>c<4<>(<17>#<23><><B6><B4><A5>k<BD><17><>L><3E><><1F>;<3B>и<9F>6<CA>ߘj[SI<53>Ѯ<A2><D1AE><B4>!<21>2<A2><32><B6>N<C4>B<14>D<>
+"](<28>MŅSJ.,<2C><>"n<><6E><85>.<2E><>?YT<59>4<A3>2<8B><32>P<A8>,<2C>*<2A><1A><>̢<A8>^<5E><><<3C><><E7><BC>i<9D><69>O<F1>J<9D><4A>>o<>}<7D><>Ν<E6><CE9D><A7>3<DC><33><BF><E7><DC><CF>ݓ<82>E<F9>7<BB>)z<><7A>У<FA>xo =<3D><>z<C9><7A>У;<3B>B<ED><1E><><C5><C5>У<A6><D0A3><B8><A0>Gqa =<3D><>;<3B>P<D6>Q<E8><51>m֟<6D><D69F><DB>^.7<FA>(<28><10>y<BD><79><87><F5>Q`<60>e<DD>y{X<>KE<4B>)"o;<3B>r<FB><72><D8>V  X<><58><90>`ݿ<00>67f<37>iKc><3E>vq<76><71><D4>.T|<7C><><EC><11>w[<5B><><BC>ݖ<E6><DD96><BF><D9>n <0B>}<7D><>c<13>A$<24>*
+<2B> R1(l<>o<DB>1<31><07>~<7E><>ھ<1B><><F0>ٰ<B6><D9B0>[<5B>"<22>@<40><0F>?<3F>Z<E6><5A>6d<7F>I<C5><49>A<94> #O<>y_[<5B><>c(<28><><18>g<><67>sv<73>9<AF><39><EC>gv<67><15>#<23>e<AE><65><F9><A3><8E><EC><9D><D9><E0>;<3B><>=<3D><>^<5E><>?<3F><><FA>pM<70><4D><CC><1C><><FD>i<D7><69>L<B7><4C>U<E6><1C>{<7B>%j<><6A>2g#(<28><><D5><C7><FD><83> V<>z<E1>n<97><6E><F6><CF><FD>p<CE><70><95><CE><EF><F7><8F><FD><8E>}̙<>/<c<><63>^|<7C><><93><E1><FA><9E><BF>ޢ<E0><17>/<1B><><B7>u<9F><75><95><FB>{ <13><>KᎱ]m<><6D><0F><><F1><F4><DF>3O<4F><7F><FA><01><><BB><93><B8>?y<>Z<80>3H<33><48>=r<>%O<>F<F6><46><BB>}B<>MvR<><52>v72}<7D>t]ow(<28><>EԾz<D4BE><0E>u]gw4<77><34><AD><AB>p|u<><8F>?&<01><><BD>Ww<57><77>)<29><><8B><94><CB>x<1F>h<F7><68><C9><F7><DC>湓S<E6B993>]p<><70>9 <0B><>O<04><>yb廆<62>/<2F>5<1D><85>c-<17><><9C>X<AF>e<D8><65>o猋Z<><00>cf/<2F>]v<>x<EB>)<29><13> y<><79>~<7E>>r?y<>xۤo<DBA4>ö)<29>Ӧ<C8><D3A6>O<E1>Q*a<>Y<DB><04>;<3B><><B1><BD>I<DB><07><><EF><F3>'};<3B><><EA>>$<24><><BE>ן<E7>mڷ<6D>|b|<7C>f܃`<60><><B5>os<6F>]<5D>i<B2>|ć<>'}<7D><><9B><F6>o<94><6F><BF><FA><80><F9><B0>?<3F>۔o<1F><><FA>C<E8><43>m<9B>><3E><><FC><F0> ۵<><1B><><FF>h<D7>{<7B>`<60><><F7><B1>\<5C>Ý*l.5֎<A4><B1>v&<26><><8D>M*m<><6D><A6>ڛ(m<><6D>Ʃ<F6>4-<2D><>
+<2B>ֻ'<27><1E><><D4><FF><E5>A"<22><><8F><E1><FC><93>]?!ʡ<7F>97<39>ƍ<C6>
+<2B><><C6>mN<6D>O<F6>v<F9>ܲ<C1><DCB2><A0><AC>?e.t><3E>O<E6>|<7C><1D><>?.ѷg<>|<7C> <20>l;<3B><><E7>^{"gP<67><50>`<60><>}<7D>`<60>I<CE>N<DF><4E>6dO<64> <0B>Ѷ<C2>܀<1B><>uN<75>v<FA>,<2C><><D7><DC><E0><CF><EC>یog<6F>is<69><73>o<0F>|ͷ<>|<7C><>ϟ<BC><CF9F><DF>oG}<7D><>}<7D><><F3><AD>=<3D>۴o_<6F>3<F9><06>>n<><6E><F5>9<D5><39><AB>jA<><41>
+N<><4E>B<9C>5(<28><><B0>egq<67>ѳb<D1B3><62><E9>uU<75><55><FE>w.<2E><>gQ<67>P>D<><44><C1>o<F8>:<3A><><82><B1><BB><02><>M<ED><4D>j<>7ٖ<37><D996><BC><0E>ޮ<17>|;<3B><>E 0<19>@<40><><97> <09><07><1E><><B1><FA><05> <0A>MX<1A>8<83><38>Q<DB>((<28>Q<0E><><A2>2<89><32>><3E>,<2C><J<1D> J<03><<3C><12>/(M<><4D>(<28>Em<45><6D><E3>1Y<31><59><CB>{<0F>:<3A><><9C>5<9E>ZV<5A>:<3A>ԋC<D48B>#<23><>u:<3A><>a X<>6)<29><><8A><0E>u$<24><0F>Z<08>V<>zoe;Jee?<3F>A<CA>7QfP<66>G<DE>E<99>G<99><47><A9>Ai<41><69>GYB<59><05><>re<>x<B9><78><BD><E3><A7>m<7F><6D><9F><8E><C4><D5><F9>{<7B><><BC><DD>o<>x<F7>z<D7>7<BC><37><15>R<E5><52><CD>o<83>4<D8>k<8F>dG3J<33><4A>(OQ<>ԣ<B2><D4A3><8C><99>f&ʝ<>QMDYd R<>U<C9><14>B<D4><42><A2>$<24>k"QbPe?<3F><><81><FF>Yc<59>z<CD>j<E3><6A>Gqޥ<1E>QQ,E<>шʣ<1E><>lT(3Q<33><1C>Jf"<22><1B><><E8>A<C5>>&<26>(<28><>P"MP2 ^<5E><>ӵ<EC>w<92><77>Ƿ<92><17><><17><><B6><FB><89><A9><D7>C<EE>e<>]<5D><><A6>|<7C><><CE>L=Q<><51><F9>MS/U<>*<2A><><BC><D6><EE><F1><AF><F3><E3><F7><BB><D0><F2>w<94><77>J<4A>t;7<1B>mNh<4E><68>N<8B>x<B5>pP駖<50><E9A796>t<EA><74>:⩤<>Z<<3C><>-<2D>-<2D>\z<><7A><BB>K<D3>.0=<3D><>!<21>_<A6><5F>Y<E7>'[<5B>e<9C><65>t<CC>K<0F>i7<69><37>W<E9><57>5<EE>l:ۥ<>=<3D>O<E4>:<3A>V<E1>;<3B>n<E2><6E>/<2F>{N/<2F>t<BD><74><D6><E1>u<D3><1E>[<5B>t<F2><74><E8>ӽ<D7><D3BD>Og<4F><67><BF><F4><F9><E1>3~"<22><>:~U<><55>_o<5F><6F>&v<><76>d{?<3F>}<7D>ރi<DE83><69><FF><A5><BD><97><9A><9D><EA>M<>R<CD><52> <0C><>dU<64><55>Ϻ<A1>pMB<><1E><><98>7<B2><37><A7>9B4z<34><7A><13>t <20><><9A><A8>J<A5>v븛<76><EBB89B>Kc6-M<><4D>…<D2>K{<7B>4{a<><61> <09>ưlb<6C>ƴ<98>KC<19>2<F6>fZ<66>r<CF><72>1m65M<35><4D>†<D2>M{<7B>f<9B><66><B7>h<EF><68>1N<31><4E><9B>9-<2D><>P<D2>揖y<E68F96>=<3D>q<71> <0C><>v<F8>*]<5D>8<AB><38><BE><B5>U<DB><55><BF>|ۏf<DB8F><66><8B>Mv<4D> d3<64>7g<37>b<D9><62><F4><98><A7><<3C><>o<85><6F><B3>><3E><><89>`<60><>A<F0><41><E1> <0B>
+?<14>(<0<><30>Ea<45><61>f<80>7
+w<04>( <12><><C0>H<F0><48>r<>O<02><04>#<23><12>%<25>K<90><4B>@1<>d<02><14> d<13>&<26> <20><>@:<3A>v
+<2B><04> <09>p<><70>"<22><1E>z?~<7E><0E> H <20>@$<24><>&qM›D9 v<12>$<24>I<04>@(<28>P¢DG <09><>+%fJ<66><4A>*<2A>T<81><54><F1>U <09>e%<25>*Ε<>+!X1<58>Dd ̊<>%NK<4E><4B><B8><96><A8>[<5B><><82>r <09><><E9>%<25>K<C2><4B>x<97>h_¿D<C2BF> 5,<2C><>P1c<02>ď #M'<27><>0<FC>e<C9><65>N5W<35><57><B3>"<22><><AF><01>V;<3B><><AF><F1>׸<E2><D7B8><9C>nݸ<6E> #(fP <0C><>B1<42>bѪb<11>&<26>M<A2>,<2C>aD<61><44>mD<6D><44>y<04><><13>')f-
+<2B>RL%Z<14>%xK<78><4B><B1>0<E0>c<C1><63>D{<7B><><04>)v'xNp<4E>h<9D><68><CF><EE><F1><AF>'<27>@<1A>lI <09><><92>*IY<49><59>$<24>I<1E>t&YM<59><4D><92>8Iu<49><75>$<24>I<F1>S8(<28>P<E9><50>$Gɑ
++%eJ<65><4A>*yTᩤUɮ
+e%<25>J<D9>U<CE>+)X2<58>$d̒<>%MK<4D>V<B6>-<2D>[r<><72>r<05><><E9>%<25>K<C1><4B>t<97>`_<><5F>d<BF>I<06>&5L<35><4C>D<98>c<01><02>$ P<>b<BE><62><C6><CA><FF><CA><D3><CA><F6><F8>L'<27>J2<4A>p<8E>$3H<33><48> <1F><2u$a$Y<><59><F0><<3C>,<2C><1C>{\<5C>C<F2><03>e<EF> <0C> <0B>
+H
+H <09>O!!  v<><76><9B>P+<2B>?{g~v<>m᠋<6D>^4<07><>}M<>k<F2>_<B2><5F><93><FE>gc<12><>%(Q@  `<60><><FC><08>N<94><4E>e(ˀ<>J:P<><01><10><><94><8B><04>&(GA<47>
+<2B>YP<59><50>r<18>ˠ<94><06>6(<28>A<C7><0E>yP<79><50>r ƙ <0B><>c"<22><><AA><88>!<21>gH<67>;<04><0E>3<BC><33><F0>;<02><06>p<><70><85><C2>ggggg<18>gg<>Z<F3><5A>AV@U<><01>P<>@<40>P<>@L"<22><>1<> <20><17>D<C4><44>qP<71><1E>Q1<1D> L(C<14>d<92>$o<><6F>ڴ<D3><DAB4><B6><C5><00> W +8S<38>-<2D>*<2A>%<25> <20><1C><16><13><0E>
+<2B><05><><1F>W`<06>a<FF><61>H<7F><48>؏<13>q<FC>?N<>ǹ<F9><C7B9><10>ʸ<>2B <20>
+<2B>Ae<>@<40>H<92><48><14>zj<7A>e1<65>B<CA>e(<28>֠<>@<40>F<E9>D<E9>҄ЂҀ<D082><D0>|<7C>z<D2>x<D0>vx<76><78><89><A4>RA<52>A<BF>A<BB>A<B7>A<AF>A<AB>a&<26><>><3E>]t<74><7F><E2>'<27>
+<2B><><DC>
+򪢡<>qθ<71>q<8F>]3<><1C><><89><<3C><>9<<3C>Yz<59><7A>k֞<6B><D69E><1C><>\<5C><><BE>9<F4><39>)~M<>s<F5>_3<5F><33>`$<24><02><18>%
+(a@<40>J P"<22>
+<2B>X<94>%(<28>@<40>J@P"<22><12><><94>*<2A>ی<84><DB8C>f<C2>+<2B><><C4>9C<39><43><BC><D6><FD><BB><8B>O<1A><>d<E3><64><9E><8F><E9>Y<A3><59>VH<16><><F8><E3>RA<52> e<>ߗ<<3C><<3C><> ><3E>t<81><[<5B><>{_3ޞj<DE9E>z<B3><7A><15>̿<F8>u<FD>D<D6>MK<4D>$ͱ<>kո<1B>B<DC><10>o<8E>X<AE>wI<77>K̃<4B>e<A9><65><9F><FE><E9>_<DF>?<3F><><A0><AD>e<F4>~<7E>¯\<5C><>W<>;||j<><6A><9E>
\ No newline at end of file
diff -Naur mxml-2.6/doc/makedocs.sh mxml-2.6-haiku/doc/makedocs.sh
--- mxml-2.6/doc/makedocs.sh 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/makedocs.sh 2007-09-09 07:16:52.000000000 +0000
@@ -0,0 +1,30 @@
+#!/bin/sh
+#
+# "$Id: makedocs.sh 297 2007-09-09 07:16:52Z mike $"
+#
+# Script to make documentation...
+#
+# Copyright 2003-2007 by Michael Sweet.
+#
+# This program is free software; you can redistribute it and/or
+# modify it under the terms of the GNU Library General Public
+# License as published by the Free Software Foundation; either
+# version 2, or (at your option) any later version.
+#
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+# GNU General Public License for more details.
+#
+
+htmldoc --verbose --path "hires;." --batch mxml.book -f mxml.pdf
+
+htmldoc --verbose --batch mxml.book --no-title -f mxml.html
+
+rm -rf mxml.d
+mkdir mxml.d
+htmldoc --verbose --batch mxml.book --no-title -t html -d mxml.d
+
+#
+# End of "$Id: makedocs.sh 297 2007-09-09 07:16:52Z mike $".
+#
diff -Naur mxml-2.6/doc/mxml.book mxml-2.6-haiku/doc/mxml.book
--- mxml-2.6/doc/mxml.book 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/mxml.book 2008-01-25 07:50:40.000000000 +0000
@@ -0,0 +1,11 @@
+#HTMLDOC 1.8.27.1
+-t pdf14 -f "mxml.pdf" --book --toclevels 3 --no-numbered --toctitle "Table of Contents" --title --titleimage "title.html" --linkstyle plain --size 4.25x6.875in --left 0.750in --right 0.50in --top 0.50in --bottom 0.50in --header .t. --header1 ... --footer h.1 --nup 1 --tocheader .t. --tocfooter ..i --duplex --portrait --color --no-pscommands --no-xrxcomments --compression=9 --jpeg=95 --fontsize 9.0 --fontspacing 1.2 --headingfont Helvetica --bodyfont Helvetica --headfootsize 8.0 --headfootfont Helvetica-Oblique --charset iso-8859-1 --links --embedfonts --pagemode outline --pagelayout single --firstpage c1 --pageeffect none --pageduration 10 --effectduration 1.0 --no-encryption --permissions all --owner-password "" --user-password "" --browserwidth 300 --no-strict --no-overflow
+intro.html
+install.html
+basics.html
+advanced.html
+mxmldoc.html
+license.html
+relnotes.html
+reference.html
+schema.html
diff -Naur mxml-2.6/doc/mxml.html mxml-2.6-haiku/doc/mxml.html
--- mxml-2.6/doc/mxml.html 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/mxml.html 2009-05-17 17:31:51.000000000 +0000
@@ -0,0 +1,3952 @@
+<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Transitional//EN" "http://www.w3.org/TR/REC-html40/loose.dtd">
+<HTML>
+<HEAD>
+<TITLE>Mini-XML Programmers Manual, Version 2.6</TITLE>
+<META NAME="author" CONTENT="Michael R. Sweet">
+<META NAME="copyright" CONTENT="Copyright 2003-2009">
+<META HTTP-EQUIV="Content-Type" CONTENT="text/html; CHARSET=iso-iso-8859-1">
+<STYLE TYPE="text/css"><!--
+BODY { font-family: sans-serif }
+H1 { font-family: sans-serif }
+H2 { font-family: sans-serif }
+H3 { font-family: sans-serif }
+H4 { font-family: sans-serif }
+H5 { font-family: sans-serif }
+H6 { font-family: sans-serif }
+SUB { font-size: smaller }
+SUP { font-size: smaller }
+PRE { font-family: monospace }
+A { text-decoration: none }
+--></STYLE>
+</HEAD>
+<BODY>
+<H1 ALIGN="CENTER"><A NAME="CONTENTS">Table of Contents</A></H1>
+<BR>
+<BR><B><A HREF="#INTRO">Introduction</A></B>
+<UL>
+<LI><A HREF="#1_1">Organization of This Document</A></LI>
+<LI><A HREF="#1_2">Notation Conventions</A></LI>
+<LI><A HREF="#1_3">Abbreviations</A></LI>
+<LI><A HREF="#1_4">Other References</A></LI>
+<LI><A HREF="#1_5">Legal Stuff</A></LI>
+</UL>
+<B><A HREF="#INSTALL">Building, Installing, and Packaging Mini-XML</A></B>
+<UL>
+<LI><A HREF="#2_1">Compiling Mini-XML</A>
+<UL>
+<LI><A HREF="#2_1_1">Compiling with Visual C++</A></LI>
+<LI><A HREF="#2_1_2">Compiling with Command-Line Tools</A></LI>
+</UL>
+</LI>
+<LI><A HREF="#2_2">Installing Mini-XML</A></LI>
+<LI><A HREF="#2_3">Creating Mini-XML Packages</A></LI>
+</UL>
+<B><A HREF="#BASICS">Getting Started with Mini-XML</A></B>
+<UL>
+<LI><A HREF="#3_1">The Basics</A></LI>
+<LI><A HREF="#3_2">Nodes</A></LI>
+<LI><A HREF="#3_3">Creating XML Documents</A></LI>
+<LI><A HREF="#3_4">Loading XML</A></LI>
+<LI><A HREF="#3_5">Saving XML</A>
+<UL>
+<LI><A HREF="#3_5_1">Controlling Line Wrapping</A></LI>
+</UL>
+</LI>
+<LI><A HREF="#3_6">Finding and Iterating Nodes</A></LI>
+</UL>
+<B><A HREF="#ADVANCED">More Mini-XML Programming Techniques</A></B>
+<UL>
+<LI><A HREF="#LOAD_CALLBACKS">Load Callbacks</A></LI>
+<LI><A HREF="#SAVE_CALLBACKS">Save Callbacks</A></LI>
+<LI><A HREF="#4_3">Custom Data Types</A></LI>
+<LI><A HREF="#4_4">Changing Node Values</A></LI>
+<LI><A HREF="#4_5">Formatted Text</A></LI>
+<LI><A HREF="#4_6">Indexing</A></LI>
+<LI><A HREF="#4_7">SAX (Stream) Loading of Documents</A></LI>
+</UL>
+<B><A HREF="#MXMLDOC">Using the mxmldoc Utility</A></B>
+<UL>
+<LI><A HREF="#5_1">The Basics</A>
+<UL>
+<LI><A HREF="#5_1_1">Creating Man Pages</A></LI>
+<LI><A HREF="#5_1_2">Creating Xcode Documentation Sets</A></LI>
+</UL>
+</LI>
+<LI><A HREF="#5_2">Commenting Your Code</A></LI>
+<LI><A HREF="#5_3">Titles, Sections, and Introductions</A></LI>
+</UL>
+<B><A HREF="#LICENSE">Mini-XML License</A></B>
+<BR>
+<BR><B><A HREF="#RELNOTES">Release Notes</A></B>
+<UL></UL>
+<B><A HREF="#REFERENCE">Library Reference</A></B>
+<UL>
+<LI><A HREF="#8_1">Contents</A></LI>
+<LI><A HREF="#FUNCTIONS">Functions</A>
+<UL>
+<LI><A HREF="#mxmlAdd">mxmlAdd</A></LI>
+<LI><A HREF="#mxmlDelete">mxmlDelete</A></LI>
+<LI><A HREF="#8_2_3">mxmlElementDeleteAttr</A></LI>
+<LI><A HREF="#mxmlElementGetAttr">mxmlElementGetAttr</A></LI>
+<LI><A HREF="#mxmlElementSetAttr">mxmlElementSetAttr</A></LI>
+<LI><A HREF="#8_2_6">mxmlElementSetAttrf</A></LI>
+<LI><A HREF="#mxmlEntityAddCallback">mxmlEntityAddCallback</A></LI>
+<LI><A HREF="#mxmlEntityGetName">mxmlEntityGetName</A></LI>
+<LI><A HREF="#mxmlEntityGetValue">mxmlEntityGetValue</A></LI>
+<LI><A HREF="#mxmlEntityRemoveCallback">mxmlEntityRemoveCallback</A></LI>
+<LI><A HREF="#mxmlFindElement">mxmlFindElement</A></LI>
+<LI><A HREF="#mxmlIndexDelete">mxmlIndexDelete</A></LI>
+<LI><A HREF="#mxmlIndexEnum">mxmlIndexEnum</A></LI>
+<LI><A HREF="#mxmlIndexFind">mxmlIndexFind</A></LI>
+<LI><A HREF="#mxmlIndexNew">mxmlIndexNew</A></LI>
+<LI><A HREF="#mxmlIndexReset">mxmlIndexReset</A></LI>
+<LI><A HREF="#mxmlLoadFd">mxmlLoadFd</A></LI>
+<LI><A HREF="#mxmlLoadFile">mxmlLoadFile</A></LI>
+<LI><A HREF="#mxmlLoadString">mxmlLoadString</A></LI>
+<LI><A HREF="#8_2_20">mxmlNewCDATA</A></LI>
+<LI><A HREF="#8_2_21">mxmlNewCustom</A></LI>
+<LI><A HREF="#mxmlNewElement">mxmlNewElement</A></LI>
+<LI><A HREF="#mxmlNewInteger">mxmlNewInteger</A></LI>
+<LI><A HREF="#mxmlNewOpaque">mxmlNewOpaque</A></LI>
+<LI><A HREF="#mxmlNewReal">mxmlNewReal</A></LI>
+<LI><A HREF="#mxmlNewText">mxmlNewText</A></LI>
+<LI><A HREF="#mxmlNewTextf">mxmlNewTextf</A></LI>
+<LI><A HREF="#8_2_28">mxmlNewXML</A></LI>
+<LI><A HREF="#8_2_29">mxmlRelease</A></LI>
+<LI><A HREF="#mxmlRemove">mxmlRemove</A></LI>
+<LI><A HREF="#8_2_31">mxmlRetain</A></LI>
+<LI><A HREF="#8_2_32">mxmlSAXLoadFd</A></LI>
+<LI><A HREF="#8_2_33">mxmlSAXLoadFile</A></LI>
+<LI><A HREF="#8_2_34">mxmlSAXLoadString</A></LI>
+<LI><A HREF="#mxmlSaveAllocString">mxmlSaveAllocString</A></LI>
+<LI><A HREF="#mxmlSaveFd">mxmlSaveFd</A></LI>
+<LI><A HREF="#mxmlSaveFile">mxmlSaveFile</A></LI>
+<LI><A HREF="#mxmlSaveString">mxmlSaveString</A></LI>
+<LI><A HREF="#8_2_39">mxmlSetCDATA</A></LI>
+<LI><A HREF="#8_2_40">mxmlSetCustom</A></LI>
+<LI><A HREF="#mxmlSetCustomHandlers">mxmlSetCustomHandlers</A></LI>
+<LI><A HREF="#mxmlSetElement">mxmlSetElement</A></LI>
+<LI><A HREF="#mxmlSetErrorCallback">mxmlSetErrorCallback</A></LI>
+<LI><A HREF="#mxmlSetInteger">mxmlSetInteger</A></LI>
+<LI><A HREF="#mxmlSetOpaque">mxmlSetOpaque</A></LI>
+<LI><A HREF="#mxmlSetReal">mxmlSetReal</A></LI>
+<LI><A HREF="#mxmlSetText">mxmlSetText</A></LI>
+<LI><A HREF="#mxmlSetTextf">mxmlSetTextf</A></LI>
+<LI><A HREF="#8_2_49">mxmlSetWrapMargin</A></LI>
+<LI><A HREF="#mxmlWalkNext">mxmlWalkNext</A></LI>
+<LI><A HREF="#mxmlWalkPrev">mxmlWalkPrev</A></LI>
+</UL>
+</LI>
+<LI><A HREF="#TYPES">Data Types</A>
+<UL>
+<LI><A HREF="#mxml_attr_t">mxml_attr_t</A></LI>
+<LI><A HREF="#mxml_custom_destroy_cb_t">mxml_custom_destroy_cb_t</A></LI>
+<LI><A HREF="#mxml_custom_load_cb_t">mxml_custom_load_cb_t</A></LI>
+<LI><A HREF="#mxml_custom_save_cb_t">mxml_custom_save_cb_t</A></LI>
+<LI><A HREF="#8_3_5">mxml_custom_t</A></LI>
+<LI><A HREF="#mxml_element_t">mxml_element_t</A></LI>
+<LI><A HREF="#mxml_entity_cb_t">mxml_entity_cb_t</A></LI>
+<LI><A HREF="#mxml_error_cb_t">mxml_error_cb_t</A></LI>
+<LI><A HREF="#mxml_index_t">mxml_index_t</A></LI>
+<LI><A HREF="#mxml_load_cb_t">mxml_load_cb_t</A></LI>
+<LI><A HREF="#mxml_node_t">mxml_node_t</A></LI>
+<LI><A HREF="#mxml_save_cb_t">mxml_save_cb_t</A></LI>
+<LI><A HREF="#mxml_sax_cb_t">mxml_sax_cb_t</A></LI>
+<LI><A HREF="#mxml_sax_event_t">mxml_sax_event_t</A></LI>
+<LI><A HREF="#mxml_text_t">mxml_text_t</A></LI>
+<LI><A HREF="#mxml_type_t">mxml_type_t</A></LI>
+<LI><A HREF="#mxml_value_t">mxml_value_t</A></LI>
+</UL>
+</LI>
+<LI><A HREF="#STRUCTURES">Structures</A>
+<UL>
+<LI><A HREF="#mxml_attr_s">mxml_attr_s</A></LI>
+<LI><A HREF="#8_4_2">mxml_custom_s</A></LI>
+<LI><A HREF="#mxml_element_s">mxml_element_s</A></LI>
+<LI><A HREF="#mxml_index_s">mxml_index_s</A></LI>
+<LI><A HREF="#mxml_node_s">mxml_node_s</A></LI>
+<LI><A HREF="#mxml_text_s">mxml_text_s</A></LI>
+</UL>
+</LI>
+<LI><A HREF="#UNIONS">Unions</A>
+<UL>
+<LI><A HREF="#mxml_value_u">mxml_value_u</A></LI>
+</UL>
+</LI>
+<LI><A HREF="#ENUMERATIONS">Constants</A>
+<UL>
+<LI><A HREF="#mxml_sax_event_e">mxml_sax_event_e</A></LI>
+<LI><A HREF="#mxml_type_e">mxml_type_e</A></LI>
+</UL>
+</LI>
+</UL>
+<B><A HREF="#SCHEMA">XML Schema</A></B>
+<UL></UL>
+<HR NOSHADE>
+<H1 align="right"><A name="INTRO"><IMG align="right" alt="0" height="100"
+hspace="10" src="0.gif" width="100"></A>Introduction</H1>
+<P>This programmers manual describes Mini-XML version 2.6, a small XML
+ parsing library that you can use to read and write XML data files in
+ your C and C++ applications.</P>
+<P>Mini-XML was initially developed for the <A href="http://gutenprint.sf.net/">
+Gutenprint</A> project to replace the rather large and unwieldy <TT>
+libxml2</TT> library with something substantially smaller and
+ easier-to-use. It all began one morning in June of 2003 when Robert
+ posted the following sentence to the developer's list:</P>
+<BLOCKQUOTE><EM>It's bad enough that we require libxml2, but rolling our
+ own XML parser is a bit more than we can handle.</EM></BLOCKQUOTE>
+<P>I then replied with:</P>
+<BLOCKQUOTE><EM>Given the limited scope of what you use in XML, it
+ should be trivial to code a mini-XML API in a few hundred lines of
+ code.</EM></BLOCKQUOTE>
+<P>I took my own challenge and coded furiously for two days to produced
+ the initial public release of Mini-XML, total lines of code: 696.
+ Robert promptly integrated Mini-XML into Gutenprint and removed
+ libxml2.</P>
+<P>Thanks to lots of feedback and support from various developers,
+ Mini-XML has evolved since then to provide a more complete XML
+ implementation and now stands at a whopping 3,441 lines of code,
+ compared to 103,893 lines of code for libxml2 version 2.6.9.</P>
+<P>Aside from Gutenprint, Mini-XML is used for the following
+ projects/software applications:</P>
+<UL>
+<LI><A href="http://www.cups.org/">Common UNIX Printing System</A></LI>
+<LI><A href="http://zynaddsubfx.sourceforge.net">ZynAddSubFX</A></LI>
+</UL>
+<P>Please email me (mxml @ easysw . com) if you would like your project
+ added or removed from this list, or if you have any comments/quotes you
+ would like me to publish about your experiences with Mini-XML.</P>
+
+<!-- NEED 1in -->
+<H2><A NAME="1_1">Organization of This Document</A></H2>
+<P>This manual is organized into the following chapters and appendices:</P>
+<UL>
+<LI>Chapter 1, &quot;<A href="#INSTALL">Building, Installing, and Packaging
+ Mini-XML</A>&quot;, provides compilation, installation, and packaging
+ instructions for Mini-XML.</LI>
+<LI>Chapter 2, &quot;<A href="#BASICS">Getting Started with Mini-XML</A>&quot;,
+ shows how to use the Mini-XML library in your programs.</LI>
+<LI>Chapter 3, &quot;<A href="#ADVANCED">More Mini-XML Programming Techniques</A>
+&quot;, shows additional ways to use the Mini-XML library.</LI>
+<LI>Chapter 4, &quot;<A href="#MXMLDOC">Using the mxmldoc Utility</A>&quot;,
+ describes how to use the <TT>mxmldoc(1)</TT> program to generate
+ software documentation.</LI>
+<LI>Appendix A, &quot;<A href="#LICENSE">Mini-XML License</A>&quot;, provides the
+ terms and conditions for using and distributing Mini-XML.</LI>
+<LI>Appendix B, &quot;<A href="#RELNOTES">Release Notes</A>&quot;, lists the
+ changes in each release of Mini-XML.</LI>
+<LI>Appendix C, &quot;<A href="#REFERENCE">Library Reference</A>&quot;, contains a
+ complete reference for Mini-XML, generated by <TT>mxmldoc</TT>.</LI>
+<LI>Appendix D, &quot;<A href="#SCHEMA">XML Schema</A>&quot;, shows the XML schema
+ used for the XML files produced by <TT>mxmldoc</TT>.</LI>
+</UL>
+
+<!-- NEED 10 -->
+<H2><A NAME="1_2">Notation Conventions</A></H2>
+<P>Various font and syntax conventions are used in this guide. Examples
+ and their meanings and uses are explained below:</P>
+<DL>
+<DT><CODE>mxmldoc</CODE>
+<BR> <CODE>mxmldoc(1)</CODE></DT>
+<DD>The names of commands; the first mention of a command or function in
+ a chapter is followed by a manual page section number.
+<BR>
+<BR></DD>
+<DT><VAR>/var</VAR>
+<BR><VAR> /etc/hosts</VAR></DT>
+<DD>File and directory names.
+<BR>
+<BR></DD>
+<DT><TT>Request ID is Printer-123</TT></DT>
+<DD>Screen output.
+<BR>
+<BR></DD>
+<DT><KBD>lp -d printer filename ENTER</KBD></DT>
+<DD>Literal user input; special keys like <KBD>ENTER</KBD> are in ALL
+ CAPS.
+<BR>
+<BR></DD>
+<DT>12.3</DT>
+<DD>Numbers in the text are written using the period (.) to indicate the
+ decimal point.
+<BR>
+<BR></DD>
+</DL>
+
+<!-- NEED 10 -->
+<H2><A NAME="1_3">Abbreviations</A></H2>
+<P>The following abbreviations are used throughout this manual:</P>
+<DL>
+<DT>Gb</DT>
+<DD>Gigabytes, or 1073741824 bytes
+<BR>
+<BR></DD>
+<DT>kb</DT>
+<DD>Kilobytes, or 1024 bytes
+<BR>
+<BR></DD>
+<DT>Mb</DT>
+<DD>Megabytes, or 1048576 bytes
+<BR>
+<BR></DD>
+<DT>UTF-8, UTF-16</DT>
+<DD>Unicode Transformation Format, 8-bit or 16-bit
+<BR>
+<BR></DD>
+<DT>W3C</DT>
+<DD>World Wide Web Consortium
+<BR>
+<BR></DD>
+<DT>XML</DT>
+<DD>Extensible Markup Language
+<BR>
+<BR></DD>
+</DL>
+
+<!-- NEED 12 -->
+<H2><A NAME="1_4">Other References</A></H2>
+<DL>
+<DT>The Unicode Standard, Version 4.0, Addison-Wesley, ISBN
+ 0-321-18578-1</DT>
+<DD>The definition of the Unicode character set which is used for XML.
+<BR>
+<BR></DD>
+<DT><A href="http://www.w3.org/TR/2004/REC-xml-20040204/">Extensible
+ Markup Language (XML) 1.0 (Third Edition)</A></DT>
+<DD>The XML specification from the World Wide Web Consortium (W3C)
+<BR>
+<BR></DD>
+</DL>
+
+<!-- NEED 6 -->
+<H2><A NAME="1_5">Legal Stuff</A></H2>
+<P>The Mini-XML library is copyright 2003-2009 by Michael Sweet. License
+ terms are described in <A href="#LICENSE">Appendix A - Mini-XML License</A>
+.</P>
+<HR NOSHADE>
+<H1 align="right"><A name="INSTALL"><IMG align="right" alt="1" height="100"
+hspace="10" src="1.gif" width="100"></A>Building, Installing, and
+ Packaging Mini-XML</H1>
+<P>This chapter describes how to build, install, and package Mini-XML on
+ your system from the source archive. You will need an ANSI/ISO-C
+ compatible compiler to build Mini-XML - GCC works, as do most vendors'
+ C compilers. If you are building Mini-XML on Windows, we recommend
+ using the Visual C++ environment with the supplied solution file. For
+ other operating systems, you'll need a POSIX-compatible shell and <TT>
+make</TT> program in addition to the C compiler.</P>
+<H2><A NAME="2_1">Compiling Mini-XML</A></H2>
+<P>Mini-XML comes with both an autoconf-based configure script and a
+ Visual C++ solution that can be used to compile the library and
+ associated tools.</P>
+<H3><A NAME="2_1_1">Compiling with Visual C++</A></H3>
+<P>Open the<VAR> mxml.sln</VAR> solution in the<VAR> vcnet</VAR> folder.
+ Choose the desired build configuration, &quot;Debug&quot; (the default) or
+ &quot;Release&quot;, and then choose<VAR> Build Solution</VAR> from the<VAR>
+ Build</VAR> menu.</P>
+<H3><A NAME="2_1_2">Compiling with Command-Line Tools</A></H3>
+<P>Type the following command to configure the Mini-XML source code for
+ your system:</P>
+<PRE>
+ <KBD>./configure ENTER</KBD>
+</PRE>
+<P>The default install prefix is<VAR> /usr/local</VAR>, which can be
+ overridden using the <KBD>--prefix</KBD> option:</P>
+<PRE>
+ <KBD>./configure --prefix=/foo ENTER</KBD>
+</PRE>
+<P>Other configure options can be found using the <KBD>--help</KBD>
+ option:</P>
+<PRE>
+ <KBD>./configure --help ENTER</KBD>
+</PRE>
+<P>Once you have configured the software, use the <TT>make(1)</TT>
+ program to do the build and run the test program to verify that things
+ are working, as follows:</P>
+<PRE>
+ <KBD>make ENTER</KBD>
+</PRE>
+<H2><A NAME="2_2">Installing Mini-XML</A></H2>
+<P>If you are using Visual C++, copy the<VAR> mxml.lib</VAR> and and<VAR>
+ mxml.h</VAR> files to the Visual C++<VAR> lib</VAR> and<VAR> include<VAR>
+ directories, respectively.</VAR></VAR></P>
+<P>Otherwise, use the <TT>make</TT> command with the <KBD>install</KBD>
+ target to install Mini-XML in the configured directories:</P>
+<PRE>
+ <KBD>make install ENTER</KBD>
+</PRE>
+<H2><A NAME="2_3">Creating Mini-XML Packages</A></H2>
+<P>Mini-XML includes two files that can be used to create binary
+ packages. The first file is<VAR> mxml.spec</VAR> which is used by the <TT>
+rpmbuild(8)</TT> software to create Red Hat Package Manager (&quot;RPM&quot;)
+ packages which are commonly used on Linux. Since <TT>rpmbuild</TT>
+ wants to compile the software on its own, you can provide it with the
+ Mini-XML tar file to build the package:</P>
+<PRE>
+ <KBD>rpmbuild -ta mxml-<I>version</I>.tar.gz ENTER</KBD>
+</PRE>
+<P>The second file is<VAR> mxml.list</VAR> which is used by the <TT>
+epm(1)</TT> program to create software packages in a variety of formats.
+ The <TT>epm</TT> program is available from the following URL:</P>
+<PRE>
+ <A href="http://www.easysw.com/epm/">http://www.easysw.com/epm/</A>
+</PRE>
+<P>Use the <TT>make</TT> command with the <KBD>epm</KBD> target to
+ create portable and native packages for your system:</P>
+<PRE>
+ <KBD>make epm ENTER</KBD>
+</PRE>
+<P>The packages are stored in a subdirectory named<VAR> dist</VAR> for
+ your convenience. The portable packages utilize scripts and tar files
+ to install the software on the target system. After extracting the
+ package archive, use the<VAR> mxml.install</VAR> script to install the
+ software.</P>
+<P>The native packages will be in the local OS's native format: RPM for
+ Red Hat Linux, DPKG for Debian Linux, PKG for Solaris, and so forth.
+ Use the corresponding commands to install the native packages.</P>
+<HR NOSHADE>
+<H1 align="right"><A name="BASICS"><IMG align="right" alt="2" height="100"
+hspace="10" src="2.gif" width="100"></A>Getting Started with Mini-XML</H1>
+<P>This chapter describes how to write programs that use Mini-XML to
+ access data in an XML file. Mini-XML provides the following
+ functionality:</P>
+<UL>
+<LI>Functions for creating and managing XML documents in memory.</LI>
+<LI>Reading of UTF-8 and UTF-16 encoded XML files and strings.</LI>
+<LI>Writing of UTF-8 encoded XML files and strings.</LI>
+<LI>Support for arbitrary element names, attributes, and attribute
+ values with no preset limits, just available memory.</LI>
+<LI>Support for integer, real, opaque (&quot;cdata&quot;), and text data types in
+ &quot;leaf&quot; nodes.</LI>
+<LI>&quot;Find&quot;, &quot;index&quot;, and &quot;walk&quot; functions for easily accessing data in
+ an XML document.</LI>
+</UL>
+<P>Mini-XML doesn't do validation or other types of processing on the
+ data based upon schema files or other sources of definition
+ information, nor does it support character entities other than those
+ required by the XML specification.</P>
+<H2><A NAME="3_1">The Basics</A></H2>
+<P>Mini-XML provides a single header file which you include:</P>
+<PRE>
+ #include &lt;mxml.h&gt;
+</PRE>
+<P>The Mini-XML library is included with your program using the <KBD>
+-lmxml</KBD> option:</P>
+<PRE>
+ <KBD>gcc -o myprogram myprogram.c -lmxml ENTER</KBD>
+</PRE>
+<P>If you have the <TT>pkg-config(1)</TT> software installed, you can
+ use it to determine the proper compiler and linker options for your
+ installation:</P>
+<PRE>
+ <KBD>pkg-config --cflags mxml ENTER</KBD>
+ <KBD>pkg-config --libs mxml ENTER</KBD>
+</PRE>
+<H2><A NAME="3_2">Nodes</A></H2>
+<P>Every piece of information in an XML file (elements, text, numbers)
+ is stored in memory in &quot;nodes&quot;. Nodes are defined by the <A href="#mxml_node_t">
+<TT>mxml_node_t</TT></A> structure. The <A href="#mxml_type_t"><TT>type</TT>
+</A> member defines the node type (element, integer, opaque, real, or
+ text) which determines which value you want to look at in the <A href="#mxml_value_t">
+<TT>value</TT></A> union.</P>
+
+<!-- NEED 10 -->
+<CENTER>
+<TABLE border="1" cellpadding="5" cellspacing="0" summary="Mini-XML Node Value Members"
+width="80%"><CAPTION align="bottom"><I> Table 2-1: Mini-XML Node Value
+ Members</I></CAPTION>
+<TR bgcolor="#cccccc"><TH>Value</TH><TH>Type</TH><TH>Node member</TH></TR>
+<TR><TD>Custom</TD><TD><TT>void *</TT></TD><TD><TT>
+node-&gt;value.custom.data</TT></TD></TR>
+<TR><TD>Element</TD><TD><TT>char *</TT></TD><TD><TT>
+node-&gt;value.element.name</TT></TD></TR>
+<TR><TD>Integer</TD><TD><TT>int</TT></TD><TD><TT>node-&gt;value.integer</TT>
+</TD></TR>
+<TR><TD>Opaque (string)</TD><TD><TT>char *</TT></TD><TD><TT>
+node-&gt;value.opaque</TT></TD></TR>
+<TR><TD>Real</TD><TD><TT>double</TT></TD><TD><TT>node-&gt;value.real</TT></TD>
+</TR>
+<TR><TD>Text</TD><TD><TT>char *</TT></TD><TD><TT>node-&gt;value.text.string</TT>
+</TD></TR>
+</TABLE>
+</CENTER>
+<P>Each node also has a <TT>user_data</TT> member which allows you to
+ associate application-specific data with each node as needed.</P>
+<P>New nodes are created using the <A href="#mxmlNewElement"><TT>
+mxmlNewElement</TT></A>, <A href="#mxmlNewInteger"><TT>mxmlNewInteger</TT>
+</A>, <A href="#mxmlNewOpaque"><TT>mxmlNewOpaque</TT></A>, <A href="#mxmlNewReal">
+<TT>mxmlNewReal</TT></A>, <A href="#mxmlNewText"><TT>mxmlNewText</TT></A>
+ <A href="#mxmlNewTextf"><TT>mxmlNewTextf</TT></A> <A href="#mxmlNewXML">
+<TT>mxmlNewXML</TT></A> functions. Only elements can have child nodes,
+ and the top node must be an element, usually the <TT>&lt;?xml
+ version=&quot;1.0&quot;?&gt;</TT> node created by <TT>mxmlNewXML()</TT>.</P>
+<P>Nodes have pointers to the node above (<TT>parent</TT>), below (<TT>
+child</TT>), left (<TT>prev</TT>), and right (<TT>next</TT>) of the
+ current node. If you have an XML file like the following:</P>
+<PRE>
+ &lt;?xml version=&quot;1.0&quot;?&gt;
+ &lt;data&gt;
+ &lt;node&gt;val1&lt;/node&gt;
+ &lt;node&gt;val2&lt;/node&gt;
+ &lt;node&gt;val3&lt;/node&gt;
+ &lt;group&gt;
+ &lt;node&gt;val4&lt;/node&gt;
+ &lt;node&gt;val5&lt;/node&gt;
+ &lt;node&gt;val6&lt;/node&gt;
+ &lt;/group&gt;
+ &lt;node&gt;val7&lt;/node&gt;
+ &lt;node&gt;val8&lt;/node&gt;
+ &lt;/data&gt;
+</PRE>
+<P>the node tree for the file would look like the following in memory:</P>
+<PRE>
+ ?xml
+ |
+ data
+ |
+ node - node - node - group - node - node
+ | | | | | |
+ val1 val2 val3 | val7 val8
+ |
+ node - node - node
+ | | |
+ val4 val5 val6
+</PRE>
+<P>where &quot;-&quot; is a pointer to the next node and &quot;|&quot; is a pointer to the
+ first child node.</P>
+<P>Once you are done with the XML data, use the <A href="#mxmlDelete"><TT>
+mxmlDelete</TT></A> function to recursively free the memory that is used
+ for a particular node or the entire tree:</P>
+<PRE>
+ mxmlDelete(tree);
+</PRE>
+
+<!-- NEW PAGE -->
+<H2><A NAME="3_3">Creating XML Documents</A></H2>
+<P>You can create and update XML documents in memory using the various <TT>
+mxmlNew</TT> functions. The following code will create the XML document
+ described in the previous section:</P>
+<PRE>
+ mxml_node_t *xml; /* &lt;?xml ... ?&gt; */
+ mxml_node_t *data; /* &lt;data&gt; */
+ mxml_node_t *node; /* &lt;node&gt; */
+ mxml_node_t *group; /* &lt;group&gt; */
+
+ xml = mxmlNewXML(&quot;1.0&quot;);
+
+ data = mxmlNewElement(xml, &quot;data&quot;);
+
+ node = mxmlNewElement(data, &quot;node&quot;);
+ mxmlNewText(node, 0, &quot;val1&quot;);
+ node = mxmlNewElement(data, &quot;node&quot;);
+ mxmlNewText(node, 0, &quot;val2&quot;);
+ node = mxmlNewElement(data, &quot;node&quot;);
+ mxmlNewText(node, 0, &quot;val3&quot;);
+
+ group = mxmlNewElement(data, &quot;group&quot;);
+
+ node = mxmlNewElement(group, &quot;node&quot;);
+ mxmlNewText(node, 0, &quot;val4&quot;);
+ node = mxmlNewElement(group, &quot;node&quot;);
+ mxmlNewText(node, 0, &quot;val5&quot;);
+ node = mxmlNewElement(group, &quot;node&quot;);
+ mxmlNewText(node, 0, &quot;val6&quot;);
+
+ node = mxmlNewElement(data, &quot;node&quot;);
+ mxmlNewText(node, 0, &quot;val7&quot;);
+ node = mxmlNewElement(data, &quot;node&quot;);
+ mxmlNewText(node, 0, &quot;val8&quot;);
+</PRE>
+<P>We start by creating the <TT>&lt;?xml version=&quot;1.0&quot;?&gt;</TT> node common
+ to all XML files using the <A href="#mxmlNewXML"><TT>mxmlNewXML</TT></A>
+ function:</P>
+<PRE>
+ xml = mxmlNewXML(&quot;1.0&quot;);
+</PRE>
+<P>We then create the <TT>&lt;data&gt;</TT> node used for this document using
+ the <A href="#mxmlNewElement"><TT>mxmlNewElement</TT></A> function. The
+ first argument specifies the parent node (<TT>xml</TT>) while the
+ second specifies the element name (<TT>data</TT>):</P>
+<PRE>
+ data = mxmlNewElement(xml, &quot;data&quot;);
+</PRE>
+<P>Each <TT>&lt;node&gt;...&lt;/node&gt;</TT> in the file is created using the <TT>
+mxmlNewElement</TT> and <A href="#mxmlNewText"><TT>mxmlNewText</TT></A>
+ functions. The first argument of <TT>mxmlNewText</TT> specifies the
+ parent node (<TT>node</TT>). The second argument specifies whether
+ whitespace appears before the text - 0 or false in this case. The last
+ argument specifies the actual text to add:</P>
+<PRE>
+ node = mxmlNewElement(data, &quot;node&quot;);
+ mxmlNewText(node, 0, &quot;val1&quot;);
+</PRE>
+<P>The resulting in-memory XML document can then be saved or processed
+ just like one loaded from disk or a string.</P>
+
+<!-- NEW PAGE -->
+<H2><A NAME="3_4">Loading XML</A></H2>
+<P>You load an XML file using the <A href="#mxmlLoadFile"><TT>
+mxmlLoadFile</TT></A> function:</P>
+<PRE>
+ FILE *fp;
+ mxml_node_t *tree;
+
+ fp = fopen(&quot;filename.xml&quot;, &quot;r&quot;);
+ tree = mxmlLoadFile(NULL, fp,
+ MXML_TEXT_CALLBACK);
+ fclose(fp);
+</PRE>
+<P>The first argument specifies an existing XML parent node, if any.
+ Normally you will pass <TT>NULL</TT> for this argument unless you are
+ combining multiple XML sources. The XML file must contain a complete
+ XML document including the <TT>?xml</TT> element if the parent node is <TT>
+NULL</TT>.</P>
+<P>The second argument specifies the stdio file to read from, as opened
+ by <TT>fopen()</TT> or <TT>popen()</TT>. You can also use <TT>stdin</TT>
+ if you are implementing an XML filter program.</P>
+<P>The third argument specifies a callback function which returns the
+ value type of the immediate children for a new element node: <TT>
+MXML_CUSTOM</TT>, <TT>MXML_IGNORE</TT>, <TT>MXML_INTEGER</TT>, <TT>
+MXML_OPAQUE</TT>, <TT>MXML_REAL</TT>, or <TT>MXML_TEXT</TT>. Load
+ callbacks are described in detail in <A href="#LOAD_CALLBACKS">Chapter
+ 3</A>. The example code uses the <TT>MXML_TEXT_CALLBACK</TT> constant
+ which specifies that all data nodes in the document contain
+ whitespace-separated text values. Other standard callbacks include <TT>
+MXML_IGNORE_CALLBACK</TT>, <TT>MXML_INTEGER_CALLBACK</TT>, <TT>
+MXML_OPAQUE_CALLBACK</TT>, and <TT>MXML_REAL_CALLBACK</TT>.</P>
+<P>The <A href="#mxmlLoadString"><TT>mxmlLoadString</TT></A> function
+ loads XML node trees from a string:</P>
+
+<!-- NEED 10 -->
+<PRE>
+ char buffer[8192];
+ mxml_node_t *tree;
+
+ ...
+ tree = mxmlLoadString(NULL, buffer,
+ MXML_TEXT_CALLBACK);
+</PRE>
+<P>The first and third arguments are the same as used for <TT>
+mxmlLoadFile()</TT>. The second argument specifies the string or
+ character buffer to load and must be a complete XML document including
+ the <TT>?xml</TT> element if the parent node is <TT>NULL</TT>.</P>
+
+<!-- NEW PAGE -->
+<H2><A NAME="3_5">Saving XML</A></H2>
+<P>You save an XML file using the <A href="#mxmlSaveFile"><TT>
+mxmlSaveFile</TT></A> function:</P>
+<PRE>
+ FILE *fp;
+ mxml_node_t *tree;
+
+ fp = fopen(&quot;filename.xml&quot;, &quot;w&quot;);
+ mxmlSaveFile(tree, fp, MXML_NO_CALLBACK);
+ fclose(fp);
+</PRE>
+<P>The first argument is the XML node tree to save. It should normally
+ be a pointer to the top-level <TT>?xml</TT> node in your XML document.</P>
+<P>The second argument is the stdio file to write to, as opened by <TT>
+fopen()</TT> or <TT>popen()</TT>. You can also use <TT>stdout</TT> if
+ you are implementing an XML filter program.</P>
+<P>The third argument is the whitespace callback to use when saving the
+ file. Whitespace callbacks are covered in detail in <A href="SAVE_CALLBACKS">
+Chapter 3</A>. The previous example code uses the <TT>MXML_NO_CALLBACK</TT>
+ constant to specify that no special whitespace handling is required.</P>
+<P>The <A href="#mxmlSaveAllocString"><TT>mxmlSaveAllocString</TT></A>,
+ and <A href="#mxmlSaveString"><TT>mxmlSaveString</TT></A> functions
+ save XML node trees to strings:</P>
+<PRE>
+ char buffer[8192];
+ char *ptr;
+ mxml_node_t *tree;
+
+ ...
+ mxmlSaveString(tree, buffer, sizeof(buffer),
+ MXML_NO_CALLBACK);
+
+ ...
+ ptr = mxmlSaveAllocString(tree, MXML_NO_CALLBACK);
+</PRE>
+<P>The first and last arguments are the same as used for <TT>
+mxmlSaveFile()</TT>. The <TT>mxmlSaveString</TT> function takes pointer
+ and size arguments for saving the XML document to a fixed-size buffer,
+ while <TT>mxmlSaveAllocString()</TT> returns a string buffer that was
+ allocated using <TT>malloc()</TT>.</P>
+<H3><A NAME="3_5_1">Controlling Line Wrapping</A></H3>
+<P>When saving XML documents, Mini-XML normally wraps output lines at
+ column 75 so that the text is readable in terminal windows. The <A href="#mxmlSetWrapMargin">
+<TT>mxmlSetWrapMargin</TT></A> function overrides the default wrap
+ margin:</P>
+<PRE>
+ /* Set the margin to 132 columns */
+ mxmlSetWrapMargin(132);
+
+ /* Disable wrapping */
+ mxmlSetWrapMargin(0);
+</PRE>
+
+<!-- NEW PAGE-->
+<H2><A NAME="3_6">Finding and Iterating Nodes</A></H2>
+<P>The <A href="#mxmlWalkPrev"><TT>mxmlWalkPrev</TT></A> and <A href="#mxmlWalkNext">
+<TT>mxmlWalkNext</TT></A>functions can be used to iterate through the
+ XML node tree:</P>
+<PRE>
+ mxml_node_t *node;
+
+ node = mxmlWalkPrev(current, tree,
+ MXML_DESCEND);
+
+ node = mxmlWalkNext(current, tree,
+ MXML_DESCEND);
+</PRE>
+<P>In addition, you can find a named element/node using the <A href="#mxmlFindElement">
+<TT>mxmlFindElement</TT></A> function:</P>
+<PRE>
+ mxml_node_t *node;
+
+ node = mxmlFindElement(tree, tree, &quot;name&quot;,
+ &quot;attr&quot;, &quot;value&quot;,
+ MXML_DESCEND);
+</PRE>
+<P>The <TT>name</TT>, <TT>attr</TT>, and <TT>value</TT> arguments can be
+ passed as <TT>NULL</TT> to act as wildcards, e.g.:</P>
+
+<!-- NEED 4 -->
+<PRE>
+ /* Find the first &quot;a&quot; element */
+ node = mxmlFindElement(tree, tree, &quot;a&quot;,
+ NULL, NULL,
+ MXML_DESCEND);
+</PRE>
+
+<!-- NEED 5 -->
+<PRE>
+ /* Find the first &quot;a&quot; element with &quot;href&quot;
+ attribute */
+ node = mxmlFindElement(tree, tree, &quot;a&quot;,
+ &quot;href&quot;, NULL,
+ MXML_DESCEND);
+</PRE>
+
+<!-- NEED 6 -->
+<PRE>
+ /* Find the first &quot;a&quot; element with &quot;href&quot;
+ to a URL */
+ node = mxmlFindElement(tree, tree, &quot;a&quot;,
+ &quot;href&quot;,
+ &quot;http://www.easysw.com/&quot;,
+ MXML_DESCEND);
+</PRE>
+
+<!-- NEED 5 -->
+<PRE>
+ /* Find the first element with a &quot;src&quot;
+ attribute */
+ node = mxmlFindElement(tree, tree, NULL,
+ &quot;src&quot;, NULL,
+ MXML_DESCEND);
+</PRE>
+
+<!-- NEED 5 -->
+<PRE>
+ /* Find the first element with a &quot;src&quot;
+ = &quot;foo.jpg&quot; */
+ node = mxmlFindElement(tree, tree, NULL,
+ &quot;src&quot;, &quot;foo.jpg&quot;,
+ MXML_DESCEND);
+</PRE>
+<P>You can also iterate with the same function:</P>
+<PRE>
+ mxml_node_t *node;
+
+ for (node = mxmlFindElement(tree, tree,
+ &quot;name&quot;,
+ NULL, NULL,
+ MXML_DESCEND);
+ node != NULL;
+ node = mxmlFindElement(node, tree,
+ &quot;name&quot;,
+ NULL, NULL,
+ MXML_DESCEND))
+ {
+ ... do something ...
+ }
+</PRE>
+
+<!-- NEED 10 -->
+<P>The <TT>MXML_DESCEND</TT> argument can actually be one of three
+ constants:</P>
+<UL>
+<LI><TT>MXML_NO_DESCEND</TT> means to not to look at any child nodes in
+ the element hierarchy, just look at siblings at the same level or
+ parent nodes until the top node or top-of-tree is reached.
+<P>The previous node from &quot;group&quot; would be the &quot;node&quot; element to the
+ left, while the next node from &quot;group&quot; would be the &quot;node&quot; element to
+ the right.
+<BR>
+<BR></P>
+</LI>
+<LI><TT>MXML_DESCEND_FIRST</TT> means that it is OK to descend to the
+ first child of a node, but not to descend further when searching.
+ You'll normally use this when iterating through direct children of a
+ parent node, e.g. all of the &quot;node&quot; and &quot;group&quot; elements under the
+ &quot;?xml&quot; parent node in the example above.
+<P>This mode is only applicable to the search function; the walk
+ functions treat this as <TT>MXML_DESCEND</TT> since every call is a
+ first time.
+<BR>
+<BR></P>
+</LI>
+<LI><TT>MXML_DESCEND</TT> means to keep descending until you hit the
+ bottom of the tree. The previous node from &quot;group&quot; would be the &quot;val3&quot;
+ node and the next node would be the first node element under &quot;group&quot;.
+<P>If you were to walk from the root node &quot;?xml&quot; to the end of the tree
+ with <TT>mxmlWalkNext()</TT>, the order would be:</P>
+<P><TT>?xml data node val1 node val2 node val3 group node val4 node val5
+ node val6 node val7 node val8</TT></P>
+<P>If you started at &quot;val8&quot; and walked using <TT>mxmlWalkPrev()</TT>,
+ the order would be reversed, ending at &quot;?xml&quot;.</P>
+</LI>
+</UL>
+<HR NOSHADE>
+<H1 align="right"><A name="ADVANCED"><IMG align="right" alt="3" height="100"
+hspace="10" src="3.gif" width="100"></A>More Mini-XML Programming
+ Techniques</H1>
+<P>This chapter shows additional ways to use the Mini-XML library in
+ your programs.</P>
+<H2><A name="LOAD_CALLBACKS">Load Callbacks</A></H2>
+<P><A href="#LOAD_XML">Chapter 2</A> introduced the <A href="#mxmlLoadFile">
+<TT>mxmlLoadFile()</TT></A> and <A href="#mxmlLoadString"><TT>
+mxmlLoadString()</TT></A> functions. The last argument to these
+ functions is a callback function which is used to determine the value
+ type of each data node in an XML document.</P>
+<P>Mini-XML defines several standard callbacks for simple XML data
+ files:</P>
+<UL>
+<LI><TT>MXML_INTEGER_CALLBACK</TT> - All data nodes contain
+ whitespace-separated integers.</LI>
+<LI><TT>MXML_OPAQUE_CALLBACK</TT> - All data nodes contain opaque
+ strings (&quot;CDATA&quot;).</LI>
+<LI><TT>MXML_REAL_CALLBACK</TT> - All data nodes contain
+ whitespace-separated floating-point numbers.</LI>
+<LI><TT>MXML_TEXT_CALLBACK</TT> - All data nodes contain
+ whitespace-separated strings.</LI>
+</UL>
+<P>You can provide your own callback functions for more complex XML
+ documents. Your callback function will receive a pointer to the current
+ element node and must return the value type of the immediate children
+ for that element node: <TT>MXML_INTEGER</TT>, <TT>MXML_OPAQUE</TT>, <TT>
+MXML_REAL</TT>, or <TT>MXML_TEXT</TT>. The function is called<I> after</I>
+ the element and its attributes have been read, so you can look at the
+ element name, attributes, and attribute values to determine the proper
+ value type to return.</P>
+
+<!-- NEED 2in -->
+<P>The following callback function looks for an attribute named &quot;type&quot;
+ or the element name to determine the value type for its child nodes:</P>
+<PRE>
+ mxml_type_t
+ type_cb(mxml_node_t *node)
+ {
+ const char *type;
+
+ /*
+ * You can lookup attributes and/or use the
+ * element name, hierarchy, etc...
+ */
+
+ type = mxmlElementGetAttr(node, &quot;type&quot;);
+ if (type == NULL)
+ type = node-&gt;value.element.name;
+
+ if (!strcmp(type, &quot;integer&quot;))
+ return (MXML_INTEGER);
+ else if (!strcmp(type, &quot;opaque&quot;))
+ return (MXML_OPAQUE);
+ else if (!strcmp(type, &quot;real&quot;))
+ return (MXML_REAL);
+ else
+ return (MXML_TEXT);
+ }
+</PRE>
+<P>To use this callback function, simply use the name when you call any
+ of the load functions:</P>
+<PRE>
+ FILE *fp;
+ mxml_node_t *tree;
+
+ fp = fopen(&quot;filename.xml&quot;, &quot;r&quot;);
+ tree = mxmlLoadFile(NULL, fp, <B>type_cb</B>);
+ fclose(fp);
+</PRE>
+<H2><A name="SAVE_CALLBACKS">Save Callbacks</A></H2>
+<P><A href="#LOAD_XML">Chapter 2</A> also introduced the <A href="#mxmlSaveFile">
+<TT>mxmlSaveFile()</TT></A>, <A href="#mxmlSaveString"><TT>
+mxmlSaveString()</TT></A>, and <A href="#mxmlSaveAllocString"><TT>
+mxmlSaveAllocString()</TT></A> functions. The last argument to these
+ functions is a callback function which is used to automatically insert
+ whitespace in an XML document.</P>
+<P>Your callback function will be called up to four times for each
+ element node with a pointer to the node and a &quot;where&quot; value of <TT>
+MXML_WS_BEFORE_OPEN</TT>, <TT>MXML_WS_AFTER_OPEN</TT>, <TT>
+MXML_WS_BEFORE_CLOSE</TT>, or <TT>MXML_WS_AFTER_CLOSE</TT>. The callback
+ function should return <TT>NULL</TT> if no whitespace should be added
+ and the string to insert (spaces, tabs, carriage returns, and newlines)
+ otherwise.</P>
+<P>The following whitespace callback can be used to add whitespace to
+ XHTML output to make it more readable in a standard text editor:</P>
+<PRE>
+ const char *
+ whitespace_cb(mxml_node_t *node,
+ int where)
+ {
+ const char *name;
+
+ /*
+ * We can conditionally break to a new line
+ * before or after any element. These are
+ * just common HTML elements...
+ */
+
+ name = node-&gt;value.element.name;
+
+ if (!strcmp(name, &quot;html&quot;) ||
+ !strcmp(name, &quot;head&quot;) ||
+ !strcmp(name, &quot;body&quot;) ||
+ !strcmp(name, &quot;pre&quot;) ||
+ !strcmp(name, &quot;p&quot;) ||
+ !strcmp(name, &quot;h1&quot;) ||
+ !strcmp(name, &quot;h2&quot;) ||
+ !strcmp(name, &quot;h3&quot;) ||
+ !strcmp(name, &quot;h4&quot;) ||
+ !strcmp(name, &quot;h5&quot;) ||
+ !strcmp(name, &quot;h6&quot;))
+ {
+ /*
+ * Newlines before open and after
+ * close...
+ */
+
+ if (where == MXML_WS_BEFORE_OPEN ||
+ where == MXML_WS_AFTER_CLOSE)
+ return (&quot;\n&quot;);
+ }
+ else if (!strcmp(name, &quot;dl&quot;) ||
+ !strcmp(name, &quot;ol&quot;) ||
+ !strcmp(name, &quot;ul&quot;))
+ {
+ /*
+ * Put a newline before and after list
+ * elements...
+ */
+
+ return (&quot;\n&quot;);
+ }
+ else if (!strcmp(name, &quot;dd&quot;) ||
+ !strcmp(name, &quot;dt&quot;) ||
+ !strcmp(name, &quot;li&quot;))
+ {
+ /*
+ * Put a tab before &lt;li&gt;'s, * &lt;dd&gt;'s,
+ * and &lt;dt&gt;'s, and a newline after them...
+ */
+
+ if (where == MXML_WS_BEFORE_OPEN)
+ return (&quot;\t&quot;);
+ else if (where == MXML_WS_AFTER_CLOSE)
+ return (&quot;\n&quot;);
+ }
+
+ /*
+ * Return NULL for no added whitespace...
+ */
+
+ return (NULL);
+ }
+</PRE>
+<P>To use this callback function, simply use the name when you call any
+ of the save functions:</P>
+<PRE>
+ FILE *fp;
+ mxml_node_t *tree;
+
+ fp = fopen(&quot;filename.xml&quot;, &quot;w&quot;);
+ mxmlSaveFile(tree, fp, <B>whitespace_cb</B>);
+ fclose(fp);
+</PRE>
+
+<!-- NEED 10 -->
+<H2><A NAME="4_3">Custom Data Types</A></H2>
+<P>Mini-XML supports custom data types via global load and save
+ callbacks. Only a single set of callbacks can be active at any time,
+ however your callbacks can store additional information in order to
+ support multiple custom data types as needed. The <TT>MXML_CUSTOM</TT>
+ node type identifies custom data nodes.</P>
+<P>The load callback receives a pointer to the current data node and a
+ string of opaque character data from the XML source with character
+ entities converted to the corresponding UTF-8 characters. For example,
+ if we wanted to support a custom date/time type whose value is encoded
+ as &quot;yyyy-mm-ddThh:mm:ssZ&quot; (ISO format), the load callback would look
+ like the following:</P>
+<PRE>
+ typedef struct
+ {
+ unsigned year, /* Year */
+ month, /* Month */
+ day, /* Day */
+ hour, /* Hour */
+ minute, /* Minute */
+ second; /* Second */
+ time_t unix; /* UNIX time */
+ } iso_date_time_t;
+
+ int
+ load_custom(mxml_node_t *node,
+ const char *data)
+ {
+ iso_date_time_t *dt;
+ struct tm tmdata;
+
+ /*
+ * Allocate data structure...
+ */
+
+ dt = calloc(1, sizeof(iso_date_time_t));
+
+ /*
+ * Try reading 6 unsigned integers from the
+ * data string...
+ */
+
+ if (sscanf(data, &quot;%u-%u-%uT%u:%u:%uZ&quot;,
+ &amp;(dt-&gt;year), &amp;(dt-&gt;month),
+ &amp;(dt-&gt;day), &amp;(dt-&gt;hour),
+ &amp;(dt-&gt;minute),
+ &amp;(dt-&gt;second)) != 6)
+ {
+ /*
+ * Unable to read numbers, free the data
+ * structure and return an error...
+ */
+
+ free(dt);
+
+ return (-1);
+ }
+
+ /*
+ * Range check values...
+ */
+
+ if (dt-&gt;month &lt;1 || dt-&gt;month &gt; 12 ||
+ dt-&gt;day &lt;1 || dt-&gt;day &gt; 31 ||
+ dt-&gt;hour &lt;0 || dt-&gt;hour &gt; 23 ||
+ dt-&gt;minute &lt;0 || dt-&gt;minute &gt; 59 ||
+ dt-&gt;second &lt;0 || dt-&gt;second &gt; 59)
+ {
+ /*
+ * Date information is out of range...
+ */
+
+ free(dt);
+
+ return (-1);
+ }
+
+ /*
+ * Convert ISO time to UNIX time in
+ * seconds...
+ */
+
+ tmdata.tm_year = dt-&gt;year - 1900;
+ tmdata.tm_mon = dt-&gt;month - 1;
+ tmdata.tm_day = dt-&gt;day;
+ tmdata.tm_hour = dt-&gt;hour;
+ tmdata.tm_min = dt-&gt;minute;
+ tmdata.tm_sec = dt-&gt;second;
+
+ dt-&gt;unix = gmtime(&amp;tmdata);
+
+ /*
+ * Assign custom node data and destroy
+ * function pointers...
+ */
+
+ node-&gt;value.custom.data = dt;
+ node-&gt;value.custom.destroy = free;
+
+ /*
+ * Return with no errors...
+ */
+
+ return (0);
+ }
+</PRE>
+<P>The function itself can return 0 on success or -1 if it is unable to
+ decode the custom data or the data contains an error. Custom data nodes
+ contain a <TT>void</TT> pointer to the allocated custom data for the
+ node and a pointer to a destructor function which will free the custom
+ data when the node is deleted.</P>
+<P>The save callback receives the node pointer and returns an allocated
+ string containing the custom data value. The following save callback
+ could be used for our ISO date/time type:</P>
+<PRE>
+ char *
+ save_custom(mxml_node_t *node)
+ {
+ char data[255];
+ iso_date_time_t *dt;
+
+
+ dt = (iso_date_time_t *)node-&gt;custom.data;
+
+ snprintf(data, sizeof(data),
+ &quot;%04u-%02u-%02uT%02u:%02u:%02uZ&quot;,
+ dt-&gt;year, dt-&gt;month, dt-&gt;day,
+ dt-&gt;hour, dt-&gt;minute, dt-&gt;second);
+
+ return (strdup(data));
+ }
+</PRE>
+<P>You register the callback functions using the <A href="#mxmlSetCustomHandlers">
+<TT>mxmlSetCustomHandlers()</TT></A> function:</P>
+<PRE>
+ mxmlSetCustomHandlers(<B>load_custom</B>,
+ <B>save_custom</B>);
+</PRE>
+
+<!-- NEED 20 -->
+<H2><A NAME="4_4">Changing Node Values</A></H2>
+<P>All of the examples so far have concentrated on creating and loading
+ new XML data nodes. Many applications, however, need to manipulate or
+ change the nodes during their operation, so Mini-XML provides functions
+ to change node values safely and without leaking memory.</P>
+<P>Existing nodes can be changed using the <A href="#mxmlSetElement"><TT>
+mxmlSetElement()</TT></A>, <A href="#mxmlSetInteger"><TT>
+mxmlSetInteger()</TT></A>, <A href="#mxmlSetOpaque"><TT>mxmlSetOpaque()</TT>
+</A>, <A href="#mxmlSetReal"><TT>mxmlSetReal()</TT></A>, <A href="#mxmlSetText">
+<TT>mxmlSetText()</TT></A>, and <A href="#mxmlSetTextf"><TT>
+mxmlSetTextf()</TT></A> functions. For example, use the following
+ function call to change a text node to contain the text &quot;new&quot; with
+ leading whitespace:</P>
+<PRE>
+ mxml_node_t *node;
+
+ mxmlSetText(node, 1, &quot;new&quot;);
+</PRE>
+<H2><A NAME="4_5">Formatted Text</A></H2>
+<P>The <A href="#mxmlNewTextf"><TT>mxmlNewTextf()</TT></A> and <A href="#mxmlSetTextf">
+<TT>mxmlSetTextf()</TT></A> functions create and change text nodes,
+ respectively, using <TT>printf</TT>-style format strings and arguments.
+ For example, use the following function call to create a new text node
+ containing a constructed filename:</P>
+<PRE>
+ mxml_node_t *node;
+
+ node = mxmlNewTextf(node, 1, &quot;%s/%s&quot;,
+ path, filename);
+</PRE>
+<H2><A NAME="4_6">Indexing</A></H2>
+<P>Mini-XML provides functions for managing indices of nodes. The
+ current implementation provides the same functionality as <A href="#mxmlFindElement">
+<TT>mxmlFindElement()</TT></A>. The advantage of using an index is that
+ searching and enumeration of elements is significantly faster. The only
+ disadvantage is that each index is a static snapshot of the XML
+ document, so indices are not well suited to XML data that is updated
+ more often than it is searched. The overhead of creating an index is
+ approximately equal to walking the XML document tree. Nodes in the
+ index are sorted by element name and attribute value.</P>
+<P>Indices are stored in <A href="#mxml_index_t"><TT>mxml_index_t</TT></A>
+ structures. The <A href="#mxmlIndexNew"><TT>mxmlIndexNew()</TT></A>
+ function creates a new index:</P>
+<PRE>
+ mxml_node_t *tree;
+ mxml_index_t *ind;
+
+ ind = mxmlIndexNew(tree, &quot;element&quot;,
+ &quot;attribute&quot;);
+</PRE>
+<P>The first argument is the XML node tree to index. Normally this will
+ be a pointer to the <TT>?xml</TT> element.</P>
+<P>The second argument contains the element to index; passing <TT>NULL</TT>
+ indexes all element nodes alphabetically.</P>
+<P>The third argument contains the attribute to index; passing <TT>NULL</TT>
+ causes only the element name to be indexed.</P>
+<P>Once the index is created, the <A href="#mxmlIndexEnum"><TT>
+mxmlIndexEnum()</TT></A>, <A href="#mxmlIndexFind"><TT>mxmlIndexFind()</TT>
+</A>, and <A href="#mxmlIndexReset"><TT>mxmlIndexReset()</TT></A>
+ functions are used to access the nodes in the index. The <A href="#mxmlIndexReset">
+<TT>mxmlIndexReset()</TT></A> function resets the &quot;current&quot; node pointer
+ in the index, allowing you to do new searches and enumerations on the
+ same index. Typically you will call this function prior to your calls
+ to <A href="#mxmlIndexEnum"><TT>mxmlIndexEnum()</TT></A> and <A href="#mxmlIndexFind">
+<TT>mxmlIndexFind()</TT></A>.</P>
+<P>The <A href="#mxmlIndexEnum"><TT>mxmlIndexEnum()</TT></A> function
+ enumerates each of the nodes in the index and can be used in a loop as
+ follows:</P>
+<PRE>
+ mxml_node_t *node;
+
+ mxmlIndexReset(ind);
+
+ while ((node = mxmlIndexEnum(ind)) != NULL)
+ {
+ // do something with node
+ }
+</PRE>
+<P>The <A href="#mxmlIndexFind"><TT>mxmlIndexFind()</TT></A> function
+ locates the next occurrence of the named element and attribute value in
+ the index. It can be used to find all matching elements in an index, as
+ follows:</P>
+<PRE>
+ mxml_node_t *node;
+
+ mxmlIndexReset(ind);
+
+ while ((node = mxmlIndexFind(ind, &quot;element&quot;,
+ &quot;attr-value&quot;))
+ != NULL)
+ {
+ // do something with node
+ }
+</PRE>
+<P>The second and third arguments represent the element name and
+ attribute value, respectively. A <TT>NULL</TT> pointer is used to
+ return all elements or attributes in the index. Passing <TT>NULL</TT>
+ for both the element name and attribute value is equivalent to calling <TT>
+mxmlIndexEnum</TT>.</P>
+<P>When you are done using the index, delete it using the <A href="#mxmlIndexDelete()">
+<TT>mxmlIndexDelete()</TT></A> function:</P>
+<PRE>
+ mxmlIndexDelete(ind);
+</PRE>
+<H2><A NAME="4_7">SAX (Stream) Loading of Documents</A></H2>
+<P>Mini-XML supports an implementation of the Simple API for XML (SAX)
+ which allows you to load and process an XML document as a stream of
+ nodes. Aside from allowing you to process XML documents of any size,
+ the Mini-XML implementation also allows you to retain portions of the
+ document in memory for later processing.</P>
+<P>The <A href="#mxmlSAXLoad"><TT>mxmlSAXLoadFd</TT></A>, <A href="#mxmlSAXLoadFile">
+<TT>mxmlSAXLoadFile</TT></A>, and <A href="#mxmlSAXLoadString"><TT>
+mxmlSAXLoadString</TT></A> functions provide the SAX loading APIs. Each
+ function works like the corresponding <TT>mxmlLoad</TT> function but
+ uses a callback to process each node as it is read.</P>
+<P>The callback function receives the node, an event code, and a user
+ data pointer you supply:</P>
+<PRE>
+ void
+ sax_cb(mxml_node_t *node,
+ mxml_sax_event_t event,
+ void *data)
+ {
+ ... do something ...
+ }
+</PRE>
+<P>The event will be one of the following:</P>
+<UL>
+<LI><TT>MXML_SAX_CDATA</TT> - CDATA was just read</LI>
+<LI><TT>MXML_SAX_COMMENT</TT> - A comment was just read</LI>
+<LI><TT>MXML_SAX_DATA</TT> - Data (custom, integer, opaque, real, or
+ text) was just read</LI>
+<LI><TT>MXML_SAX_DIRECTIVE</TT> - A processing directive was just read</LI>
+<LI><TT>MXML_SAX_ELEMENT_CLOSE</TT> - A close element was just read (<TT>
+&lt;/element&gt;</TT>)</LI>
+<LI><TT>MXML_SAX_ELEMENT_OPEN</TT> - An open element was just read (<TT>
+&lt;element&gt;</TT>)</LI>
+</UL>
+<P>Elements are<EM> released</EM> after the close element is processed.
+ All other nodes are released after they are processed. The SAX callback
+ can<EM> retain</EM> the node using the <A href="#mxmlRetain"><TT>
+mxmlRetain</TT></A> function. For example, the following SAX callback
+ will retain all nodes, effectively simulating a normal in-memory load:</P>
+<PRE>
+ void
+ sax_cb(mxml_node_t *node,
+ mxml_sax_event_t event,
+ void *data)
+ {
+ if (event != MXML_SAX_ELEMENT_CLOSE)
+ mxmlRetain(node);
+ }
+</PRE>
+<P>More typically the SAX callback will only retain a small portion of
+ the document that is needed for post-processing. For example, the
+ following SAX callback will retain the title and headings in an XHTML
+ file. It also retains the (parent) elements like <TT>&lt;html&gt;</TT>, <TT>
+&lt;head&gt;</TT>, and <TT>&lt;body&gt;</TT>, and processing directives like <TT>
+&lt;?xml ... ?&gt;</TT> and <TT>&lt;!DOCTYPE ... &gt;</TT>:</P>
+
+<!-- NEED 10 -->
+<PRE>
+ void
+ sax_cb(mxml_node_t *node,
+ mxml_sax_event_t event,
+ void *data)
+ {
+ if (event == MXML_SAX_ELEMENT_OPEN)
+ {
+ /*
+ * Retain headings and titles...
+ */
+
+ char *name = node-&gt;value.element.name;
+
+ if (!strcmp(name, &quot;html&quot;) ||
+ !strcmp(name, &quot;head&quot;) ||
+ !strcmp(name, &quot;title&quot;) ||
+ !strcmp(name, &quot;body&quot;) ||
+ !strcmp(name, &quot;h1&quot;) ||
+ !strcmp(name, &quot;h2&quot;) ||
+ !strcmp(name, &quot;h3&quot;) ||
+ !strcmp(name, &quot;h4&quot;) ||
+ !strcmp(name, &quot;h5&quot;) ||
+ !strcmp(name, &quot;h6&quot;))
+ mxmlRetain(node);
+ }
+ else if (event == MXML_SAX_DIRECTIVE)
+ mxmlRetain(node);
+ else if (event == MXML_SAX_DATA &amp;&amp;
+ node-&gt;parent-&gt;ref_count &gt; 1)
+ {
+ /*
+ * If the parent was retained, then retain
+ * this data node as well.
+ */
+
+ mxmlRetain(node);
+ }
+ }
+</PRE>
+<P>The resulting skeleton document tree can then be searched just like
+ one loaded using the <TT>mxmlLoad</TT> functions. For example, a filter
+ that reads an XHTML document from stdin and then shows the title and
+ headings in the document would look like:</P>
+<PRE>
+ mxml_node_t *doc, *title, *body, *heading;
+
+ doc = mxmlSAXLoadFd(NULL, 0,
+ MXML_TEXT_CALLBACK,
+ <B>sax_cb</B>, NULL);
+
+ title = mxmlFindElement(doc, doc, &quot;title&quot;,
+ NULL, NULL,
+ MXML_DESCEND);
+
+ if (title)
+ print_children(title);
+
+ body = mxmlFindElement(doc, doc, &quot;body&quot;,
+ NULL, NULL,
+ MXML_DESCEND);
+
+ if (body)
+ {
+ for (heading = body-&gt;child;
+ heading;
+ heading = heading-&gt;next)
+ print_children(heading);
+ }
+</PRE>
+<HR NOSHADE>
+<H1 align="right"><A name="MXMLDOC"><IMG align="right" alt="4" height="100"
+hspace="10" src="4.gif" width="100"></A>Using the mxmldoc Utility</H1>
+<P>This chapter describes how to use <TT>mxmldoc(1)</TT> program to
+ automatically generate documentation from C and C++ source files.</P>
+<H2><A NAME="5_1">The Basics</A></H2>
+<P>Originally developed to generate the Mini-XML and CUPS API
+ documentation, <TT>mxmldoc</TT> is now a general-purpose utility which
+ scans C and C++ source files to produce HTML and man page documentation
+ along with an XML file representing the functions, types, and
+ definitions in those source files. Unlike popular documentation
+ generators like Doxygen or Javadoc, <TT>mxmldoc</TT> uses in-line
+ comments rather than comment headers, allowing for more &quot;natural&quot; code
+ documentation.</P>
+<P>By default, <TT>mxmldoc</TT> produces HTML documentation. For
+ example, the following command will scan all of the C source and header
+ files in the current directory and produce a HTML documentation file
+ called<VAR> filename.html</VAR>:</P>
+<PRE>
+ <KBD>mxmldoc *.h *.c &gt;filename.html ENTER</KBD>
+</PRE>
+<P>You can also specify an XML file to create which contains all of the
+ information from the source files. For example, the following command
+ creates an XML file called<VAR> filename.xml</VAR> in addition to the
+ HTML file:</P>
+<PRE>
+ <KBD>mxmldoc filename.xml *.h *.c &gt;filename.html ENTER</KBD>
+</PRE>
+<P>The <TT>--no-output</TT> option disables the normal HTML output:</P>
+<PRE>
+ <KBD>mxmldoc --no-output filename.xml *.h *.c ENTER</KBD>
+</PRE>
+<P>You can then run <TT>mxmldoc</TT> again with the XML file alone to
+ generate the HTML documentation:</P>
+<PRE>
+ <KBD>mxmldoc filename.xml &gt;filename.html ENTER</KBD>
+</PRE>
+<H3><A NAME="5_1_1">Creating Man Pages</A></H3>
+<P>The <TT>--man filename</TT> option tells <TT>mxmldoc</TT> to create a
+ man page instead of HTML documentation, for example:</P>
+<PRE>
+ <KBD>mxmldoc --man filename filename.xml \
+ &gt;filename.man ENTER</KBD>
+
+ <KBD>mxmldoc --man filename *.h *.c \
+ &gt;filename.man ENTER</KBD>
+</PRE>
+<H3><A NAME="5_1_2">Creating Xcode Documentation Sets</A></H3>
+<P>The <TT>--docset directory.docset</TT> option tells <TT>mxmldoc</TT>
+ to create an Xcode documentation set containing the HTML documentation,
+ for example:</P>
+<PRE>
+ <KBD>mxmldoc --docset foo.docset *.h *.c foo.xml ENTER</KBD>
+</PRE>
+<P>Xcode documentation sets can only be built on Mac OS X with Xcode 3.0
+ or higher installed.</P>
+<H2><A NAME="5_2">Commenting Your Code</A></H2>
+<P>As noted previously, <TT>mxmldoc</TT> looks for in-line comments to
+ describe the functions, types, and constants in your code. <TT>Mxmldoc</TT>
+ will document all public names it finds in your source files - any
+ names starting with the underscore character (_) or names that are
+ documented with the <A HREF="#ATDIRECTIVES">@private@</A> directive are
+ treated as private and are undocumented.</P>
+<P>Comments appearing directly before a function or type definition are
+ used to document that function or type. Comments appearing after
+ argument, definition, return type, or variable declarations are used to
+ document that argument, definition, return type, or variable. For
+ example, the following code excerpt defines a key/value structure and a
+ function that creates a new instance of that structure:</P>
+<PRE>
+ /* A key/value pair. This is used with the
+ dictionary structure. */
+
+ struct keyval
+ {
+ char *key; /* Key string */
+ char *val; /* Value string */
+ };
+
+ /* Create a new key/value pair. */
+
+ struct keyval * /* New key/value pair */
+ new_keyval(
+ const char *key, /* Key string */
+ const char *val) /* Value string */
+ {
+ ...
+ }
+</PRE>
+<P><TT>Mxmldoc</TT> also knows to remove extra asterisks (*) from the
+ comment string, so the comment string:</P>
+<PRE>
+ /*
+ * Compute the value of PI.
+ *
+ * The function connects to an Internet server
+ * that streams audio of mathematical monks
+ * chanting the first 100 digits of PI.
+ */
+</PRE>
+<P>will be shown as:</P>
+<PRE>
+ Compute the value of PI.
+
+ The function connects to an Internet server
+ that streams audio of mathematical monks
+ chanting the first 100 digits of PI.
+</PRE>
+<P><A name="ATDIRECTIVES">Comments</A> can also include the following
+ special <TT>@name ...@</TT> directive strings:</P>
+<UL>
+<LI><TT>@deprecated@</TT> - flags the item as deprecated to discourage
+ its use</LI>
+<LI><TT>@private@</TT> - flags the item as private so it will not be
+ included in the documentation</LI>
+<LI><TT>@since ...@</TT> - flags the item as new since a particular
+ release. The text following the <TT>@since</TT> up to the closing <TT>@</TT>
+ is highlighted in the generated documentation, e.g. <TT>@since CUPS
+ 1.3@</TT>.</LI>
+</UL>
+
+<!-- NEED 10 -->
+<H2><A NAME="5_3">Titles, Sections, and Introductions</A></H2>
+<P><TT>Mxmldoc</TT> also provides options to set the title, section, and
+ introduction text for the generated documentation. The <TT>--title text</TT>
+ option specifies the title for the documentation. The title string is
+ usually put in quotes:</P>
+<PRE>
+ <KBD>mxmldoc filename.xml \
+ --title &quot;My Famous Documentation&quot; \
+ &gt;filename.html ENTER</KBD>
+</PRE>
+<P>The <TT>--section name</TT> option specifies the section for the
+ documentation. For HTML documentation, the name is placed in a HTML
+ comment such as:</P>
+<PRE>
+ &lt;!-- SECTION: name --&gt;
+</PRE>
+<P>For man pages, the section name is usually just a number (&quot;3&quot;), or a
+ number followed by a vendor name (&quot;3acme&quot;). The section name is used in
+ the <TT>.TH</TT> directive in the man page:</P>
+<PRE>
+ .TH mylibrary 3acme &quot;My Title&quot; ...
+</PRE>
+<P>The default section name for man page output is &quot;3&quot;. There is no
+ default section name for HTML output.</P>
+<P>Finally, the <TT>--intro filename</TT> option specifies a file to
+ embed after the title and section but before the generated
+ documentation. For HTML documentation, the file must consist of valid
+ HTML without the usual <TT>DOCTYPE</TT>, <TT>html</TT>, and <TT>body</TT>
+ elements. For man page documentation, the file must consist of valid <TT>
+nroff(1)</TT> text.</P>
+<HR NOSHADE>
+<H1 align="right"><A name="LICENSE"><IMG align="right" alt="A" height="100"
+hspace="10" src="A.gif" width="100"></A>Mini-XML License</H1>
+<P>The Mini-XML library and included programs are provided under the
+ terms of the GNU Library General Public License (LGPL) with the
+ following exceptions:</P>
+<OL>
+<LI>Static linking of applications to the Mini-XML library does not
+ constitute a derivative work and does not require the author to provide
+ source code for the application, use the shared Mini-XML libraries, or
+ link their applications against a user-supplied version of Mini-XML.
+<P><I>If you link the application to a modified version of Mini-XML,
+ then the changes to Mini-XML must be provided under the terms of the
+ LGPL in sections 1, 2, and 4.</I></P>
+</LI>
+<LI>You do not have to provide a copy of the Mini-XML license with
+ programs that are linked to the Mini-XML library, nor do you have to
+ identify the Mini-XML license in your program or documentation as
+ required by section 6 of the LGPL.</LI>
+</OL>
+
+<!-- NEW PAGE -->
+<P align="center"><B>GNU LIBRARY GENERAL PUBLIC LICENSE</B></P>
+<P align="center">Version 2, June 1991
+<BR> Copyright (C) 1991 Free Software Foundation, Inc.
+<BR> 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA
+<BR> Everyone is permitted to copy and distribute verbatim copies of
+ this license document, but changing it is not allowed.
+<BR> [This is the first released version of the library GPL. It is
+ numbered 2 because it goes with version 2 of the ordinary GPL.]</P>
+<P><B>Preamble</B></P>
+<P>The licenses for most software are designed to take away your freedom
+ to share and change it. By contrast, the GNU General Public Licenses
+ are intended to guarantee your freedom to share and change free
+ software--to make sure the software is free for all its users.</P>
+<P>This license, the Library General Public License, applies to some
+ specially designated Free Software Foundation software, and to any
+ other libraries whose authors decide to use it. You can use it for your
+ libraries, too.</P>
+<P>When we speak of free software, we are referring to freedom, not
+ price. Our General Public Licenses are designed to make sure that you
+ have the freedom to distribute copies of free software (and charge for
+ this service if you wish), that you receive source code or can get it
+ if you want it, that you can change the software or use pieces of it in
+ new free programs; and that you know you can do these things.</P>
+<P>To protect your rights, we need to make restrictions that forbid
+ anyone to deny you these rights or to ask you to surrender the rights.
+ These restrictions translate to certain responsibilities for you if you
+ distribute copies of the library, or if you modify it.</P>
+<P>For example, if you distribute copies of the library, whether gratis
+ or for a fee, you must give the recipients all the rights that we gave
+ you. You must make sure that they, too, receive or can get the source
+ code. If you link a program with the library, you must provide complete
+ object files to the recipients so that they can relink them with the
+ library, after making changes to the library and recompiling it. And
+ you must show them these terms so they know their rights.</P>
+<P>Our method of protecting your rights has two steps: (1) copyright the
+ library, and (2) offer you this license which gives you legal
+ permission to copy, distribute and/or modify the library.</P>
+<P>Also, for each distributor's protection, we want to make certain that
+ everyone understands that there is no warranty for this free library.
+ If the library is modified by someone else and passed on, we want its
+ recipients to know that what they have is not the original version, so
+ that any problems introduced by others will not reflect on the original
+ authors' reputations.</P>
+<P>Finally, any free program is threatened constantly by software
+ patents. We wish to avoid the danger that companies distributing free
+ software will individually obtain patent licenses, thus in effect
+ transforming the program into proprietary software. To prevent this, we
+ have made it clear that any patent must be licensed for everyone's free
+ use or not licensed at all.</P>
+<P>Most GNU software, including some libraries, is covered by the
+ ordinary GNU General Public License, which was designed for utility
+ programs. This license, the GNU Library General Public License, applies
+ to certain designated libraries. This license is quite different from
+ the ordinary one; be sure to read it in full, and don't assume that
+ anything in it is the same as in the ordinary license.</P>
+<P>The reason we have a separate public license for some libraries is
+ that they blur the distinction we usually make between modifying or
+ adding to a program and simply using it. Linking a program with a
+ library, without changing the library, is in some sense simply using
+ the library, and is analogous to running a utility program or
+ application program. However, in a textual and legal sense, the linked
+ executable is a combined work, a derivative of the original library,
+ and the ordinary General Public License treats it as such.</P>
+<P>Because of this blurred distinction, using the ordinary General
+ Public License for libraries did not effectively promote software
+ sharing, because most developers did not use the libraries. We
+ concluded that weaker conditions might promote sharing better.</P>
+<P>However, unrestricted linking of non-free programs would deprive the
+ users of those programs of all benefit from the free status of the
+ libraries themselves. This Library General Public License is intended
+ to permit developers of non-free programs to use free libraries, while
+ preserving your freedom as a user of such programs to change the free
+ libraries that are incorporated in them. (We have not seen how to
+ achieve this as regards changes in header files, but we have achieved
+ it as regards changes in the actual functions of the Library.) The hope
+ is that this will lead to faster development of free libraries.</P>
+<P>The precise terms and conditions for copying, distribution and
+ modification follow. Pay close attention to the difference between a
+ &quot;work based on the libary&quot; and a &quot;work that uses the library&quot;. The
+ former contains code derived from the library, while the latter only
+ works together with the library.</P>
+<P>Note that it is possible for a library to be covered by the ordinary
+ General Public License rather than by this special one.</P>
+<P align="center"><B>TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND
+ MODIFICATION</B></P>
+<P><STRONG>0.</STRONG> This License Agreement applies to any software
+ library which contains a notice placed by the copyright holder or other
+ authorized party saying it may be distributed under the terms of this
+ Library General Public License (also called &quot;this License&quot;). Each
+ licensee is addressed as &quot;you&quot;.</P>
+<P>A &quot;library&quot; means a collection of software functions and/or data
+ prepared so as to be conveniently linked with application programs
+ (which use some of those functions and data) to form executables.</P>
+<P>The &quot;Library&quot;, below, refers to any such software library or work
+ which has been distributed under these terms. A &quot;work based on the
+ Library&quot; means either the Library or any derivative work under
+ copyright law: that is to say, a work containing the Library or a
+ portion of it, either verbatim or with modifications and/or translated
+ straightforwardly into another language. (Hereinafter, translation is
+ included without limitation in the term &quot;modification&quot;.)</P>
+<P>&quot;Source code&quot; for a work means the preferred form of the work for
+ making modifications to it. For a library, complete source code means
+ all the source code for all modules it contains, plus any associated
+ interface definition files, plus the scripts used to control
+ compilation and installation of the library.</P>
+<P>Activities other than copying, distribution and modification are not
+ covered by this License; they are outside its scope. The act of running
+ a program using the Library is not restricted, and output from such a
+ program is covered only if its contents constitute a work based on the
+ Library (independent of the use of the Library in a tool for writing
+ it). Whether that is true depends on what the Library does and what the
+ program that uses the Library does.</P>
+<P><STRONG>1.</STRONG> You may copy and distribute verbatim copies of
+ the Library's complete source code as you receive it, in any medium,
+ provided that you conspicuously and appropriately publish on each copy
+ an appropriate copyright notice and disclaimer of warranty; keep intact
+ all the notices that refer to this License and to the absence of any
+ warranty; and distribute a copy of this License along with the Library.</P>
+<P>You may charge a fee for the physical act of transferring a copy, and
+ you may at your option offer warranty protection in exchange for a fee.</P>
+<P><STRONG>2.</STRONG> You may modify your copy or copies of the Library
+ or any portion of it, thus forming a work based on the Library, and
+ copy and distribute such modifications or work under the terms of
+ Section 1 above, provided that you also meet all of these conditions:</P>
+<UL>
+<P><STRONG>a)</STRONG> The modified work must itself be a software
+ library.</P>
+<P><STRONG>b)</STRONG> You must cause the files modified to carry
+ prominent notices stating that you changed the files and the date of
+ any change.</P>
+<P><STRONG>c)</STRONG> You must cause the whole of the work to be
+ licensed at no charge to all third parties under the terms of this
+ License.</P>
+<P><STRONG>d)</STRONG> If a facility in the modified Library refers to a
+ function or a table of data to be supplied by an application program
+ that uses the facility, other than as an argument passed when the
+ facility is invoked, then you must make a good faith effort to ensure
+ that, in the event an application does not supply such function or
+ table, the facility still operates, and performs whatever part of its
+ purpose remains meaningful.</P>
+<P>(For example, a function in a library to compute square roots has a
+ purpose that is entirely well-defined independent of the application.
+ Therefore, Subsection 2d requires that any application-supplied
+ function or table used by this function must be optional: if the
+ application does not supply it, the square root function must still
+ compute square roots.)</P>
+</UL>
+<P>These requirements apply to the modified work as a whole. If
+ identifiable sections of that work are not derived from the Library,
+ and can be reasonably considered independent and separate works in
+ themselves, then this License, and its terms, do not apply to those
+ sections when you distribute them as separate works. But when you
+ distribute the same sections as part of a whole which is a work based
+ on the Library, the distribution of the whole must be on the terms of
+ this License, whose permissions for other licensees extend to the
+ entire whole, and thus to each and every part regardless of who wrote
+ it.</P>
+<P>Thus, it is not the intent of this section to claim rights or contest
+ your rights to work written entirely by you; rather, the intent is to
+ exercise the right to control the distribution of derivative or
+ collective works based on the Library.</P>
+<P>In addition, mere aggregation of another work not based on the
+ Library with the Library (or with a work based on the Library) on a
+ volume of a storage or distribution medium does not bring the other
+ work under the scope of this License.</P>
+<P><STRONG>3.</STRONG> You may opt to apply the terms of the ordinary
+ GNU General Public License instead of this License to a given copy of
+ the Library. To do this, you must alter all the notices that refer to
+ this License, so that they refer to the ordinary GNU General Public
+ License, version 2, instead of to this License. (If a newer version
+ than version 2 of the ordinary GNU General Public License has appeared,
+ then you can specify that version instead if you wish.) Do not make any
+ other change in these notices.</P>
+<P>Once this change is made in a given copy, it is irreversible for that
+ copy, so the ordinary GNU General Public License applies to all
+ subsequent copies and derivative works made from that copy.</P>
+<P>This option is useful when you wish to copy part of the code of the
+ Library into a program that is not a library.</P>
+<P><STRONG>4.</STRONG> You may copy and distribute the Library (or a
+ portion or derivative of it, under Section 2) in object code or
+ executable form under the terms of Sections 1 and 2 above provided that
+ you accompany it with the complete corresponding machine-readable
+ source code, which must be distributed under the terms of Sections 1
+ and 2 above on a medium customarily used for software interchange.</P>
+<P>If distribution of object code is made by offering access to copy
+ from a designated place, then offering equivalent access to copy the
+ source code from the same place satisfies the requirement to distribute
+ the source code, even though third parties are not compelled to copy
+ the source along with the object code.</P>
+<P><STRONG>5.</STRONG> A program that contains no derivative of any
+ portion of the Library, but is designed to work with the Library by
+ being compiled or linked with it, is called a &quot;work that uses the
+ Library&quot;. Such a work, in isolation, is not a derivative work of the
+ Library, and therefore falls outside the scope of this License.</P>
+<P>However, linking a &quot;work that uses the Library&quot; with the Library
+ creates an executable that is a derivative of the Library (because it
+ contains portions of the Library), rather than a &quot;work that uses the
+ library&quot;. The executable is therefore covered by this License. Section
+ 6 states terms for distribution of such executables.</P>
+<P>When a &quot;work that uses the Library&quot; uses material from a header file
+ that is part of the Library, the object code for the work may be a
+ derivative work of the Library even though the source code is not.
+ Whether this is true is especially significant if the work can be
+ linked without the Library, or if the work is itself a library. The
+ threshold for this to be true is not precisely defined by law.</P>
+<P>If such an object file uses only numerical parameters, data structure
+ layouts and accessors, and small macros and small inline functions (ten
+ lines or less in length), then the use of the object file is
+ unrestricted, regardless of whether it is legally a derivative work.
+ (Executables containing this object code plus portions of the Library
+ will still fall under Section 6.)</P>
+<P>Otherwise, if the work is a derivative of the Library, you may
+ distribute the object code for the work under the terms of Section 6.
+ Any executables containing that work also fall under Section 6, whether
+ or not they are linked directly with the Library itself.</P>
+<P><STRONG>6.</STRONG> As an exception to the Sections above, you may
+ also compile or link a &quot;work that uses the Library&quot; with the Library to
+ produce a work containing portions of the Library, and distribute that
+ work under terms of your choice, provided that the terms permit
+ modification of the work for the customer's own use and reverse
+ engineering for debugging such modifications.</P>
+<P>You must give prominent notice with each copy of the work that the
+ Library is used in it and that the Library and its use are covered by
+ this License. You must supply a copy of this License. If the work
+ during execution displays copyright notices, you must include the
+ copyright notice for the Library among them, as well as a reference
+ directing the user to the copy of this License. Also, you must do one
+ of these things:</P>
+<UL><STRONG> a)</STRONG> Accompany the work with the complete
+ corresponding machine-readable source code for the Library including
+ whatever changes were used in the work (which must be distributed under
+ Sections 1 and 2 above); and, if the work is an executable linked with
+ the Library, with the complete machine-readable &quot;work that uses the
+ Library&quot;, as object code and/or source code, so that the user can
+ modify the Library and then relink to produce a modified executable
+ containing the modified Library. (It is understood that the user who
+ changes the contents of definitions files in the Library will not
+ necessarily be able to recompile the application to use the modified
+ definitions.)
+<P><STRONG>b)</STRONG> Accompany the work with a written offer, valid
+ for at least three years, to give the same user the materials specified
+ in Subsection 6a, above, for a charge no more than the cost of
+ performing this distribution.</P>
+<P><STRONG>c)</STRONG> If distribution of the work is made by offering
+ access to copy from a designated place, offer equivalent access to copy
+ the above specified materials from the same place.</P>
+<P><STRONG>d)</STRONG> Verify that the user has already received a copy
+ of these materials or that you have already sent this user a copy.</P>
+</UL>
+<P>For an executable, the required form of the &quot;work that uses the
+ Library&quot; must include any data and utility programs needed for
+ reproducing the executable from it. However, as a special exception,
+ the source code distributed need not include anything that is normally
+ distributed (in either source or binary form) with the major components
+ (compiler, kernel, and so on) of the operating system on which the
+ executable runs, unless that component itself accompanies the
+ executable.</P>
+<P>It may happen that this requirement contradicts the license
+ restrictions of other proprietary libraries that do not normally
+ accompany the operating system. Such a contradiction means you cannot
+ use both them and the Library together in an executable that you
+ distribute.</P>
+<P><STRONG>7.</STRONG> You may place library facilities that are a work
+ based on the Library side-by-side in a single library together with
+ other library facilities not covered by this License, and distribute
+ such a combined library, provided that the separate distribution of the
+ work based on the Library and of the other library facilities is
+ otherwise permitted, and provided that you do these two things:</P>
+<UL><STRONG> a)</STRONG> Accompany the combined library with a copy of
+ the same work based on the Library, uncombined with any other library
+ facilities. This must be distributed under the terms of the Sections
+ above.
+<P><STRONG>b)</STRONG> Give prominent notice with the combined library
+ of the fact that part of it is a work based on the Library, and
+ explaining where to find the accompanying uncombined form of the same
+ work.</P>
+</UL>
+<P><STRONG>8.</STRONG> You may not copy, modify, sublicense, link with,
+ or distribute the Library except as expressly provided under this
+ License. Any attempt otherwise to copy, modify, sublicense, link with,
+ or distribute the Library is void, and will automatically terminate
+ your rights under this License. However, parties who have received
+ copies, or rights, from you under this License will not have their
+ licenses terminated so long as such parties remain in full compliance.</P>
+<P><STRONG>9.</STRONG> You are not required to accept this License,
+ since you have not signed it. However, nothing else grants you
+ permission to modify or distribute the Library or its derivative works.
+ These actions are prohibited by law if you do not accept this License.
+ Therefore, by modifying or distributing the Library (or any work based
+ on the Library), you indicate your acceptance of this License to do so,
+ and all its terms and conditions for copying, distributing or modifying
+ the Library or works based on it.</P>
+<P><STRONG>10.</STRONG> Each time you redistribute the Library (or any
+ work based on the Library), the recipient automatically receives a
+ license from the original licensor to copy, distribute, link with or
+ modify the Library subject to these terms and conditions. You may not
+ impose any further restrictions on the recipients' exercise of the
+ rights granted herein. You are not responsible for enforcing compliance
+ by third parties to this License.</P>
+<P><STRONG>11.</STRONG> If, as a consequence of a court judgment or
+ allegation of patent infringement or for any other reason (not limited
+ to patent issues), conditions are imposed on you (whether by court
+ order, agreement or otherwise) that contradict the conditions of this
+ License, they do not excuse you from the conditions of this License. If
+ you cannot distribute so as to satisfy simultaneously your obligations
+ under this License and any other pertinent obligations, then as a
+ consequence you may not distribute the Library at all. For example, if
+ a patent license would not permit royalty-free redistribution of the
+ Library by all those who receive copies directly or indirectly through
+ you, then the only way you could satisfy both it and this License would
+ be to refrain entirely from distribution of the Library.</P>
+<P>If any portion of this section is held invalid or unenforceable under
+ any particular circumstance, the balance of the section is intended to
+ apply, and the section as a whole is intended to apply in other
+ circumstances.</P>
+<P>It is not the purpose of this section to induce you to infringe any
+ patents or other property right claims or to contest validity of any
+ such claims; this section has the sole purpose of protecting the
+ integrity of the free software distribution system which is implemented
+ by public license practices. Many people have made generous
+ contributions to the wide range of software distributed through that
+ system in reliance on consistent application of that system; it is up
+ to the author/donor to decide if he or she is willing to distribute
+ software through any other system and a licensee cannot impose that
+ choice.</P>
+<P>This section is intended to make thoroughly clear what is believed to
+ be a consequence of the rest of this License.</P>
+<P><STRONG>12.</STRONG> If the distribution and/or use of the Library is
+ restricted in certain countries either by patents or by copyrighted
+ interfaces, the original copyright holder who places the Library under
+ this License may add an explicit geographical distribution limitation
+ excluding those countries, so that distribution is permitted only in or
+ among countries not thus excluded. In such case, this License
+ incorporates the limitation as if written in the body of this License.</P>
+<P><STRONG>13.</STRONG> The Free Software Foundation may publish revised
+ and/or new versions of the Library General Public License from time to
+ time. Such new versions will be similar in spirit to the present
+ version, but may differ in detail to address new problems or concerns.</P>
+<P>Each version is given a distinguishing version number. If the Library
+ specifies a version number of this License which applies to it and &quot;any
+ later version&quot;, you have the option of following the terms and
+ conditions either of that version or of any later version published by
+ the Free Software Foundation. If the Library does not specify a license
+ version number, you may choose any version ever published by the Free
+ Software Foundation.</P>
+<P><STRONG>14.</STRONG> If you wish to incorporate parts of the Library
+ into other free programs whose distribution conditions are incompatible
+ with these, write to the author to ask for permission. For software
+ which is copyrighted by the Free Software Foundation, write to the Free
+ Software Foundation; we sometimes make exceptions for this. Our
+ decision will be guided by the two goals of preserving the free status
+ of all derivatives of our free software and of promoting the sharing
+ and reuse of software generally.</P>
+<P align="center"><B>NO WARRANTY</B></P>
+<P><STRONG>15.</STRONG> BECAUSE THE LIBRARY IS LICENSED FREE OF CHARGE,
+ THERE IS NO WARRANTY FOR THE LIBRARY, TO THE EXTENT PERMITTED BY
+ APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT
+ HOLDERS AND/OR OTHER PARTIES PROVIDE THE LIBRARY &quot;AS IS&quot; WITHOUT
+ WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT
+ LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A
+ PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE
+ OF THE LIBRARY IS WITH YOU. SHOULD THE LIBRARY PROVE DEFECTIVE, YOU
+ ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION.</P>
+<P><STRONG>16.</STRONG> IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR
+ AGREED TO IN WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO
+ MAY MODIFY AND/OR REDISTRIBUTE THE LIBRARY AS PERMITTED ABOVE, BE
+ LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL
+ OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE
+ LIBRARY (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING
+ RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A
+ FAILURE OF THE LIBRARY TO OPERATE WITH ANY OTHER SOFTWARE), EVEN IF
+ SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH
+ DAMAGES.</P>
+<P align="center"><B>END OF TERMS AND CONDITIONS</B></P>
+<P><B>How to Apply These Terms to Your New Libraries</B></P>
+<P>If you develop a new library, and you want it to be of the greatest
+ possible use to the public, we recommend making it free software that
+ everyone can redistribute and change. You can do so by permitting
+ redistribution under these terms (or, alternatively, under the terms of
+ the ordinary General Public License).</P>
+<P>To apply these terms, attach the following notices to the library. It
+ is safest to attach them to the start of each source file to most
+ effectively convey the exclusion of warranty; and each file should have
+ at least the &quot;copyright&quot; line and a pointer to where the full notice is
+ found.</P>
+<UL>
+<P><VAR>one line to give the library's name and an idea of what it does.</VAR>
+<BR> Copyright (C)<VAR> year</VAR><VAR> name of author</VAR></P>
+<P>This library is free software; you can redistribute it and/or modify
+ it under the terms of the GNU Lesser General Public License as
+ published by the Free Software Foundation; either version 2.1 of the
+ License, or (at your option) any later version.</P>
+<P>This library is distributed in the hope that it will be useful, but
+ WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Lesser
+ General Public License for more details.</P>
+<P>You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the Free Software
+ Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA</P>
+</UL>
+<P>Also add information on how to contact you by electronic and paper
+ mail.</P>
+<P>You should also get your employer (if you work as a programmer) or
+ your school, if any, to sign a &quot;copyright disclaimer&quot; for the library,
+ if necessary. Here is a sample; alter the names:</P>
+<UL>
+<P>Yoyodyne, Inc., hereby disclaims all copyright interest in the
+ library `Frob' (a library for tweaking knobs) written by James Random
+ Hacker.</P>
+<P><VAR>signature of Ty Coon</VAR>, 1 April 1990 Ty Coon, President of
+ Vice</P>
+</UL>
+<P>That's all there is to it!</P>
+<HR NOSHADE>
+<H1 align="right"><A name="RELNOTES"><IMG align="right" alt="B" height="100"
+hspace="10" src="B.gif" width="100"></A>Release Notes</H1>
+<H2><A NAME="7_1">Changes in Mini-XML 2.6</A></H2>
+<UL>
+<LI>Documentation fixes (STR #91, STR #92)</LI>
+<LI>The mxmldoc program did not handle typedef comments properly (STR
+ #72)</LI>
+<LI>Added support for &quot;long long&quot; printf formats.</LI>
+<LI>The XML parser now ignores BOMs in UTF-8 XML files (STR #89)</LI>
+<LI>The mxmldoc program now supports generating Xcode documentation
+ sets.</LI>
+<LI>mxmlSave*() did not output UTF-8 correctly on some platforms.</LI>
+<LI>mxmlNewXML() now adds encoding=&quot;utf-8&quot; in the ?xml directive to
+ avoid problems with non-conformant XML parsers that assume something
+ other than UTF-8 as the default encoding.</LI>
+<LI>Wrapping was not disabled when mxmlSetWrapMargin(0) was called, and
+ &quot;&lt;?xml ... ?&gt;&quot; was always followed by a newline (STR #76)</LI>
+<LI>The mxml.pc.in file was broken (STR #79)</LI>
+<LI>The mxmldoc program now handles &quot;typedef enum name {} name&quot;
+ correctly (STR #72)</LI>
+</UL>
+<H2><A NAME="7_2">Changes in Mini-XML 2.5</A></H2>
+<UL>
+<LI>The mxmldoc program now makes greater use of CSS and supports a
+ --css option to embed an alternate stylesheet.</LI>
+<LI>The mxmldoc program now supports --header and --footer options to
+ insert documentation content before and after the generated content.</LI>
+<LI>The mxmldoc program now supports a --framed option to generate
+ framed HTML output.</LI>
+<LI>The mxmldoc program now creates a table of contents including any
+ headings in the --intro file when generating HTML output.</LI>
+<LI>The man pages and man page output from mxmldoc did not use &quot;\-&quot; for
+ dashes (STR #68)</LI>
+<LI>The debug version of the Mini-XML DLL could not be built (STR #65)</LI>
+<LI>Processing instructions and directives did not work when not at the
+ top level of a document (STR #67)</LI>
+<LI>Spaces around the &quot;=&quot; in attributes were not supported (STR #67)</LI>
+</UL>
+<H2><A NAME="7_3">Changes in Mini-XML 2.4</A></H2>
+<UL>
+<LI>Fixed shared library build problems on HP-UX and Mac OS X.</LI>
+<LI>The mxmldoc program did not output argument descriptions for
+ functions properly.</LI>
+<LI>All global settings (custom, error, and entity callbacks and the
+ wrap margin) are now managed separately for each thread.</LI>
+<LI>Added mxmlElementDeleteAttr() function (STR #59)</LI>
+<LI>mxmlElementSetAttrf() did not work (STR #57)</LI>
+<LI>mxmlLoad*() incorrectly treated declarations as parent elements (STR
+ #56)</LI>
+<LI>mxmlLoad*() incorrectly allowed attributes without values (STR #47)</LI>
+<LI>Fixed Visual C++ build problems (STR #49)</LI>
+<LI>mxmlLoad*() did not return NULL when an element contained an error
+ (STR #46)</LI>
+<LI>Added support for the apos character entity (STR #54)</LI>
+<LI>Fixed whitespace detection with Unicode characters (STR #48)</LI>
+<LI>mxmlWalkNext() and mxmlWalkPrev() did not work correctly when called
+ with a node with no children as the top node (STR #53)</LI>
+</UL>
+<H2><A NAME="7_4">Changes in Mini-XML 2.3</A></H2>
+<UL>
+<LI>Added two exceptions to the LGPL to support static linking of
+ applications against Mini-XML</LI>
+<LI>The mxmldoc utility can now generate man pages, too.</LI>
+<LI>Added a mxmlNewXML() function</LI>
+<LI>Added a mxmlElementSetAttrf() function (STR #43)</LI>
+<LI>Added a snprintf() emulation function for the test program (STR #32)</LI>
+<LI>Added the _CRT_SECURE_NO_DEPRECATE definition when building on VC++
+ 2005 (STR #36)</LI>
+<LI>mxmlLoad*() did not detect missing &gt; characters in elements (STR
+ #41)</LI>
+<LI>mxmlLoad*() did not detect missing close tags at the end of an XML
+ document (STR #45)</LI>
+<LI>Added user_data and ref_count members to mxml_node_t structure</LI>
+<LI>Added mxmlReleaseNode() and mxmlRetainNode() APIs for
+ reference-counted nodes</LI>
+<LI>Added mxmlSetWrapMargin() to control the wrapping of XML output</LI>
+<LI>Added conditional check for EINTR error code for certain Windows
+ compilers that do not define it (STR #33)</LI>
+<LI>The mxmldoc program now generates correct HTML 4.0 output -
+ previously it generated invalid XHTML</LI>
+<LI>The mxmldoc program now supports &quot;@deprecated@, &quot;@private@&quot;, and
+ &quot;@since version@&quot; comments</LI>
+<LI>Fixed function and enumeration type bugs in mxmldoc</LI>
+<LI>Fixed the XML schema for mxmldoc</LI>
+<LI>The mxmldoc program now supports --intro, --section, and --title
+ options</LI>
+<LI>The mxmlLoad*() functions could leak a node on an error (STR #27)</LI>
+<LI>The mxml_vsnprintf() function could get in an infinite loop on a
+ buffer overflow (STR #25)</LI>
+<LI>Added new mxmlNewCDATA() and mxmlSetCDATA() functions to create and
+ set CDATA nodes, which are really just special element nodes</LI>
+<LI>Added new MXML_IGNORE type and MXML_IGNORE_CB callback to ignore
+ non-element nodes, e.g. whitespace</LI>
+<LI>mxmlLoad*() did not treat custom data as opaque, so whitespace
+ characters would be lost</LI>
+</UL>
+<H2><A NAME="7_5">Changes in Mini-XML 2.2.2</A></H2>
+<UL>
+<LI>mxmlLoad*() did not treat custom data as opaque, so whitespace
+ characters would be lost.</LI>
+</UL>
+<H2><A NAME="7_6">Changes in Mini-XML 2.2.1</A></H2>
+<UL>
+<LI>mxmlLoadFd(), mxmlLoadFile(), and mxmlLoadString() now correctly
+ return NULL on error (STR #21)</LI>
+<LI>mxmlNewInteger(), mxmlNewOpaque(), mxmlNewReal(), mxmlNewText(), and
+ mxmlNewTextf() incorrectly required a parent node (STR #22)</LI>
+<LI>Fixed an XML output bug in mxmldoc.</LI>
+<LI>The &quot;make install&quot; target now uses the install command to set the
+ proper permissions on UNIX/Linux/OSX.</LI>
+<LI>Fixed a MingW/Cygwin compilation problem (STR #18)</LI>
+</UL>
+<H2><A NAME="7_7">Changes in Mini-XML 2.2</A></H2>
+<UL>
+<LI>Added shared library support (STR #17)</LI>
+<LI>mxmlLoad*() now returns an error when an XML stream contains illegal
+ control characters (STR #10)</LI>
+<LI>mxmlLoad*() now returns an error when an element contains two
+ attributes with the same name in conformance with the XML spec (STR
+ #16)</LI>
+<LI>Added support for CDATA (STR #14, STR #15)</LI>
+<LI>Updated comment and processing instruction handling - no entity
+ support per XML specification.</LI>
+<LI>Added checking for invalid comment termination (&quot;---&gt;&quot; is not
+ allowed)</LI>
+</UL>
+<H2><A NAME="7_8">Changes in Mini-XML 2.1</A></H2>
+<UL>
+<LI>Added support for custom data nodes (STR #6)</LI>
+<LI>Now treat UTF-8 sequences which are longer than necessary as an
+ error (STR #4)</LI>
+<LI>Fixed entity number support (STR #8)</LI>
+<LI>Fixed mxmlLoadString() bug with UTF-8 (STR #7)</LI>
+<LI>Fixed entity lookup bug (STR #5)</LI>
+<LI>Added mxmlLoadFd() and mxmlSaveFd() functions.</LI>
+<LI>Fixed multi-word UTF-16 handling.</LI>
+</UL>
+<H2><A NAME="7_9">Changes in Mini-XML 2.0</A></H2>
+<UL>
+<LI>New programmers manual.</LI>
+<LI>Added Visual C++ project files for Microsoft Windows users.</LI>
+<LI>Added optimizations to mxmldoc, mxmlSaveFile(), and mxmlIndexNew()
+ (STR #2)</LI>
+<LI>mxmlEntityAddCallback() now returns an integer status (STR #2)</LI>
+<LI>Added UTF-16 support (input only; all output is UTF-8)</LI>
+<LI>Added index functions to build a searchable index of XML nodes.</LI>
+<LI>Added character entity callback interface to support additional
+ character entities beyond those defined in the XHTML specification.</LI>
+<LI>Added support for XHTML character entities.</LI>
+<LI>The mxmldoc utility now produces XML output which conforms to an
+ updated XML schema, described in the file &quot;doc/mxmldoc.xsd&quot;.</LI>
+<LI>Changed the whitespace callback interface to return strings instead
+ of a single character, allowing for greater control over the formatting
+ of XML files written using Mini-XML. THIS CHANGE WILL REQUIRE CHANGES
+ TO YOUR 1.x CODE IF YOU USE WHITESPACE CALLBACKS.</LI>
+<LI>The mxmldoc utility now produces XML output which conforms to an
+ updated XML schema, described in the file &quot;doc/mxmldoc.xsd&quot;.</LI>
+<LI>Changed the whitespace callback interface to return strings instead
+ of a single character, allowing for greater control over the formatting
+ of XML files written using Mini-XML. THIS CHANGE WILL REQUIRE CHANGES
+ TO YOUR 1.x CODE IF YOU USE WHITESPACE CALLBACKS.</LI>
+<LI>The mxmldoc utility is now capable of documenting C++ classes,
+ functions, and structures, and correctly handles C++ comments.</LI>
+<LI>Added new modular tests for mxmldoc.</LI>
+<LI>Updated the mxmldoc output to be more compatible with embedding in
+ manuals produced with HTMLDOC.</LI>
+<LI>The makefile incorrectly included a &quot;/&quot; separator between the
+ destination path and install path. This caused problems when building
+ and installing with MingW.</LI>
+</UL>
+<H2><A NAME="7_10">Changes in Mini-XML 1.3</A></H2>
+<UL>
+<LI>Fixes for mxmldoc.</LI>
+<LI>Added support for reading standard HTML entity names.</LI>
+<LI>mxmlLoadString/File() did not decode character entities in element
+ names, attribute names, or attribute values.</LI>
+<LI>mxmlLoadString/File() would crash when loading non- conformant XML
+ data under an existing parent (top) node.</LI>
+<LI>Fixed several bugs in the mxmldoc utility.</LI>
+<LI>Added new error callback function to catch a variety of errors and
+ log them to someplace other than stderr.</LI>
+<LI>The mxmlElementSetAttr() function now allows for NULL attribute
+ values.</LI>
+<LI>The load and save functions now properly handle quoted element and
+ attribute name strings properly, e.g. for !DOCTYPE declarations.</LI>
+</UL>
+<H2><A NAME="7_11">Changes in Mini-XML 1.2</A></H2>
+<UL>
+<LI>Added new &quot;set&quot; methods to set the value of a node.</LI>
+<LI>Added new formatted text methods mxmlNewTextf() and mxmlSetTextf()
+ to create/set a text node value using printf-style formats.</LI>
+<LI>Added new standard callbacks for use with the mxmlLoad functions.</LI>
+<LI>Updated the HTML documentation to include examples of the walk and
+ load function output.</LI>
+<LI>Added --with/without-ansi configure option to control the strdup()
+ function check.</LI>
+<LI>Added --with/without-snprintf configure option to control the
+ snprintf() and vsnprintf() function checks.</LI>
+</UL>
+<H2><A NAME="7_12">Changes in Mini-XML 1.1.2</A></H2>
+<UL>
+<LI>The mxml(3) man page wasn't updated for the string functions.</LI>
+<LI>mxmlSaveString() returned the wrong number of characters.</LI>
+<LI>mxml_add_char() updated the buffer pointer in the wrong place.</LI>
+</UL>
+<H2><A NAME="7_13">Changes in Mini-XML 1.1.1</A></H2>
+<UL>
+<LI>The private mxml_add_ch() function did not update the
+ start-of-buffer pointer which could cause a crash when using
+ mxmlSaveString().</LI>
+<LI>The private mxml_write_ws() function called putc() instead of using
+ the proper callback which could cause a crash when using
+ mxmlSaveString().</LI>
+<LI>Added a mxmlSaveAllocString() convenience function for saving an XML
+ node tree to an allocated string.</LI>
+</UL>
+<H2><A NAME="7_14">Changes in Mini-XML 1.1</A></H2>
+<UL>
+<LI>The mxmlLoadFile() function now uses dynamically allocated string
+ buffers for element names, attribute names, and attribute values.
+ Previously they were capped at 16383, 255, and 255 bytes, respectively.</LI>
+<LI>Added a new mxmlLoadString() function for loading an XML node tree
+ from a string.</LI>
+<LI>Added a new mxmlSaveString() function for saving an XML node tree to
+ a string.</LI>
+<LI>Add emulation of strdup() if the local platform does not provide the
+ function.</LI>
+</UL>
+<H2><A NAME="7_15">Changes in Mini-XML 1.0</A></H2>
+<UL>
+<LI>The mxmldoc program now handles function arguments, structures,
+ unions, enumerations, classes, and typedefs properly.</LI>
+<LI>Documentation provided via mxmldoc and more in-line comments in the
+ code.</LI>
+<LI>Added man pages and packaging files.</LI>
+</UL>
+<H2><A NAME="7_16">Changes in Mini-XML 0.93</A></H2>
+<UL>
+<LI>New mxmldoc example program that is also used to create and update
+ code documentation using XML and produce HTML reference pages.</LI>
+<LI>Added mxmlAdd() and mxmlRemove() functions to add and remove nodes
+ from a tree. This provides more flexibility over where the nodes are
+ inserted and allows nodes to be moved within the tree as needed.</LI>
+<LI>mxmlLoadFile() now correctly handles comments.</LI>
+<LI>mxmlLoadFile() now supports the required &quot;gt&quot;, &quot;quot&quot;, and &quot;nbsp&quot;
+ character entities.</LI>
+<LI>mxmlSaveFile() now uses newlines as whitespace when valid to do so.</LI>
+<LI>mxmlFindElement() now also takes attribute name and attribute value
+ string arguments to limit the search to specific elements with
+ attributes and/or values.</LI>
+ NULL pointers can be used as &quot;wildcards&quot;.
+<LI>Added uninstall target to makefile, and auto-reconfig if Makefile.in
+ or configure.in are changed.</LI>
+<LI>mxmlFindElement(), mxmlWalkNext(), and mxmlWalkPrev() now all
+ provide &quot;descend&quot; arguments to control whether they descend into child
+ nodes in the tree.</LI>
+<LI>Fixed some whitespace issues in mxmlLoadFile().</LI>
+<LI>Fixed Unicode output and whitespace issues in mxmlSaveFile().</LI>
+<LI>mxmlSaveFile() now supports a whitespace callback to provide more
+ human-readable XML output under program control.</LI>
+</UL>
+<H2><A NAME="7_17">Changes in Mini-XML 0.92</A></H2>
+<UL>
+<LI>mxmlSaveFile() didn't return a value on success.</LI>
+</UL>
+<H2><A NAME="7_18">Changes in Mini-XML 0.91</A></H2>
+<UL>
+<LI>mxmlWalkNext() would go into an infinite loop.</LI>
+</UL>
+<H2><A NAME="7_19">Changes in Mini-XML 0.9</A></H2>
+<UL>
+<LI>Initial public release.</LI>
+</UL>
+<HR NOSHADE>
+<DIV class="body">
+<H1 align="right"><A name="REFERENCE"><IMG align="right" alt="C" height="100"
+hspace="10" src="C.gif" width="100"></A>Library Reference</H1>
+<H2 class="title"><A NAME="8_1">Contents</A></H2>
+<UL class="contents">
+<LI><A href="#FUNCTIONS">Functions</A>
+<UL class="code">
+<LI><A href="#mxmlAdd" title="Add a node to a tree.">mxmlAdd</A></LI>
+<LI><A href="#mxmlDelete" title="Delete a node and all of its children.">
+mxmlDelete</A></LI>
+<LI><A href="#mxmlElementDeleteAttr" title="Delete an attribute.">
+mxmlElementDeleteAttr</A></LI>
+<LI><A href="#mxmlElementGetAttr" title="Get an attribute.">
+mxmlElementGetAttr</A></LI>
+<LI><A href="#mxmlElementSetAttr" title="Set an attribute.">
+mxmlElementSetAttr</A></LI>
+<LI><A href="#mxmlElementSetAttrf" title="Set an attribute with a formatted value.">
+mxmlElementSetAttrf</A></LI>
+<LI><A href="#mxmlEntityAddCallback" title="Add a callback to convert entities to Unicode.">
+mxmlEntityAddCallback</A></LI>
+<LI><A href="#mxmlEntityGetName" title="Get the name that corresponds to the character value.">
+mxmlEntityGetName</A></LI>
+<LI><A href="#mxmlEntityGetValue" title="Get the character corresponding to a named entity.">
+mxmlEntityGetValue</A></LI>
+<LI><A href="#mxmlEntityRemoveCallback" title="Remove a callback.">
+mxmlEntityRemoveCallback</A></LI>
+<LI><A href="#mxmlFindElement" title="Find the named element.">
+mxmlFindElement</A></LI>
+<LI><A href="#mxmlIndexDelete" title="Delete an index.">mxmlIndexDelete</A>
+</LI>
+<LI><A href="#mxmlIndexEnum" title="Return the next node in the index.">
+mxmlIndexEnum</A></LI>
+<LI><A href="#mxmlIndexFind" title="Find the next matching node.">
+mxmlIndexFind</A></LI>
+<LI><A href="#mxmlIndexNew" title="Create a new index.">mxmlIndexNew</A></LI>
+<LI><A href="#mxmlIndexReset" title="Reset the enumeration/find pointer in the index and return the first node in the index.">
+mxmlIndexReset</A></LI>
+<LI><A href="#mxmlLoadFd" title="Load a file descriptor into an XML node tree.">
+mxmlLoadFd</A></LI>
+<LI><A href="#mxmlLoadFile" title="Load a file into an XML node tree.">
+mxmlLoadFile</A></LI>
+<LI><A href="#mxmlLoadString" title="Load a string into an XML node tree.">
+mxmlLoadString</A></LI>
+<LI><A href="#mxmlNewCDATA" title="Create a new CDATA node.">
+mxmlNewCDATA</A></LI>
+<LI><A href="#mxmlNewCustom" title="Create a new custom data node.">
+mxmlNewCustom</A></LI>
+<LI><A href="#mxmlNewElement" title="Create a new element node.">
+mxmlNewElement</A></LI>
+<LI><A href="#mxmlNewInteger" title="Create a new integer node.">
+mxmlNewInteger</A></LI>
+<LI><A href="#mxmlNewOpaque" title="Create a new opaque string.">
+mxmlNewOpaque</A></LI>
+<LI><A href="#mxmlNewReal" title="Create a new real number node.">
+mxmlNewReal</A></LI>
+<LI><A href="#mxmlNewText" title="Create a new text fragment node.">
+mxmlNewText</A></LI>
+<LI><A href="#mxmlNewTextf" title="Create a new formatted text fragment node.">
+mxmlNewTextf</A></LI>
+<LI><A href="#mxmlNewXML" title="Create a new XML document tree.">
+mxmlNewXML</A></LI>
+<LI><A href="#mxmlRelease" title="Release a node.">mxmlRelease</A></LI>
+<LI><A href="#mxmlRemove" title="Remove a node from its parent.">
+mxmlRemove</A></LI>
+<LI><A href="#mxmlRetain" title="Retain a node.">mxmlRetain</A></LI>
+<LI><A href="#mxmlSAXLoadFd" title="Load a file descriptor into an XML node tree using a SAX callback.">
+mxmlSAXLoadFd</A></LI>
+<LI><A href="#mxmlSAXLoadFile" title="Load a file into an XML node tree using a SAX callback.">
+mxmlSAXLoadFile</A></LI>
+<LI><A href="#mxmlSAXLoadString" title="Load a string into an XML node tree using a SAX callback.">
+mxmlSAXLoadString</A></LI>
+<LI><A href="#mxmlSaveAllocString" title="Save an XML node tree to an allocated string.">
+mxmlSaveAllocString</A></LI>
+<LI><A href="#mxmlSaveFd" title="Save an XML tree to a file descriptor.">
+mxmlSaveFd</A></LI>
+<LI><A href="#mxmlSaveFile" title="Save an XML tree to a file.">
+mxmlSaveFile</A></LI>
+<LI><A href="#mxmlSaveString" title="Save an XML node tree to a string.">
+mxmlSaveString</A></LI>
+<LI><A href="#mxmlSetCDATA" title="Set the element name of a CDATA node.">
+mxmlSetCDATA</A></LI>
+<LI><A href="#mxmlSetCustom" title="Set the data and destructor of a custom data node.">
+mxmlSetCustom</A></LI>
+<LI><A href="#mxmlSetCustomHandlers" title="Set the handling functions for custom data.">
+mxmlSetCustomHandlers</A></LI>
+<LI><A href="#mxmlSetElement" title="Set the name of an element node.">
+mxmlSetElement</A></LI>
+<LI><A href="#mxmlSetErrorCallback" title="Set the error message callback.">
+mxmlSetErrorCallback</A></LI>
+<LI><A href="#mxmlSetInteger" title="Set the value of an integer node.">
+mxmlSetInteger</A></LI>
+<LI><A href="#mxmlSetOpaque" title="Set the value of an opaque node.">
+mxmlSetOpaque</A></LI>
+<LI><A href="#mxmlSetReal" title="Set the value of a real number node.">
+mxmlSetReal</A></LI>
+<LI><A href="#mxmlSetText" title="Set the value of a text node.">
+mxmlSetText</A></LI>
+<LI><A href="#mxmlSetTextf" title="Set the value of a text node to a formatted string.">
+mxmlSetTextf</A></LI>
+<LI><A href="#mxmlSetWrapMargin" title="Set the the wrap margin when saving XML data.">
+mxmlSetWrapMargin</A></LI>
+<LI><A href="#mxmlWalkNext" title="Walk to the next logical node in the tree.">
+mxmlWalkNext</A></LI>
+<LI><A href="#mxmlWalkPrev" title="Walk to the previous logical node in the tree.">
+mxmlWalkPrev</A></LI>
+</UL>
+</LI>
+<LI><A href="#TYPES">Data Types</A>
+<UL class="code">
+<LI><A href="#mxml_attr_t" title="An XML element attribute value.">
+mxml_attr_t</A></LI>
+<LI><A href="#mxml_custom_destroy_cb_t" title="Custom data destructor">
+mxml_custom_destroy_cb_t</A></LI>
+<LI><A href="#mxml_custom_load_cb_t" title="Custom data load callback function">
+mxml_custom_load_cb_t</A></LI>
+<LI><A href="#mxml_custom_save_cb_t" title="Custom data save callback function">
+mxml_custom_save_cb_t</A></LI>
+<LI><A href="#mxml_custom_t" title="An XML custom value. ">mxml_custom_t</A>
+</LI>
+<LI><A href="#mxml_element_t" title="An XML element value.">
+mxml_element_t</A></LI>
+<LI><A href="#mxml_entity_cb_t" title="Entity callback function">
+mxml_entity_cb_t</A></LI>
+<LI><A href="#mxml_error_cb_t" title="Error callback function">
+mxml_error_cb_t</A></LI>
+<LI><A href="#mxml_index_t" title="An XML node index.">mxml_index_t</A></LI>
+<LI><A href="#mxml_load_cb_t" title="Load callback function">
+mxml_load_cb_t</A></LI>
+<LI><A href="#mxml_node_t" title="An XML node.">mxml_node_t</A></LI>
+<LI><A href="#mxml_save_cb_t" title="Save callback function">
+mxml_save_cb_t</A></LI>
+<LI><A href="#mxml_sax_cb_t" title="SAX callback function">mxml_sax_cb_t</A>
+</LI>
+<LI><A href="#mxml_sax_event_t" title="SAX event type.">mxml_sax_event_t</A>
+</LI>
+<LI><A href="#mxml_text_t" title="An XML text value.">mxml_text_t</A></LI>
+<LI><A href="#mxml_type_t" title="The XML node type.">mxml_type_t</A></LI>
+<LI><A href="#mxml_value_t" title="An XML node value.">mxml_value_t</A></LI>
+</UL>
+</LI>
+<LI><A href="#STRUCTURES">Structures</A>
+<UL class="code">
+<LI><A href="#mxml_attr_s" title="An XML element attribute value.">
+mxml_attr_s</A></LI>
+<LI><A href="#mxml_custom_s" title="An XML custom value. ">mxml_custom_s</A>
+</LI>
+<LI><A href="#mxml_element_s" title="An XML element value.">
+mxml_element_s</A></LI>
+<LI><A href="#mxml_index_s" title="An XML node index.">mxml_index_s</A></LI>
+<LI><A href="#mxml_node_s" title="An XML node.">mxml_node_s</A></LI>
+<LI><A href="#mxml_text_s" title="An XML text value.">mxml_text_s</A></LI>
+</UL>
+</LI>
+<LI><A href="#UNIONS">Unions</A>
+<UL class="code">
+<LI><A href="#mxml_value_u" title="An XML node value.">mxml_value_u</A></LI>
+</UL>
+</LI>
+<LI><A href="#ENUMERATIONS">Constants</A>
+<UL class="code">
+<LI><A href="#mxml_sax_event_e" title="SAX event type.">mxml_sax_event_e</A>
+</LI>
+<LI><A href="#mxml_type_e" title="The XML node type.">mxml_type_e</A></LI>
+</UL>
+</LI>
+<H2 class="title"><A name="FUNCTIONS">Functions</A></H2>
+<H3 class="function"><A name="mxmlAdd">mxmlAdd</A></H3>
+<P class="description">Add a node to a tree.</P>
+<P class="code"> void mxmlAdd (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *parent,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;int where,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *child,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>parent</DT>
+<DD class="description">Parent node</DD>
+<DT>where</DT>
+<DD class="description">Where to add, MXML_ADD_BEFORE or MXML_ADD_AFTER</DD>
+<DT>child</DT>
+<DD class="description">Child node for where or MXML_ADD_TO_PARENT</DD>
+<DT>node</DT>
+<DD class="description">Node to add</DD>
+</DL>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">Adds the specified node to the parent. If the
+ child argument is not NULL, puts the new node before or after the
+ specified child depending on the value of the where argument. If the
+ child argument is NULL, puts the new node at the beginning of the child
+ list (MXML_ADD_BEFORE) or at the end of the child list
+ (MXML_ADD_AFTER). The constant MXML_ADD_TO_PARENT can be used to
+ specify a NULL child pointer.</P>
+<H3 class="function"><A name="mxmlDelete">mxmlDelete</A></H3>
+<P class="description">Delete a node and all of its children.</P>
+<P class="code"> void mxmlDelete (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">Node to delete</DD>
+</DL>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">If the specified node has a parent, this function
+ first removes the node from its parent using the mxmlRemove() function.</P>
+<H3 class="function"><A NAME="8_2_3">
+<!--span class=&quot;info&quot;-->
+&nbsp;Mini-XML 2.4&nbsp;<A name="mxmlElementDeleteAttr">mxmlElementDeleteAttr</A></A>
+</H3>
+<P class="description">Delete an attribute.</P>
+<P class="code"> void mxmlElementDeleteAttr (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *name
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">Element</DD>
+<DT>name</DT>
+<DD class="description">Attribute name</DD>
+</DL>
+<H3 class="function"><A name="mxmlElementGetAttr">mxmlElementGetAttr</A></H3>
+<P class="description">Get an attribute.</P>
+<P class="code"> const char *mxmlElementGetAttr (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *name
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">Element node</DD>
+<DT>name</DT>
+<DD class="description">Name of attribute</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">Attribute value or NULL</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">This function returns NULL if the node is not an
+ element or the named attribute does not exist.</P>
+<H3 class="function"><A name="mxmlElementSetAttr">mxmlElementSetAttr</A></H3>
+<P class="description">Set an attribute.</P>
+<P class="code"> void mxmlElementSetAttr (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *name,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *value
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">Element node</DD>
+<DT>name</DT>
+<DD class="description">Name of attribute</DD>
+<DT>value</DT>
+<DD class="description">Attribute value</DD>
+</DL>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">If the named attribute already exists, the value
+ of the attribute is replaced by the new string value. The string value
+ is copied into the element node. This function does nothing if the node
+ is not an element.</P>
+<H3 class="function"><A NAME="8_2_6">
+<!--span class=&quot;info&quot;-->
+&nbsp;Mini-XML 2.3&nbsp;<A name="mxmlElementSetAttrf">mxmlElementSetAttrf</A></A></H3>
+<P class="description">Set an attribute with a formatted value.</P>
+<P class="code"> void mxmlElementSetAttrf (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *name,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *format,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;...
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">Element node</DD>
+<DT>name</DT>
+<DD class="description">Name of attribute</DD>
+<DT>format</DT>
+<DD class="description">Printf-style attribute value</DD>
+<DT>...</DT>
+<DD class="description">Additional arguments as needed</DD>
+</DL>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">If the named attribute already exists, the value
+ of the attribute is replaced by the new formatted string. The formatted
+ string value is copied into the element node. This function does
+ nothing if the node is not an element.</P>
+<H3 class="function"><A name="mxmlEntityAddCallback">
+mxmlEntityAddCallback</A></H3>
+<P class="description">Add a callback to convert entities to Unicode.</P>
+<P class="code"> int mxmlEntityAddCallback (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_entity_cb_t">mxml_entity_cb_t</A> cb
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>cb</DT>
+<DD class="description">Callback function to add</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">0 on success, -1 on failure</P>
+<H3 class="function"><A name="mxmlEntityGetName">mxmlEntityGetName</A></H3>
+<P class="description">Get the name that corresponds to the character
+ value.</P>
+<P class="code"> const char *mxmlEntityGetName (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;int val
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>val</DT>
+<DD class="description">Character value</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">Entity name or NULL</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">If val does not need to be represented by a named
+ entity, NULL is returned.</P>
+<H3 class="function"><A name="mxmlEntityGetValue">mxmlEntityGetValue</A></H3>
+<P class="description">Get the character corresponding to a named
+ entity.</P>
+<P class="code"> int mxmlEntityGetValue (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *name
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>name</DT>
+<DD class="description">Entity name</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">Character value or -1 on error</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The entity name can also be a numeric constant. -1
+ is returned if the name is not known.</P>
+<H3 class="function"><A name="mxmlEntityRemoveCallback">
+mxmlEntityRemoveCallback</A></H3>
+<P class="description">Remove a callback.</P>
+<P class="code"> void mxmlEntityRemoveCallback (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_entity_cb_t">mxml_entity_cb_t</A> cb
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>cb</DT>
+<DD class="description">Callback function to remove</DD>
+</DL>
+<H3 class="function"><A name="mxmlFindElement">mxmlFindElement</A></H3>
+<P class="description">Find the named element.</P>
+<P class="code"> <A href="#mxml_node_t">mxml_node_t</A> *mxmlFindElement
+ (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *top,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *name,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *attr,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *value,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;int descend
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">Current node</DD>
+<DT>top</DT>
+<DD class="description">Top node</DD>
+<DT>name</DT>
+<DD class="description">Element name or NULL for any</DD>
+<DT>attr</DT>
+<DD class="description">Attribute name, or NULL for none</DD>
+<DT>value</DT>
+<DD class="description">Attribute value, or NULL for any</DD>
+<DT>descend</DT>
+<DD class="description">Descend into tree - MXML_DESCEND,
+ MXML_NO_DESCEND, or MXML_DESCEND_FIRST</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">Element node or NULL</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The search is constrained by the name, attribute
+ name, and value; any NULL names or values are treated as wildcards, so
+ different kinds of searches can be implemented by looking for all
+ elements of a given name or all elements with a specific attribute. The
+ descend argument determines whether the search descends into child
+ nodes; normally you will use MXML_DESCEND_FIRST for the initial search
+ and MXML_NO_DESCEND to find additional direct descendents of the node.
+ The top node argument constrains the search to a particular node's
+ children.</P>
+<H3 class="function"><A name="mxmlIndexDelete">mxmlIndexDelete</A></H3>
+<P class="description">Delete an index.</P>
+<P class="code"> void mxmlIndexDelete (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_index_t">mxml_index_t</A> *ind
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>ind</DT>
+<DD class="description">Index to delete</DD>
+</DL>
+<H3 class="function"><A name="mxmlIndexEnum">mxmlIndexEnum</A></H3>
+<P class="description">Return the next node in the index.</P>
+<P class="code"> <A href="#mxml_node_t">mxml_node_t</A> *mxmlIndexEnum (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_index_t">mxml_index_t</A> *ind
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>ind</DT>
+<DD class="description">Index to enumerate</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">Next node or NULL if there is none</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">Nodes are returned in the sorted order of the
+ index.</P>
+<H3 class="function"><A name="mxmlIndexFind">mxmlIndexFind</A></H3>
+<P class="description">Find the next matching node.</P>
+<P class="code"> <A href="#mxml_node_t">mxml_node_t</A> *mxmlIndexFind (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_index_t">mxml_index_t</A> *ind,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *element,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *value
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>ind</DT>
+<DD class="description">Index to search</DD>
+<DT>element</DT>
+<DD class="description">Element name to find, if any</DD>
+<DT>value</DT>
+<DD class="description">Attribute value, if any</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">Node or NULL if none found</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">You should call mxmlIndexReset() prior to using
+ this function for the first time with a particular set of &quot;element&quot; and
+ &quot;value&quot; strings. Passing NULL for both &quot;element&quot; and &quot;value&quot; is
+ equivalent to calling mxmlIndexEnum().</P>
+<H3 class="function"><A name="mxmlIndexNew">mxmlIndexNew</A></H3>
+<P class="description">Create a new index.</P>
+<P class="code"> <A href="#mxml_index_t">mxml_index_t</A> *mxmlIndexNew
+ (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *element,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *attr
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">XML node tree</DD>
+<DT>element</DT>
+<DD class="description">Element to index or NULL for all</DD>
+<DT>attr</DT>
+<DD class="description">Attribute to index or NULL for none</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">New index</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The index will contain all nodes that contain the
+ named element and/or attribute. If both &quot;element&quot; and &quot;attr&quot; are NULL,
+ then the index will contain a sorted list of the elements in the node
+ tree. Nodes are sorted by element name and optionally by attribute
+ value if the &quot;attr&quot; argument is not NULL.</P>
+<H3 class="function"><A name="mxmlIndexReset">mxmlIndexReset</A></H3>
+<P class="description">Reset the enumeration/find pointer in the index
+ and return the first node in the index.</P>
+<P class="code"> <A href="#mxml_node_t">mxml_node_t</A> *mxmlIndexReset
+ (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_index_t">mxml_index_t</A> *ind
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>ind</DT>
+<DD class="description">Index to reset</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">First node or NULL if there is none</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">This function should be called prior to using
+ mxmlIndexEnum() or mxmlIndexFind() for the first time.</P>
+<H3 class="function"><A name="mxmlLoadFd">mxmlLoadFd</A></H3>
+<P class="description">Load a file descriptor into an XML node tree.</P>
+<P class="code"> <A href="#mxml_node_t">mxml_node_t</A> *mxmlLoadFd (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *top,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;int fd,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_load_cb_t">mxml_load_cb_t</A> cb
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>top</DT>
+<DD class="description">Top node</DD>
+<DT>fd</DT>
+<DD class="description">File descriptor to read from</DD>
+<DT>cb</DT>
+<DD class="description">Callback function or MXML_NO_CALLBACK</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">First node or NULL if the file could not be read.</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The nodes in the specified file are added to the
+ specified top node. If no top node is provided, the XML file MUST be
+ well-formed with a single parent node like &lt;?xml&gt; for the entire file.
+ The callback function returns the value type that should be used for
+ child nodes. If MXML_NO_CALLBACK is specified then all child nodes will
+ be either MXML_ELEMENT or MXML_TEXT nodes.
+<BR>
+<BR> The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK,
+ MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading
+ child nodes of the specified type.</P>
+<H3 class="function"><A name="mxmlLoadFile">mxmlLoadFile</A></H3>
+<P class="description">Load a file into an XML node tree.</P>
+<P class="code"> <A href="#mxml_node_t">mxml_node_t</A> *mxmlLoadFile (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *top,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;FILE *fp,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_load_cb_t">mxml_load_cb_t</A> cb
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>top</DT>
+<DD class="description">Top node</DD>
+<DT>fp</DT>
+<DD class="description">File to read from</DD>
+<DT>cb</DT>
+<DD class="description">Callback function or MXML_NO_CALLBACK</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">First node or NULL if the file could not be read.</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The nodes in the specified file are added to the
+ specified top node. If no top node is provided, the XML file MUST be
+ well-formed with a single parent node like &lt;?xml&gt; for the entire file.
+ The callback function returns the value type that should be used for
+ child nodes. If MXML_NO_CALLBACK is specified then all child nodes will
+ be either MXML_ELEMENT or MXML_TEXT nodes.
+<BR>
+<BR> The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK,
+ MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading
+ child nodes of the specified type.</P>
+<H3 class="function"><A name="mxmlLoadString">mxmlLoadString</A></H3>
+<P class="description">Load a string into an XML node tree.</P>
+<P class="code"> <A href="#mxml_node_t">mxml_node_t</A> *mxmlLoadString
+ (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *top,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *s,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_load_cb_t">mxml_load_cb_t</A> cb
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>top</DT>
+<DD class="description">Top node</DD>
+<DT>s</DT>
+<DD class="description">String to load</DD>
+<DT>cb</DT>
+<DD class="description">Callback function or MXML_NO_CALLBACK</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">First node or NULL if the string has errors.</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The nodes in the specified string are added to the
+ specified top node. If no top node is provided, the XML string MUST be
+ well-formed with a single parent node like &lt;?xml&gt; for the entire
+ string. The callback function returns the value type that should be
+ used for child nodes. If MXML_NO_CALLBACK is specified then all child
+ nodes will be either MXML_ELEMENT or MXML_TEXT nodes.
+<BR>
+<BR> The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK,
+ MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading
+ child nodes of the specified type.</P>
+<H3 class="function"><A NAME="8_2_20">
+<!--span class=&quot;info&quot;-->
+&nbsp;Mini-XML 2.3&nbsp;<A name="mxmlNewCDATA">mxmlNewCDATA</A></A></H3>
+<P class="description">Create a new CDATA node.</P>
+<P class="code"> <A href="#mxml_node_t">mxml_node_t</A> *mxmlNewCDATA (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *parent,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *data
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>parent</DT>
+<DD class="description">Parent node or MXML_NO_PARENT</DD>
+<DT>data</DT>
+<DD class="description">Data string</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">New node</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The new CDATA node is added to the end of the
+ specified parent's child list. The constant MXML_NO_PARENT can be used
+ to specify that the new CDATA node has no parent. The data string must
+ be nul-terminated and is copied into the new node. CDATA nodes use the
+ MXML_ELEMENT type.</P>
+<H3 class="function"><A NAME="8_2_21">
+<!--span class=&quot;info&quot;-->
+&nbsp;Mini-XML 2.1&nbsp;<A name="mxmlNewCustom">mxmlNewCustom</A></A></H3>
+<P class="description">Create a new custom data node.</P>
+<P class="code"> <A href="#mxml_node_t">mxml_node_t</A> *mxmlNewCustom (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *parent,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;void *data,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_custom_destroy_cb_t">mxml_custom_destroy_cb_t</A>
+ destroy
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>parent</DT>
+<DD class="description">Parent node or MXML_NO_PARENT</DD>
+<DT>data</DT>
+<DD class="description">Pointer to data</DD>
+<DT>destroy</DT>
+<DD class="description">Function to destroy data</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">New node</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The new custom node is added to the end of the
+ specified parent's child list. The constant MXML_NO_PARENT can be used
+ to specify that the new element node has no parent. NULL can be passed
+ when the data in the node is not dynamically allocated or is separately
+ managed.</P>
+<H3 class="function"><A name="mxmlNewElement">mxmlNewElement</A></H3>
+<P class="description">Create a new element node.</P>
+<P class="code"> <A href="#mxml_node_t">mxml_node_t</A> *mxmlNewElement
+ (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *parent,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *name
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>parent</DT>
+<DD class="description">Parent node or MXML_NO_PARENT</DD>
+<DT>name</DT>
+<DD class="description">Name of element</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">New node</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The new element node is added to the end of the
+ specified parent's child list. The constant MXML_NO_PARENT can be used
+ to specify that the new element node has no parent.</P>
+<H3 class="function"><A name="mxmlNewInteger">mxmlNewInteger</A></H3>
+<P class="description">Create a new integer node.</P>
+<P class="code"> <A href="#mxml_node_t">mxml_node_t</A> *mxmlNewInteger
+ (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *parent,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;int integer
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>parent</DT>
+<DD class="description">Parent node or MXML_NO_PARENT</DD>
+<DT>integer</DT>
+<DD class="description">Integer value</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">New node</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The new integer node is added to the end of the
+ specified parent's child list. The constant MXML_NO_PARENT can be used
+ to specify that the new integer node has no parent.</P>
+<H3 class="function"><A name="mxmlNewOpaque">mxmlNewOpaque</A></H3>
+<P class="description">Create a new opaque string.</P>
+<P class="code"> <A href="#mxml_node_t">mxml_node_t</A> *mxmlNewOpaque (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *parent,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *opaque
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>parent</DT>
+<DD class="description">Parent node or MXML_NO_PARENT</DD>
+<DT>opaque</DT>
+<DD class="description">Opaque string</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">New node</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The new opaque node is added to the end of the
+ specified parent's child list. The constant MXML_NO_PARENT can be used
+ to specify that the new opaque node has no parent. The opaque string
+ must be nul-terminated and is copied into the new node.</P>
+<H3 class="function"><A name="mxmlNewReal">mxmlNewReal</A></H3>
+<P class="description">Create a new real number node.</P>
+<P class="code"> <A href="#mxml_node_t">mxml_node_t</A> *mxmlNewReal (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *parent,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;double real
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>parent</DT>
+<DD class="description">Parent node or MXML_NO_PARENT</DD>
+<DT>real</DT>
+<DD class="description">Real number value</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">New node</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The new real number node is added to the end of
+ the specified parent's child list. The constant MXML_NO_PARENT can be
+ used to specify that the new real number node has no parent.</P>
+<H3 class="function"><A name="mxmlNewText">mxmlNewText</A></H3>
+<P class="description">Create a new text fragment node.</P>
+<P class="code"> <A href="#mxml_node_t">mxml_node_t</A> *mxmlNewText (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *parent,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;int whitespace,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *string
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>parent</DT>
+<DD class="description">Parent node or MXML_NO_PARENT</DD>
+<DT>whitespace</DT>
+<DD class="description">1 = leading whitespace, 0 = no whitespace</DD>
+<DT>string</DT>
+<DD class="description">String</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">New node</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The new text node is added to the end of the
+ specified parent's child list. The constant MXML_NO_PARENT can be used
+ to specify that the new text node has no parent. The whitespace
+ parameter is used to specify whether leading whitespace is present
+ before the node. The text string must be nul-terminated and is copied
+ into the new node.</P>
+<H3 class="function"><A name="mxmlNewTextf">mxmlNewTextf</A></H3>
+<P class="description">Create a new formatted text fragment node.</P>
+<P class="code"> <A href="#mxml_node_t">mxml_node_t</A> *mxmlNewTextf (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *parent,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;int whitespace,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *format,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;...
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>parent</DT>
+<DD class="description">Parent node or MXML_NO_PARENT</DD>
+<DT>whitespace</DT>
+<DD class="description">1 = leading whitespace, 0 = no whitespace</DD>
+<DT>format</DT>
+<DD class="description">Printf-style frmat string</DD>
+<DT>...</DT>
+<DD class="description">Additional args as needed</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">New node</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The new text node is added to the end of the
+ specified parent's child list. The constant MXML_NO_PARENT can be used
+ to specify that the new text node has no parent. The whitespace
+ parameter is used to specify whether leading whitespace is present
+ before the node. The format string must be nul-terminated and is
+ formatted into the new node.</P>
+<H3 class="function"><A NAME="8_2_28">
+<!--span class=&quot;info&quot;-->
+&nbsp;Mini-XML 2.3&nbsp;<A name="mxmlNewXML">mxmlNewXML</A></A></H3>
+<P class="description">Create a new XML document tree.</P>
+<P class="code"> <A href="#mxml_node_t">mxml_node_t</A> *mxmlNewXML (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *version
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>version</DT>
+<DD class="description">Version number to use</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">New ?xml node</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The &quot;version&quot; argument specifies the version
+ number to put in the ?xml element node. If NULL, version 1.0 is
+ assumed.</P>
+<H3 class="function"><A NAME="8_2_29">
+<!--span class=&quot;info&quot;-->
+&nbsp;Mini-XML 2.3&nbsp;<A name="mxmlRelease">mxmlRelease</A></A></H3>
+<P class="description">Release a node.</P>
+<P class="code"> int mxmlRelease (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">Node</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">New reference count</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">When the reference count reaches zero, the node
+ (and any children) is deleted via mxmlDelete().</P>
+<H3 class="function"><A name="mxmlRemove">mxmlRemove</A></H3>
+<P class="description">Remove a node from its parent.</P>
+<P class="code"> void mxmlRemove (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">Node to remove</DD>
+</DL>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">Does not free memory used by the node - use
+ mxmlDelete() for that. This function does nothing if the node has no
+ parent.</P>
+<H3 class="function"><A NAME="8_2_31">
+<!--span class=&quot;info&quot;-->
+&nbsp;Mini-XML 2.3&nbsp;<A name="mxmlRetain">mxmlRetain</A></A></H3>
+<P class="description">Retain a node.</P>
+<P class="code"> int mxmlRetain (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">Node</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">New reference count</P>
+<H3 class="function"><A NAME="8_2_32">
+<!--span class=&quot;info&quot;-->
+&nbsp;Mini-XML 2.3&nbsp;<A name="mxmlSAXLoadFd">mxmlSAXLoadFd</A></A></H3>
+<P class="description">Load a file descriptor into an XML node tree
+ using a SAX callback.</P>
+<P class="code"> <A href="#mxml_node_t">mxml_node_t</A> *mxmlSAXLoadFd (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *top,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;int fd,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_load_cb_t">mxml_load_cb_t</A> cb,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_sax_cb_t">mxml_sax_cb_t</A> sax_cb,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;void *sax_data
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>top</DT>
+<DD class="description">Top node</DD>
+<DT>fd</DT>
+<DD class="description">File descriptor to read from</DD>
+<DT>cb</DT>
+<DD class="description">Callback function or MXML_NO_CALLBACK</DD>
+<DT>sax_cb</DT>
+<DD class="description">SAX callback or MXML_NO_CALLBACK</DD>
+<DT>sax_data</DT>
+<DD class="description">SAX user data</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">First node or NULL if the file could not be read.</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The nodes in the specified file are added to the
+ specified top node. If no top node is provided, the XML file MUST be
+ well-formed with a single parent node like &lt;?xml&gt; for the entire file.
+ The callback function returns the value type that should be used for
+ child nodes. If MXML_NO_CALLBACK is specified then all child nodes will
+ be either MXML_ELEMENT or MXML_TEXT nodes.
+<BR>
+<BR> The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK,
+ MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading
+ child nodes of the specified type.
+<BR>
+<BR> The SAX callback must call mxmlRetain() for any nodes that need to
+ be kept for later use. Otherwise, nodes are deleted when the parent
+ node is closed or after each data, comment, CDATA, or directive node.</P>
+<H3 class="function"><A NAME="8_2_33">
+<!--span class=&quot;info&quot;-->
+&nbsp;Mini-XML 2.3&nbsp;<A name="mxmlSAXLoadFile">mxmlSAXLoadFile</A></A></H3>
+<P class="description">Load a file into an XML node tree using a SAX
+ callback.</P>
+<P class="code"> <A href="#mxml_node_t">mxml_node_t</A> *mxmlSAXLoadFile
+ (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *top,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;FILE *fp,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_load_cb_t">mxml_load_cb_t</A> cb,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_sax_cb_t">mxml_sax_cb_t</A> sax_cb,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;void *sax_data
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>top</DT>
+<DD class="description">Top node</DD>
+<DT>fp</DT>
+<DD class="description">File to read from</DD>
+<DT>cb</DT>
+<DD class="description">Callback function or MXML_NO_CALLBACK</DD>
+<DT>sax_cb</DT>
+<DD class="description">SAX callback or MXML_NO_CALLBACK</DD>
+<DT>sax_data</DT>
+<DD class="description">SAX user data</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">First node or NULL if the file could not be read.</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The nodes in the specified file are added to the
+ specified top node. If no top node is provided, the XML file MUST be
+ well-formed with a single parent node like &lt;?xml&gt; for the entire file.
+ The callback function returns the value type that should be used for
+ child nodes. If MXML_NO_CALLBACK is specified then all child nodes will
+ be either MXML_ELEMENT or MXML_TEXT nodes.
+<BR>
+<BR> The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK,
+ MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading
+ child nodes of the specified type.
+<BR>
+<BR> The SAX callback must call mxmlRetain() for any nodes that need to
+ be kept for later use. Otherwise, nodes are deleted when the parent
+ node is closed or after each data, comment, CDATA, or directive node.</P>
+<H3 class="function"><A NAME="8_2_34">
+<!--span class=&quot;info&quot;-->
+&nbsp;Mini-XML 2.3&nbsp;<A name="mxmlSAXLoadString">mxmlSAXLoadString</A></A></H3>
+<P class="description">Load a string into an XML node tree using a SAX
+ callback.</P>
+<P class="code"> <A href="#mxml_node_t">mxml_node_t</A>
+ *mxmlSAXLoadString (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *top,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *s,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_load_cb_t">mxml_load_cb_t</A> cb,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_sax_cb_t">mxml_sax_cb_t</A> sax_cb,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;void *sax_data
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>top</DT>
+<DD class="description">Top node</DD>
+<DT>s</DT>
+<DD class="description">String to load</DD>
+<DT>cb</DT>
+<DD class="description">Callback function or MXML_NO_CALLBACK</DD>
+<DT>sax_cb</DT>
+<DD class="description">SAX callback or MXML_NO_CALLBACK</DD>
+<DT>sax_data</DT>
+<DD class="description">SAX user data</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">First node or NULL if the string has errors.</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The nodes in the specified string are added to the
+ specified top node. If no top node is provided, the XML string MUST be
+ well-formed with a single parent node like &lt;?xml&gt; for the entire
+ string. The callback function returns the value type that should be
+ used for child nodes. If MXML_NO_CALLBACK is specified then all child
+ nodes will be either MXML_ELEMENT or MXML_TEXT nodes.
+<BR>
+<BR> The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK,
+ MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading
+ child nodes of the specified type.
+<BR>
+<BR> The SAX callback must call mxmlRetain() for any nodes that need to
+ be kept for later use. Otherwise, nodes are deleted when the parent
+ node is closed or after each data, comment, CDATA, or directive node.</P>
+<H3 class="function"><A name="mxmlSaveAllocString">mxmlSaveAllocString</A>
+</H3>
+<P class="description">Save an XML node tree to an allocated string.</P>
+<P class="code"> char *mxmlSaveAllocString (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_save_cb_t">mxml_save_cb_t</A> cb
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">Node to write</DD>
+<DT>cb</DT>
+<DD class="description">Whitespace callback or MXML_NO_CALLBACK</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">Allocated string or NULL</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">This function returns a pointer to a string
+ containing the textual representation of the XML node tree. The string
+ should be freed using the free() function when you are done with it.
+ NULL is returned if the node would produce an empty string or if the
+ string cannot be allocated.
+<BR>
+<BR> The callback argument specifies a function that returns a
+ whitespace string or NULL before and after each element. If
+ MXML_NO_CALLBACK is specified, whitespace will only be added before
+ MXML_TEXT nodes with leading whitespace and before attribute names
+ inside opening element tags.</P>
+<H3 class="function"><A name="mxmlSaveFd">mxmlSaveFd</A></H3>
+<P class="description">Save an XML tree to a file descriptor.</P>
+<P class="code"> int mxmlSaveFd (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;int fd,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_save_cb_t">mxml_save_cb_t</A> cb
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">Node to write</DD>
+<DT>fd</DT>
+<DD class="description">File descriptor to write to</DD>
+<DT>cb</DT>
+<DD class="description">Whitespace callback or MXML_NO_CALLBACK</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">0 on success, -1 on error.</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The callback argument specifies a function that
+ returns a whitespace string or NULL before and after each element. If
+ MXML_NO_CALLBACK is specified, whitespace will only be added before
+ MXML_TEXT nodes with leading whitespace and before attribute names
+ inside opening element tags.</P>
+<H3 class="function"><A name="mxmlSaveFile">mxmlSaveFile</A></H3>
+<P class="description">Save an XML tree to a file.</P>
+<P class="code"> int mxmlSaveFile (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;FILE *fp,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_save_cb_t">mxml_save_cb_t</A> cb
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">Node to write</DD>
+<DT>fp</DT>
+<DD class="description">File to write to</DD>
+<DT>cb</DT>
+<DD class="description">Whitespace callback or MXML_NO_CALLBACK</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">0 on success, -1 on error.</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The callback argument specifies a function that
+ returns a whitespace string or NULL before and after each element. If
+ MXML_NO_CALLBACK is specified, whitespace will only be added before
+ MXML_TEXT nodes with leading whitespace and before attribute names
+ inside opening element tags.</P>
+<H3 class="function"><A name="mxmlSaveString">mxmlSaveString</A></H3>
+<P class="description">Save an XML node tree to a string.</P>
+<P class="code"> int mxmlSaveString (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;char *buffer,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;int bufsize,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_save_cb_t">mxml_save_cb_t</A> cb
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">Node to write</DD>
+<DT>buffer</DT>
+<DD class="description">String buffer</DD>
+<DT>bufsize</DT>
+<DD class="description">Size of string buffer</DD>
+<DT>cb</DT>
+<DD class="description">Whitespace callback or MXML_NO_CALLBACK</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">Size of string</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">This function returns the total number of bytes
+ that would be required for the string but only copies (bufsize - 1)
+ characters into the specified buffer.
+<BR>
+<BR> The callback argument specifies a function that returns a
+ whitespace string or NULL before and after each element. If
+ MXML_NO_CALLBACK is specified, whitespace will only be added before
+ MXML_TEXT nodes with leading whitespace and before attribute names
+ inside opening element tags.</P>
+<H3 class="function"><A NAME="8_2_39">
+<!--span class=&quot;info&quot;-->
+&nbsp;Mini-XML 2.3&nbsp;<A name="mxmlSetCDATA">mxmlSetCDATA</A></A></H3>
+<P class="description">Set the element name of a CDATA node.</P>
+<P class="code"> int mxmlSetCDATA (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *data
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">Node to set</DD>
+<DT>data</DT>
+<DD class="description">New data string</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">0 on success, -1 on failure</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The node is not changed if it is not a CDATA
+ element node.</P>
+<H3 class="function"><A NAME="8_2_40">
+<!--span class=&quot;info&quot;-->
+&nbsp;Mini-XML 2.1&nbsp;<A name="mxmlSetCustom">mxmlSetCustom</A></A></H3>
+<P class="description">Set the data and destructor of a custom data
+ node.</P>
+<P class="code"> int mxmlSetCustom (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;void *data,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_custom_destroy_cb_t">mxml_custom_destroy_cb_t</A>
+ destroy
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">Node to set</DD>
+<DT>data</DT>
+<DD class="description">New data pointer</DD>
+<DT>destroy</DT>
+<DD class="description">New destructor function</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">0 on success, -1 on failure</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The node is not changed if it is not a custom
+ node.</P>
+<H3 class="function"><A name="mxmlSetCustomHandlers">
+mxmlSetCustomHandlers</A></H3>
+<P class="description">Set the handling functions for custom data.</P>
+<P class="code"> void mxmlSetCustomHandlers (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_custom_load_cb_t">mxml_custom_load_cb_t</A>
+ load,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_custom_save_cb_t">mxml_custom_save_cb_t</A> save
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>load</DT>
+<DD class="description">Load function</DD>
+<DT>save</DT>
+<DD class="description">Save function</DD>
+</DL>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The load function accepts a node pointer and a
+ data string and must return 0 on success and non-zero on error.
+<BR>
+<BR> The save function accepts a node pointer and must return a malloc'd
+ string on success and NULL on error.</P>
+<H3 class="function"><A name="mxmlSetElement">mxmlSetElement</A></H3>
+<P class="description">Set the name of an element node.</P>
+<P class="code"> int mxmlSetElement (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *name
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">Node to set</DD>
+<DT>name</DT>
+<DD class="description">New name string</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">0 on success, -1 on failure</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The node is not changed if it is not an element
+ node.</P>
+<H3 class="function"><A name="mxmlSetErrorCallback">mxmlSetErrorCallback</A>
+</H3>
+<P class="description">Set the error message callback.</P>
+<P class="code"> void mxmlSetErrorCallback (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_error_cb_t">mxml_error_cb_t</A> cb
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>cb</DT>
+<DD class="description">Error callback function</DD>
+</DL>
+<H3 class="function"><A name="mxmlSetInteger">mxmlSetInteger</A></H3>
+<P class="description">Set the value of an integer node.</P>
+<P class="code"> int mxmlSetInteger (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;int integer
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">Node to set</DD>
+<DT>integer</DT>
+<DD class="description">Integer value</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">0 on success, -1 on failure</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The node is not changed if it is not an integer
+ node.</P>
+<H3 class="function"><A name="mxmlSetOpaque">mxmlSetOpaque</A></H3>
+<P class="description">Set the value of an opaque node.</P>
+<P class="code"> int mxmlSetOpaque (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *opaque
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">Node to set</DD>
+<DT>opaque</DT>
+<DD class="description">Opaque string</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">0 on success, -1 on failure</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The node is not changed if it is not an opaque
+ node.</P>
+<H3 class="function"><A name="mxmlSetReal">mxmlSetReal</A></H3>
+<P class="description">Set the value of a real number node.</P>
+<P class="code"> int mxmlSetReal (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;double real
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">Node to set</DD>
+<DT>real</DT>
+<DD class="description">Real number value</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">0 on success, -1 on failure</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The node is not changed if it is not a real number
+ node.</P>
+<H3 class="function"><A name="mxmlSetText">mxmlSetText</A></H3>
+<P class="description">Set the value of a text node.</P>
+<P class="code"> int mxmlSetText (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;int whitespace,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *string
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">Node to set</DD>
+<DT>whitespace</DT>
+<DD class="description">1 = leading whitespace, 0 = no whitespace</DD>
+<DT>string</DT>
+<DD class="description">String</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">0 on success, -1 on failure</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The node is not changed if it is not a text node.</P>
+<H3 class="function"><A name="mxmlSetTextf">mxmlSetTextf</A></H3>
+<P class="description">Set the value of a text node to a formatted
+ string.</P>
+<P class="code"> int mxmlSetTextf (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;int whitespace,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;const char *format,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;...
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">Node to set</DD>
+<DT>whitespace</DT>
+<DD class="description">1 = leading whitespace, 0 = no whitespace</DD>
+<DT>format</DT>
+<DD class="description">Printf-style format string</DD>
+<DT>...</DT>
+<DD class="description">Additional arguments as needed</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">0 on success, -1 on failure</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The node is not changed if it is not a text node.</P>
+<H3 class="function"><A NAME="8_2_49">
+<!--span class=&quot;info&quot;-->
+&nbsp;Mini-XML 2.3&nbsp;<A name="mxmlSetWrapMargin">mxmlSetWrapMargin</A></A></H3>
+<P class="description">Set the the wrap margin when saving XML data.</P>
+<P class="code"> void mxmlSetWrapMargin (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;int column
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>column</DT>
+<DD class="description">Column for wrapping, 0 to disable wrapping</DD>
+</DL>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">Wrapping is disabled when &quot;column&quot; is 0.</P>
+<H3 class="function"><A name="mxmlWalkNext">mxmlWalkNext</A></H3>
+<P class="description">Walk to the next logical node in the tree.</P>
+<P class="code"> <A href="#mxml_node_t">mxml_node_t</A> *mxmlWalkNext (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *top,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;int descend
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">Current node</DD>
+<DT>top</DT>
+<DD class="description">Top node</DD>
+<DT>descend</DT>
+<DD class="description">Descend into tree - MXML_DESCEND,
+ MXML_NO_DESCEND, or MXML_DESCEND_FIRST</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">Next node or NULL</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The descend argument controls whether the first
+ child is considered to be the next node. The top node argument
+ constrains the walk to the node's children.</P>
+<H3 class="function"><A name="mxmlWalkPrev">mxmlWalkPrev</A></H3>
+<P class="description">Walk to the previous logical node in the tree.</P>
+<P class="code"> <A href="#mxml_node_t">mxml_node_t</A> *mxmlWalkPrev (
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *node,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> *top,
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;int descend
+<BR> );</P>
+<H4 class="parameters">Parameters</H4>
+<DL>
+<DT>node</DT>
+<DD class="description">Current node</DD>
+<DT>top</DT>
+<DD class="description">Top node</DD>
+<DT>descend</DT>
+<DD class="description">Descend into tree - MXML_DESCEND,
+ MXML_NO_DESCEND, or MXML_DESCEND_FIRST</DD>
+</DL>
+<H4 class="returnvalue">Return Value</H4>
+<P class="description">Previous node or NULL</P>
+<H4 class="discussion">Discussion</H4>
+<P class="discussion">The descend argument controls whether the previous
+ node's last child is considered to be the previous node. The top node
+ argument constrains the walk to the node's children.</P>
+<H2 class="title"><A name="TYPES">Data Types</A></H2>
+<H3 class="typedef"><A name="mxml_attr_t">mxml_attr_t</A></H3>
+<P class="description">An XML element attribute value.</P>
+<P class="code"> typedef struct <A href="#mxml_attr_s">mxml_attr_s</A>
+ mxml_attr_t;</P>
+<H3 class="typedef"><A name="mxml_custom_destroy_cb_t">
+mxml_custom_destroy_cb_t</A></H3>
+<P class="description">Custom data destructor</P>
+<P class="code"> typedef void (*mxml_custom_destroy_cb_t)(void *);</P>
+<H3 class="typedef"><A name="mxml_custom_load_cb_t">
+mxml_custom_load_cb_t</A></H3>
+<P class="description">Custom data load callback function</P>
+<P class="code"> typedef int (*mxml_custom_load_cb_t)(<A href="#mxml_node_t">
+mxml_node_t</A> *, const char *);</P>
+<H3 class="typedef"><A name="mxml_custom_save_cb_t">
+mxml_custom_save_cb_t</A></H3>
+<P class="description">Custom data save callback function</P>
+<P class="code"> typedef char *(*mxml_custom_save_cb_t)(<A href="#mxml_node_t">
+mxml_node_t</A> *);</P>
+<H3 class="typedef"><A NAME="8_3_5">
+<!--span class=&quot;info&quot;-->
+&nbsp;Mini-XML 2.1&nbsp;<A name="mxml_custom_t">mxml_custom_t</A></A></H3>
+<P class="description">An XML custom value.</P>
+<P class="code"> typedef struct <A href="#mxml_custom_s">mxml_custom_s</A>
+ mxml_custom_t;</P>
+<H3 class="typedef"><A name="mxml_element_t">mxml_element_t</A></H3>
+<P class="description">An XML element value.</P>
+<P class="code"> typedef struct <A href="#mxml_element_s">mxml_element_s</A>
+ mxml_element_t;</P>
+<H3 class="typedef"><A name="mxml_entity_cb_t">mxml_entity_cb_t</A></H3>
+<P class="description">Entity callback function</P>
+<P class="code"> typedef int (*mxml_entity_cb_t)(const char *);</P>
+<H3 class="typedef"><A name="mxml_error_cb_t">mxml_error_cb_t</A></H3>
+<P class="description">Error callback function</P>
+<P class="code"> typedef void (*mxml_error_cb_t)(const char *);</P>
+<H3 class="typedef"><A name="mxml_index_t">mxml_index_t</A></H3>
+<P class="description">An XML node index.</P>
+<P class="code"> typedef struct <A href="#mxml_index_s">mxml_index_s</A>
+ mxml_index_t;</P>
+<H3 class="typedef"><A name="mxml_load_cb_t">mxml_load_cb_t</A></H3>
+<P class="description">Load callback function</P>
+<P class="code"> typedef <A href="#mxml_type_t">mxml_type_t</A>
+ (*mxml_load_cb_t)(<A href="#mxml_node_t">mxml_node_t</A> *);</P>
+<H3 class="typedef"><A name="mxml_node_t">mxml_node_t</A></H3>
+<P class="description">An XML node.</P>
+<P class="code"> typedef struct <A href="#mxml_node_s">mxml_node_s</A>
+ mxml_node_t;</P>
+<H3 class="typedef"><A name="mxml_save_cb_t">mxml_save_cb_t</A></H3>
+<P class="description">Save callback function</P>
+<P class="code"> typedef const char *(*mxml_save_cb_t)(<A href="#mxml_node_t">
+mxml_node_t</A> *, int);</P>
+<H3 class="typedef"><A name="mxml_sax_cb_t">mxml_sax_cb_t</A></H3>
+<P class="description">SAX callback function</P>
+<P class="code"> typedef void (*mxml_sax_cb_t)(<A href="#mxml_node_t">
+mxml_node_t</A> *, mxml_sax_event_t, void *);</P>
+<H3 class="typedef"><A name="mxml_sax_event_t">mxml_sax_event_t</A></H3>
+<P class="description">SAX event type.</P>
+<P class="code"> typedef enum <A href="#mxml_sax_event_e">
+mxml_sax_event_e</A> mxml_sax_event_t;</P>
+<H3 class="typedef"><A name="mxml_text_t">mxml_text_t</A></H3>
+<P class="description">An XML text value.</P>
+<P class="code"> typedef struct <A href="#mxml_text_s">mxml_text_s</A>
+ mxml_text_t;</P>
+<H3 class="typedef"><A name="mxml_type_t">mxml_type_t</A></H3>
+<P class="description">The XML node type.</P>
+<P class="code"> typedef enum <A href="#mxml_type_e">mxml_type_e</A>
+ mxml_type_t;</P>
+<H3 class="typedef"><A name="mxml_value_t">mxml_value_t</A></H3>
+<P class="description">An XML node value.</P>
+<P class="code"> typedef union <A href="#mxml_value_u">mxml_value_u</A>
+ mxml_value_t;</P>
+<H2 class="title"><A name="STRUCTURES">Structures</A></H2>
+<H3 class="struct"><A name="mxml_attr_s">mxml_attr_s</A></H3>
+<P class="description">An XML element attribute value.</P>
+<P class="code">struct mxml_attr_s {
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;char *name;
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;char *value;
+<BR> };</P>
+<H4 class="members">Members</H4>
+<DL>
+<DT>name</DT>
+<DD class="description">Attribute name</DD>
+<DT>value</DT>
+<DD class="description">Attribute value</DD>
+</DL>
+<H3 class="struct"><A NAME="8_4_2">
+<!--span class=&quot;info&quot;-->
+&nbsp;Mini-XML 2.1&nbsp;<A name="mxml_custom_s">mxml_custom_s</A></A></H3>
+<P class="description">An XML custom value.</P>
+<P class="code">struct mxml_custom_s {
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;void *data;
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_custom_destroy_cb_t">mxml_custom_destroy_cb_t</A>
+ destroy;
+<BR> };</P>
+<H4 class="members">Members</H4>
+<DL>
+<DT>data</DT>
+<DD class="description">Pointer to (allocated) custom data</DD>
+<DT>destroy</DT>
+<DD class="description">Pointer to destructor function</DD>
+</DL>
+<H3 class="struct"><A name="mxml_element_s">mxml_element_s</A></H3>
+<P class="description">An XML element value.</P>
+<P class="code">struct mxml_element_s {
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_attr_t">mxml_attr_t</A> *attrs;
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;char *name;
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;int num_attrs;
+<BR> };</P>
+<H4 class="members">Members</H4>
+<DL>
+<DT>attrs</DT>
+<DD class="description">Attributes</DD>
+<DT>name</DT>
+<DD class="description">Name of element</DD>
+<DT>num_attrs</DT>
+<DD class="description">Number of attributes</DD>
+</DL>
+<H3 class="struct"><A name="mxml_index_s">mxml_index_s</A></H3>
+<P class="description">An XML node index.</P>
+<P class="code">struct mxml_index_s {
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;int alloc_nodes;
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;char *attr;
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;int cur_node;
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_node_t">mxml_node_t</A> **nodes;
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;int num_nodes;
+<BR> };</P>
+<H4 class="members">Members</H4>
+<DL>
+<DT>alloc_nodes</DT>
+<DD class="description">Allocated nodes in index</DD>
+<DT>attr</DT>
+<DD class="description">Attribute used for indexing or NULL</DD>
+<DT>cur_node</DT>
+<DD class="description">Current node</DD>
+<DT>nodes</DT>
+<DD class="description">Node array</DD>
+<DT>num_nodes</DT>
+<DD class="description">Number of nodes in index</DD>
+</DL>
+<H3 class="struct"><A name="mxml_node_s">mxml_node_s</A></H3>
+<P class="description">An XML node.</P>
+<P class="code">struct mxml_node_s {
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;struct <A href="#mxml_node_s">mxml_node_s</A> *child;
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;struct <A href="#mxml_node_s">mxml_node_s</A> *last_child;
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;struct <A href="#mxml_node_s">mxml_node_s</A> *next;
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;struct <A href="#mxml_node_s">mxml_node_s</A> *parent;
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;struct <A href="#mxml_node_s">mxml_node_s</A> *prev;
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;int ref_count;
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_type_t">mxml_type_t</A> type;
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;void *user_data;
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_value_t">mxml_value_t</A> value;
+<BR> };</P>
+<H4 class="members">Members</H4>
+<DL>
+<DT>child</DT>
+<DD class="description">First child node</DD>
+<DT>last_child</DT>
+<DD class="description">Last child node</DD>
+<DT>next</DT>
+<DD class="description">Next node under same parent</DD>
+<DT>parent</DT>
+<DD class="description">Parent node</DD>
+<DT>prev</DT>
+<DD class="description">Previous node under same parent</DD>
+<DT>ref_count</DT>
+<DD class="description">Use count</DD>
+<DT>type</DT>
+<DD class="description">Node type</DD>
+<DT>user_data</DT>
+<DD class="description">User data</DD>
+<DT>value</DT>
+<DD class="description">Node value</DD>
+</DL>
+<H3 class="struct"><A name="mxml_text_s">mxml_text_s</A></H3>
+<P class="description">An XML text value.</P>
+<P class="code">struct mxml_text_s {
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;char *string;
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;int whitespace;
+<BR> };</P>
+<H4 class="members">Members</H4>
+<DL>
+<DT>string</DT>
+<DD class="description">Fragment string</DD>
+<DT>whitespace</DT>
+<DD class="description">Leading whitespace?</DD>
+</DL>
+<H2 class="title"><A name="UNIONS">Unions</A></H2>
+<H3 class="union"><A name="mxml_value_u">mxml_value_u</A></H3>
+<P class="description">An XML node value.</P>
+<P class="code">union mxml_value_u {
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_custom_t">mxml_custom_t</A> custom;
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_element_t">mxml_element_t</A> element;
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;int integer;
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;char *opaque;
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;double real;
+<BR> &nbsp;&nbsp;&nbsp;&nbsp;<A href="#mxml_text_t">mxml_text_t</A> text;
+<BR> };</P>
+<H4 class="members">Members</H4>
+<DL>
+<DT>custom
+<!--span class=&quot;info&quot;-->
+ &nbsp;Mini-XML 2.1&nbsp;</DT>
+<DD class="description">Custom data</DD>
+<DT>element</DT>
+<DD class="description">Element</DD>
+<DT>integer</DT>
+<DD class="description">Integer number</DD>
+<DT>opaque</DT>
+<DD class="description">Opaque string</DD>
+<DT>real</DT>
+<DD class="description">Real number</DD>
+<DT>text</DT>
+<DD class="description">Text fragment</DD>
+</DL>
+<H2 class="title"><A name="ENUMERATIONS">Constants</A></H2>
+<H3 class="enumeration"><A name="mxml_sax_event_e">mxml_sax_event_e</A></H3>
+<P class="description">SAX event type.</P>
+<H4 class="constants">Constants</H4>
+<DL>
+<DT>MXML_SAX_CDATA</DT>
+<DD class="description">CDATA node</DD>
+<DT>MXML_SAX_COMMENT</DT>
+<DD class="description">Comment node</DD>
+<DT>MXML_SAX_DATA</DT>
+<DD class="description">Data node</DD>
+<DT>MXML_SAX_DIRECTIVE</DT>
+<DD class="description">Processing directive node</DD>
+<DT>MXML_SAX_ELEMENT_CLOSE</DT>
+<DD class="description">Element closed</DD>
+<DT>MXML_SAX_ELEMENT_OPEN</DT>
+<DD class="description">Element opened</DD>
+</DL>
+<H3 class="enumeration"><A name="mxml_type_e">mxml_type_e</A></H3>
+<P class="description">The XML node type.</P>
+<H4 class="constants">Constants</H4>
+<DL>
+<DT>MXML_CUSTOM
+<!--span class=&quot;info&quot;-->
+ &nbsp;Mini-XML 2.1&nbsp;</DT>
+<DD class="description">Custom data</DD>
+<DT>MXML_ELEMENT</DT>
+<DD class="description">XML element with attributes</DD>
+<DT>MXML_IGNORE
+<!--span class=&quot;info&quot;-->
+ &nbsp;Mini-XML 2.3&nbsp;</DT>
+<DD class="description">Ignore/throw away node</DD>
+<DT>MXML_INTEGER</DT>
+<DD class="description">Integer value</DD>
+<DT>MXML_OPAQUE</DT>
+<DD class="description">Opaque string</DD>
+<DT>MXML_REAL</DT>
+<DD class="description">Real value</DD>
+<DT>MXML_TEXT</DT>
+<DD class="description">Text fragment</DD>
+</DL>
+</UL>
+</DIV><HR NOSHADE>
+<H1 align="right"><A name="SCHEMA"><IMG align="right" alt="D" height="100"
+hspace="10" src="D.gif" width="100"></A>XML Schema</H1>
+<P>This appendix provides the XML schema that is used for the XML files
+ produced by <TT>mxmldoc</TT>. This schema is available on-line at:</P>
+<PRE>
+ http://www.easysw.com/~mike/mxmldoc.xsd
+</PRE>
+<H2><A NAME="9_1">mxmldoc.xsd</A></H2>
+<PRE><SMALL>
+&lt;?xml version=&quot;1.0&quot;?&gt;
+&lt;xsd:schema xmlns:xsd=&quot;http://www.w3.org/2001/XMLSchema&quot;&gt;
+ &lt;xsd:annotation&gt;
+ &lt;xsd:documentation xml:lang=&quot;en&quot;&gt;
+ Mini-XML 2.3 documentation schema for mxmldoc output.
+ Copyright 2003-2007 by Michael Sweet.
+ &lt;/xsd:documentation&gt;
+ &lt;/xsd:annotation&gt;
+
+ &lt;!-- basic element definitions --&gt;
+ &lt;xsd:element name=&quot;argument&quot; type=&quot;argumentType&quot;/&gt;
+ &lt;xsd:element name=&quot;class&quot; type=&quot;classType&quot;/&gt;
+ &lt;xsd:element name=&quot;constant&quot; type=&quot;constantType&quot;/&gt;
+ &lt;xsd:element name=&quot;description&quot; type=&quot;xsd:string&quot;/&gt;
+ &lt;xsd:element name=&quot;enumeration&quot; type=&quot;enumerationType&quot;/&gt;
+ &lt;xsd:element name=&quot;function&quot; type=&quot;functionType&quot;/&gt;
+ &lt;xsd:element name=&quot;mxmldoc&quot; type=&quot;mxmldocType&quot;/&gt;
+ &lt;xsd:element name=&quot;namespace&quot; type=&quot;namespaceType&quot;/&gt;
+ &lt;xsd:element name=&quot;returnvalue&quot; type=&quot;returnvalueType&quot;/&gt;
+ &lt;xsd:element name=&quot;seealso&quot; type=&quot;identifierList&quot;/&gt;
+ &lt;xsd:element name=&quot;struct&quot; type=&quot;structType&quot;/&gt;
+ &lt;xsd:element name=&quot;typedef&quot; type=&quot;typedefType&quot;/&gt;
+ &lt;xsd:element name=&quot;type&quot; type=&quot;xsd:string&quot;/&gt;
+ &lt;xsd:element name=&quot;union&quot; type=&quot;unionType&quot;/&gt;
+ &lt;xsd:element name=&quot;variable&quot; type=&quot;variableType&quot;/&gt;
+
+ &lt;!-- descriptions of complex elements --&gt;
+ &lt;xsd:complexType name=&quot;argumentType&quot;&gt;
+ &lt;xsd:sequence&gt;
+ &lt;xsd:element ref=&quot;type&quot; minOccurs=&quot;1&quot; maxOccurs=&quot;1&quot;/&gt;
+ &lt;xsd:element ref=&quot;description&quot; minOccurs=&quot;0&quot; maxOccurs=&quot;1&quot;/&gt;
+ &lt;/xsd:sequence&gt;
+ &lt;xsd:attribute name=&quot;default&quot; type=&quot;xsd:string&quot; use=&quot;optional&quot;/&gt;
+ &lt;xsd:attribute name=&quot;name&quot; type=&quot;identifier&quot; use=&quot;required&quot;/&gt;
+ &lt;xsd:attribute name=&quot;direction&quot; type=&quot;direction&quot; use=&quot;optional&quot;
+ default=&quot;I&quot;/&gt;
+ &lt;/xsd:complexType&gt;
+
+ &lt;xsd:complexType name=&quot;classType&quot;&gt;
+ &lt;xsd:sequence&gt;
+ &lt;xsd:element ref=&quot;description&quot; minOccurs=&quot;0&quot; maxOccurs=&quot;1&quot;/&gt;
+ &lt;xsd:choice minOccurs=&quot;0&quot; maxOccurs=&quot;unbounded&quot;&gt;
+ &lt;xsd:element ref=&quot;class&quot;/&gt;
+ &lt;xsd:element ref=&quot;enumeration&quot;/&gt;
+ &lt;xsd:element ref=&quot;function&quot;/&gt;
+ &lt;xsd:element ref=&quot;struct&quot;/&gt;
+ &lt;xsd:element ref=&quot;typedef&quot;/&gt;
+ &lt;xsd:element ref=&quot;union&quot;/&gt;
+ &lt;xsd:element ref=&quot;variable&quot;/&gt;
+ &lt;/xsd:choice&gt;
+ &lt;/xsd:sequence&gt;
+ &lt;xsd:attribute name=&quot;name&quot; type=&quot;identifier&quot; use=&quot;required&quot;/&gt;
+ &lt;xsd:attribute name=&quot;parent&quot; type=&quot;xsd:string&quot; use=&quot;optional&quot;/&gt;
+ &lt;/xsd:complexType&gt;
+
+ &lt;xsd:complexType name=&quot;constantType&quot;&gt;
+ &lt;xsd:sequence&gt;
+ &lt;xsd:element ref=&quot;description&quot; minOccurs=&quot;0&quot; maxOccurs=&quot;1&quot;/&gt;
+ &lt;/xsd:sequence&gt;
+ &lt;xsd:attribute name=&quot;name&quot; type=&quot;identifier&quot; use=&quot;required&quot;/&gt;
+ &lt;/xsd:complexType&gt;
+
+ &lt;xsd:complexType name=&quot;enumerationType&quot;&gt;
+ &lt;xsd:sequence&gt;
+ &lt;xsd:element ref=&quot;description&quot; minOccurs=&quot;0&quot; maxOccurs=&quot;1&quot;/&gt;
+ &lt;xsd:element ref=&quot;constant&quot; minOccurs=&quot;1&quot; maxOccurs=&quot;unbounded&quot;/&gt;
+ &lt;/xsd:sequence&gt;
+ &lt;xsd:attribute name=&quot;name&quot; type=&quot;identifier&quot; use=&quot;required&quot;/&gt;
+ &lt;/xsd:complexType&gt;
+
+ &lt;xsd:complexType name=&quot;functionType&quot;&gt;
+ &lt;xsd:sequence&gt;
+ &lt;xsd:element ref=&quot;returnvalue&quot; minOccurs=&quot;0&quot; maxOccurs=&quot;1&quot;/&gt;
+ &lt;xsd:element ref=&quot;description&quot; minOccurs=&quot;0&quot; maxOccurs=&quot;1&quot;/&gt;
+ &lt;xsd:element ref=&quot;argument&quot; minOccurs=&quot;1&quot; maxOccurs=&quot;unbounded&quot;/&gt;
+ &lt;xsd:element ref=&quot;seealso&quot; minOccurs=&quot;0&quot; maxOccurs=&quot;1&quot;/&gt;
+ &lt;/xsd:sequence&gt;
+ &lt;xsd:attribute name=&quot;name&quot; type=&quot;identifier&quot; use=&quot;required&quot;/&gt;
+ &lt;xsd:attribute name=&quot;scope&quot; type=&quot;scope&quot; use=&quot;optional&quot;/&gt;
+ &lt;/xsd:complexType&gt;
+
+ &lt;xsd:complexType name=&quot;mxmldocType&quot;&gt;
+ &lt;xsd:choice minOccurs=&quot;0&quot; maxOccurs=&quot;unbounded&quot;&gt;
+ &lt;xsd:element ref=&quot;class&quot;/&gt;
+ &lt;xsd:element ref=&quot;enumeration&quot;/&gt;
+ &lt;xsd:element ref=&quot;function&quot;/&gt;
+ &lt;xsd:element ref=&quot;namespace&quot;/&gt;
+ &lt;xsd:element ref=&quot;struct&quot;/&gt;
+ &lt;xsd:element ref=&quot;typedef&quot;/&gt;
+ &lt;xsd:element ref=&quot;union&quot;/&gt;
+ &lt;xsd:element ref=&quot;variable&quot;/&gt;
+ &lt;/xsd:choice&gt;
+ &lt;/xsd:complexType&gt;
+
+ &lt;xsd:complexType name=&quot;namespaceType&quot;&gt;
+ &lt;xsd:sequence&gt;
+ &lt;xsd:element ref=&quot;description&quot; minOccurs=&quot;0&quot; maxOccurs=&quot;1&quot;/&gt;
+ &lt;xsd:choice minOccurs=&quot;0&quot; maxOccurs=&quot;unbounded&quot;&gt;
+ &lt;xsd:element ref=&quot;class&quot;/&gt;
+ &lt;xsd:element ref=&quot;enumeration&quot;/&gt;
+ &lt;xsd:element ref=&quot;function&quot;/&gt;
+ &lt;xsd:element ref=&quot;struct&quot;/&gt;
+ &lt;xsd:element ref=&quot;typedef&quot;/&gt;
+ &lt;xsd:element ref=&quot;union&quot;/&gt;
+ &lt;xsd:element ref=&quot;variable&quot;/&gt;
+ &lt;/xsd:choice&gt;
+ &lt;/xsd:sequence&gt;
+ &lt;xsd:attribute name=&quot;name&quot; type=&quot;identifier&quot; use=&quot;required&quot;/&gt;
+ &lt;/xsd:complexType&gt;
+
+ &lt;xsd:complexType name=&quot;returnvalueType&quot;&gt;
+ &lt;xsd:sequence&gt;
+ &lt;xsd:element ref=&quot;type&quot; minOccurs=&quot;1&quot; maxOccurs=&quot;1&quot;/&gt;
+ &lt;xsd:element ref=&quot;description&quot; minOccurs=&quot;0&quot; maxOccurs=&quot;1&quot;/&gt;
+ &lt;/xsd:sequence&gt;
+ &lt;/xsd:complexType&gt;
+
+ &lt;xsd:complexType name=&quot;structType&quot;&gt;
+ &lt;xsd:sequence&gt;
+ &lt;xsd:element ref=&quot;description&quot; minOccurs=&quot;0&quot; maxOccurs=&quot;1&quot;/&gt;
+ &lt;xsd:choice minOccurs=&quot;0&quot; maxOccurs=&quot;unbounded&quot;&gt;
+ &lt;xsd:element ref=&quot;variable&quot;/&gt;
+ &lt;xsd:element ref=&quot;function&quot;/&gt;
+ &lt;/xsd:choice&gt;
+ &lt;/xsd:sequence&gt;
+ &lt;xsd:attribute name=&quot;name&quot; type=&quot;identifier&quot; use=&quot;required&quot;/&gt;
+ &lt;/xsd:complexType&gt;
+
+ &lt;xsd:complexType name=&quot;typedefType&quot;&gt;
+ &lt;xsd:sequence&gt;
+ &lt;xsd:element ref=&quot;type&quot; minOccurs=&quot;1&quot; maxOccurs=&quot;1&quot;/&gt;
+ &lt;xsd:element ref=&quot;description&quot; minOccurs=&quot;0&quot; maxOccurs=&quot;1&quot;/&gt;
+ &lt;/xsd:sequence&gt;
+ &lt;xsd:attribute name=&quot;name&quot; type=&quot;identifier&quot; use=&quot;required&quot;/&gt;
+ &lt;/xsd:complexType&gt;
+
+ &lt;xsd:complexType name=&quot;unionType&quot;&gt;
+ &lt;xsd:sequence&gt;
+ &lt;xsd:element ref=&quot;description&quot; minOccurs=&quot;0&quot; maxOccurs=&quot;1&quot;/&gt;
+ &lt;xsd:element ref=&quot;variable&quot; minOccurs=&quot;0&quot; maxOccurs=&quot;unbounded&quot;/&gt;
+ &lt;/xsd:sequence&gt;
+ &lt;xsd:attribute name=&quot;name&quot; type=&quot;identifier&quot; use=&quot;required&quot;/&gt;
+ &lt;/xsd:complexType&gt;
+
+ &lt;xsd:complexType name=&quot;variableType&quot;&gt;
+ &lt;xsd:sequence&gt;
+ &lt;xsd:element ref=&quot;type&quot; minOccurs=&quot;1&quot; maxOccurs=&quot;1&quot;/&gt;
+ &lt;xsd:element ref=&quot;description&quot; minOccurs=&quot;0&quot; maxOccurs=&quot;1&quot;/&gt;
+ &lt;/xsd:sequence&gt;
+ &lt;xsd:attribute name=&quot;name&quot; type=&quot;identifier&quot; use=&quot;required&quot;/&gt;
+ &lt;/xsd:complexType&gt;
+
+ &lt;!-- data types --&gt;
+ &lt;xsd:simpleType name=&quot;direction&quot;&gt;
+ &lt;xsd:restriction base=&quot;xsd:string&quot;&gt;
+ &lt;xsd:enumeration value=&quot;I&quot;/&gt;
+ &lt;xsd:enumeration value=&quot;O&quot;/&gt;
+ &lt;xsd:enumeration value=&quot;IO&quot;/&gt;
+ &lt;/xsd:restriction&gt;
+ &lt;/xsd:simpleType&gt;
+
+ &lt;xsd:simpleType name=&quot;identifier&quot;&gt;
+ &lt;xsd:restriction base=&quot;xsd:string&quot;&gt;
+ &lt;xsd:pattern value=&quot;[a-zA-Z_(.]([a-zA-Z_(.,)* 0-9])*&quot;/&gt;
+ &lt;/xsd:restriction&gt;
+ &lt;/xsd:simpleType&gt;
+
+ &lt;xsd:simpleType name=&quot;identifierList&quot;&gt;
+ &lt;xsd:list itemType=&quot;identifier&quot;/&gt;
+ &lt;/xsd:simpleType&gt;
+
+ &lt;xsd:simpleType name=&quot;scope&quot;&gt;
+ &lt;xsd:restriction base=&quot;xsd:string&quot;&gt;
+ &lt;xsd:enumeration value=&quot;&quot;/&gt;
+ &lt;xsd:enumeration value=&quot;private&quot;/&gt;
+ &lt;xsd:enumeration value=&quot;protected&quot;/&gt;
+ &lt;xsd:enumeration value=&quot;public&quot;/&gt;
+ &lt;/xsd:restriction&gt;
+ &lt;/xsd:simpleType&gt;
+&lt;/xsd:schema&gt;
+</SMALL></PRE>
+</BODY>
+</HTML>
diff -Naur mxml-2.6/doc/mxmldoc.html mxml-2.6-haiku/doc/mxmldoc.html
--- mxml-2.6/doc/mxmldoc.html 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/mxmldoc.html 2009-05-17 06:04:58.000000000 +0000
@@ -0,0 +1,204 @@
+<html>
+<body>
+
+<h1 align='right'><a name='MXMLDOC'><img src="4.gif" align="right"
+hspace="10" width="100" height="100" alt="4"></a>Using the mxmldoc
+Utility</h1>
+
+<p>This chapter describes how to use <tt>mxmldoc(1)</tt> program to
+automatically generate documentation from C and C++ source
+files.</p>
+
+
+<h2>The Basics</h2>
+
+<p>Originally developed to generate the Mini-XML and CUPS API
+documentation, <tt>mxmldoc</tt> is now a general-purpose utility
+which scans C and C++ source files to produce HTML and man page
+documentation along with an XML file representing the functions,
+types, and definitions in those source files. Unlike popular
+documentation generators like Doxygen or Javadoc, <tt>mxmldoc</tt>
+uses in-line comments rather than comment headers, allowing for more
+"natural" code documentation.</p>
+
+<p>By default, <tt>mxmldoc</tt> produces HTML documentation. For
+example, the following command will scan all of the C source and
+header files in the current directory and produce a HTML
+documentation file called <var>filename.html</var>:</p>
+
+<pre>
+ <kbd>mxmldoc *.h *.c &gt;filename.html ENTER</kbd>
+</pre>
+
+<p>You can also specify an XML file to create which contains all of
+the information from the source files. For example, the following
+command creates an XML file called <var>filename.xml</var> in
+addition to the HTML file:</p>
+
+<pre>
+ <kbd>mxmldoc filename.xml *.h *.c &gt;filename.html ENTER</kbd>
+</pre>
+
+<p>The <tt>--no-output</tt> option disables the normal HTML
+output:</p>
+
+<pre>
+ <kbd>mxmldoc --no-output filename.xml *.h *.c ENTER</kbd>
+</pre>
+
+<p>You can then run <tt>mxmldoc</tt> again with the XML file alone
+to generate the HTML documentation:</p>
+
+<pre>
+ <kbd>mxmldoc filename.xml &gt;filename.html ENTER</kbd>
+</pre>
+
+<h3>Creating Man Pages</h3>
+
+<p>The <tt>--man filename</tt> option tells <tt>mxmldoc</tt> to
+create a man page instead of HTML documentation, for example:</p>
+
+<pre>
+ <kbd>mxmldoc --man filename filename.xml \
+ &gt;filename.man ENTER</kbd>
+
+ <kbd>mxmldoc --man filename *.h *.c \
+ &gt;filename.man ENTER</kbd>
+</pre>
+
+<h3>Creating Xcode Documentation Sets</h3>
+
+<p>The <tt>--docset directory.docset</tt> option tells <tt>mxmldoc</tt> to
+create an Xcode documentation set containing the HTML documentation, for
+example:</p>
+
+<pre>
+ <kbd>mxmldoc --docset foo.docset *.h *.c foo.xml ENTER</kbd>
+</pre>
+
+<p>Xcode documentation sets can only be built on Mac OS X with Xcode 3.0 or
+higher installed.</p>
+
+
+<h2>Commenting Your Code</h2>
+
+<p>As noted previously, <tt>mxmldoc</tt> looks for in-line comments
+to describe the functions, types, and constants in your code.
+<tt>Mxmldoc</tt> will document all public names it finds in your
+source files - any names starting with the underscore character (_)
+or names that are documented with the <A
+HREF="#ATDIRECTIVES">@private@</A> directive are treated as private
+and are undocumented.</p>
+
+<p>Comments appearing directly before a function or type definition
+are used to document that function or type. Comments appearing after
+argument, definition, return type, or variable declarations are used
+to document that argument, definition, return type, or variable. For
+example, the following code excerpt defines a key/value structure
+and a function that creates a new instance of that structure:</p>
+
+<pre>
+ /* A key/value pair. This is used with the
+ dictionary structure. */
+
+ struct keyval
+ {
+ char *key; /* Key string */
+ char *val; /* Value string */
+ };
+
+ /* Create a new key/value pair. */
+
+ struct keyval * /* New key/value pair */
+ new_keyval(
+ const char *key, /* Key string */
+ const char *val) /* Value string */
+ {
+ ...
+ }
+</pre>
+
+<p><tt>Mxmldoc</tt> also knows to remove extra asterisks (*) from
+the comment string, so the comment string:</p>
+
+<pre>
+ /*
+ * Compute the value of PI.
+ *
+ * The function connects to an Internet server
+ * that streams audio of mathematical monks
+ * chanting the first 100 digits of PI.
+ */
+</pre>
+
+<p>will be shown as:</p>
+
+<pre>
+ Compute the value of PI.
+
+ The function connects to an Internet server
+ that streams audio of mathematical monks
+ chanting the first 100 digits of PI.
+</pre>
+
+<p><a name="ATDIRECTIVES">Comments</a> can also include the
+following special <tt>@name ...@</tt> directive strings:</p>
+
+<ul>
+
+ <li><tt>@deprecated@</tt> - flags the item as deprecated to
+ discourage its use</li>
+
+ <li><tt>@private@</tt> - flags the item as private so it
+ will not be included in the documentation</li>
+
+ <li><tt>@since ...@</tt> - flags the item as new since a
+ particular release. The text following the <tt>@since</tt>
+ up to the closing <tt>@</tt> is highlighted in the generated
+ documentation, e.g. <tt>@since CUPS 1.3@</tt>.</li>
+
+</ul>
+
+
+<!-- NEED 10 -->
+<h2>Titles, Sections, and Introductions</h2>
+
+<p><tt>Mxmldoc</tt> also provides options to set the title, section,
+and introduction text for the generated documentation. The
+<tt>--title text</tt> option specifies the title for the
+documentation. The title string is usually put in quotes:</p>
+
+<pre>
+ <kbd>mxmldoc filename.xml \
+ --title "My Famous Documentation" \
+ &gt;filename.html ENTER</kbd>
+</pre>
+
+<p>The <tt>--section name</tt> option specifies the section for
+the documentation. For HTML documentation, the name is placed in
+a HTML comment such as:</p>
+
+<pre>
+ &lt;!-- SECTION: name -->
+</pre>
+
+<p>For man pages, the section name is usually just a number ("3"),
+or a number followed by a vendor name ("3acme"). The section name is
+used in the <tt>.TH</tt> directive in the man page:</p>
+
+<pre>
+ .TH mylibrary 3acme "My Title" ...
+</pre>
+
+<p>The default section name for man page output is "3". There is no
+default section name for HTML output.</p>
+
+<p>Finally, the <tt>--intro filename</tt> option specifies a file to
+embed after the title and section but before the generated
+documentation. For HTML documentation, the file must consist of
+valid HTML without the usual <tt>DOCTYPE</tt>, <tt>html</tt>, and
+<tt>body</tt> elements. For man page documentation, the file must
+consist of valid <tt>nroff(1)</tt> text.</p>
+
+</body>
+</html>
diff -Naur mxml-2.6/doc/mxmldoc.man mxml-2.6-haiku/doc/mxmldoc.man
--- mxml-2.6/doc/mxmldoc.man 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/mxmldoc.man 2009-05-05 13:38:00.000000000 +0000
@@ -0,0 +1,198 @@
+.\"
+.\" "$Id: mxmldoc.man 390 2009-05-05 13:38:00Z mike $"
+.\"
+.\" mxmldoc man page for mini-XML, a small XML-like file parsing library.
+.\"
+.\" Copyright 2003-2009 by Michael Sweet.
+.\"
+.\" This program is free software; you can redistribute it and/or
+.\" modify it under the terms of the GNU Library General Public
+.\" License as published by the Free Software Foundation; either
+.\" version 2, or (at your option) any later version.
+.\"
+.\" This program is distributed in the hope that it will be useful,
+.\" but WITHOUT ANY WARRANTY; without even the implied warranty of
+.\" MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+.\" GNU General Public License for more details.
+.\"
+.TH mxmldoc 1 "Mini-XML" "4 May 2009" "Michael Sweet"
+.SH NAME
+mxmldoc \- mini-xml documentation generator
+.SH SYNOPSIS
+.B mxmldoc
+\-\-no-output [
+.I filename.xml
+]
+.I source file(s)
+]
+.br
+.B mxmldoc
+[ \-\-footer
+.I footerfile
+] [ \-\-header
+.I headerfile
+] [ \-\-intro
+.I introfile
+] [ \-\-section
+.I section
+] [ \-\-title
+.I title
+] [
+.I filename.xml
+] [
+.I source file(s)
+] >
+.I filename.html
+.br
+.B mxmldoc
+\-\-docset
+.I directory.docset
+[ \-\-docversion
+.I version
+] [ \-\-feedname
+.I name
+] [ \-\-feedurl
+.I url
+] [ \-\-footer
+.I footerfile
+] [ \-\-header
+.I headerfile
+] [ \-\-intro
+.I introfile
+] [ \-\-section
+.I section
+] [ \-\-title
+.I title
+] [
+.I filename.xml
+] [
+.I source file(s)
+]
+.br
+.B mxmldoc
+\-\-tokens
+.I path
+[
+.I filename.xml
+] [
+.I source file(s)
+] > tokens.xml
+.br
+.B mxmldoc
+\-\-framed
+.I basename
+[ \-\-footer
+.I footerfile
+] [ \-\-header
+.I headerfile
+] [ \-\-intro
+.I introfile
+] [ \-\-section
+.I section
+] [ \-\-title
+.I title
+] [
+.I filename.xml
+] [
+.I source file(s)
+]
+.br
+.B mxmldoc
+[ \-\-footer
+.I footerfile
+] [ \-\-header
+.I headerfile
+] [ \-\-intro
+.I introfile
+] \-\-man
+.I manpage
+[ \-\-section
+.I section
+] [ \-\-title
+.I title
+] [
+.I filename.xml
+] [
+.I source file(s)
+] >
+.I filename.man
+.SH DESCRIPTION
+\fImxmldoc\fR scans the specified C and C++ source files to produce
+an XML representation of globally accessible classes, constants,
+enumerations, functions, structures, typedefs, unions, and variables
+- the XML file is updated as necessary. By default, a HTML
+representation of the XML file is written to the standard output.
+Use the \fI\-\-no-output\fR option to disable the HTML output.
+.PP
+Man page source can be generated using the \fI\-\-man\fR option.
+.PP
+If no source files are specified then the current XML file is
+converted to the standard output.
+.PP
+In general, any C or C++ source code is handled by \fImxmldoc\fR,
+however it was specifically written to handle code with
+documentation that is formatted according to the CUPS Developer
+Guide which is available at "http://www.cups.org/documentation.php".
+.SH OPTIONS
+.TP 5
+\-\-docset directory.docset
+.br
+Creates an Xcode documentation set in the specified directory.
+.TP 5
+\-\-docversion version
+.br
+Specifies the version number for the Xcode documentation set.
+.TP 5
+\-\-feedname name
+.br
+Specifies the Xcode documentation set feed name, typically the project or
+company name.
+.TP 5
+\-\-feedurl url
+.br
+Specifies the Xcode documentation set feed URL which must point to an ATOM file
+linking to updates.
+.TP 5
+\-\-footer footerfile
+.br
+Inserts the specified file at the bottom of the output documentation.
+.TP 5
+\-\-framed basename
+.br
+Creates HTML documentation using frames - one for the table-of-contents and
+one for the body.
+.TP 5
+\-\-header headerfile
+.br
+Inserts the specified file at the top of the output documentation.
+.TP 5
+\-\-intro introfile
+.br
+Inserts the specified file before the table of contents.
+.TP 5
+\-\-man manpage
+.br
+Generated a man page instead of HTML documentation.
+.TP 5
+\-\-no-output
+.br
+Disables generation of documentation on the standard output.
+.TP 5
+\-\-section section
+.br
+Sets the section/keywords in the output documentation.
+.TP 5
+\-\-title title
+.br
+Sets the title of the output documentation.
+.TP 5
+\-\-tokens
+.br
+Generates a Tokens.xml file for use with the Xcode documentation tools.
+.SH SEE ALSO
+mxml(3), Mini-XML Programmers Manual, http://www.minixml.org/
+.SH COPYRIGHT
+Copyright 2003-2009 by Michael Sweet.
+.\"
+.\" End of "$Id: mxmldoc.man 390 2009-05-05 13:38:00Z mike $".
+.\"
diff -Naur mxml-2.6/doc/mxmldoc.xsd mxml-2.6-haiku/doc/mxmldoc.xsd
--- mxml-2.6/doc/mxmldoc.xsd 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/mxmldoc.xsd 2007-04-18 19:25:26.000000000 +0000
@@ -0,0 +1,189 @@
+<?xml version="1.0"?>
+<xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema">
+ <xsd:annotation>
+ <xsd:documentation xml:lang="en">
+ Mini-XML 2.3 documentation schema for mxmldoc output.
+ Copyright 2003-2007 by Michael Sweet.
+
+ This program is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Library General Public
+ License as published by the Free Software Foundation; either
+ version 2, or (at your option) any later version.
+
+ This program is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+ GNU General Public License for more details.
+ </xsd:documentation>
+ </xsd:annotation>
+
+ <!-- basic element definitions -->
+ <xsd:element name="argument" type="argumentType"/>
+ <xsd:element name="class" type="classType"/>
+ <xsd:element name="constant" type="constantType"/>
+ <xsd:element name="description" type="xsd:string"/>
+ <xsd:element name="enumeration" type="enumerationType"/>
+ <xsd:element name="function" type="functionType"/>
+ <xsd:element name="mxmldoc" type="mxmldocType"/>
+ <xsd:element name="namespace" type="namespaceType"/>
+ <xsd:element name="returnvalue" type="returnvalueType"/>
+ <xsd:element name="seealso" type="identifierList"/>
+ <xsd:element name="struct" type="structType"/>
+ <xsd:element name="typedef" type="typedefType"/>
+ <xsd:element name="type" type="xsd:string"/>
+ <xsd:element name="union" type="unionType"/>
+ <xsd:element name="variable" type="variableType"/>
+
+ <!-- descriptions of complex elements -->
+ <xsd:complexType name="argumentType">
+ <xsd:sequence>
+ <xsd:element ref="type" minOccurs="1" maxOccurs="1"/>
+ <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+ </xsd:sequence>
+ <xsd:attribute name="default" type="xsd:string" use="optional"/>
+ <xsd:attribute name="name" type="identifier" use="required"/>
+ <xsd:attribute name="direction" type="direction" use="optional" default="I"/>
+ </xsd:complexType>
+
+ <xsd:complexType name="classType">
+ <xsd:sequence>
+ <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+ <xsd:choice minOccurs="0" maxOccurs="unbounded">
+ <xsd:element ref="class"/>
+ <xsd:element ref="enumeration"/>
+ <xsd:element ref="function"/>
+ <xsd:element ref="struct"/>
+ <xsd:element ref="typedef"/>
+ <xsd:element ref="union"/>
+ <xsd:element ref="variable"/>
+ </xsd:choice>
+ </xsd:sequence>
+ <xsd:attribute name="name" type="identifier" use="required"/>
+ <xsd:attribute name="parent" type="xsd:string" use="optional"/>
+ </xsd:complexType>
+
+ <xsd:complexType name="constantType">
+ <xsd:sequence>
+ <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+ </xsd:sequence>
+ <xsd:attribute name="name" type="identifier" use="required"/>
+ </xsd:complexType>
+
+ <xsd:complexType name="enumerationType">
+ <xsd:sequence>
+ <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+ <xsd:element ref="constant" minOccurs="1" maxOccurs="unbounded"/>
+ </xsd:sequence>
+ <xsd:attribute name="name" type="identifier" use="required"/>
+ </xsd:complexType>
+
+ <xsd:complexType name="functionType">
+ <xsd:sequence>
+ <xsd:element ref="returnvalue" minOccurs="0" maxOccurs="1"/>
+ <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+ <xsd:element ref="argument" minOccurs="1" maxOccurs="unbounded"/>
+ <xsd:element ref="seealso" minOccurs="0" maxOccurs="1"/>
+ </xsd:sequence>
+ <xsd:attribute name="name" type="identifier" use="required"/>
+ <xsd:attribute name="scope" type="scope" use="optional"/>
+ </xsd:complexType>
+
+ <xsd:complexType name="mxmldocType">
+ <xsd:choice minOccurs="0" maxOccurs="unbounded">
+ <xsd:element ref="class"/>
+ <xsd:element ref="enumeration"/>
+ <xsd:element ref="function"/>
+ <xsd:element ref="namespace"/>
+ <xsd:element ref="struct"/>
+ <xsd:element ref="typedef"/>
+ <xsd:element ref="union"/>
+ <xsd:element ref="variable"/>
+ </xsd:choice>
+ </xsd:complexType>
+
+ <xsd:complexType name="namespaceType">
+ <xsd:sequence>
+ <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+ <xsd:choice minOccurs="0" maxOccurs="unbounded">
+ <xsd:element ref="class"/>
+ <xsd:element ref="enumeration"/>
+ <xsd:element ref="function"/>
+ <xsd:element ref="struct"/>
+ <xsd:element ref="typedef"/>
+ <xsd:element ref="union"/>
+ <xsd:element ref="variable"/>
+ </xsd:choice>
+ </xsd:sequence>
+ <xsd:attribute name="name" type="identifier" use="required"/>
+ </xsd:complexType>
+
+ <xsd:complexType name="returnvalueType">
+ <xsd:sequence>
+ <xsd:element ref="type" minOccurs="1" maxOccurs="1"/>
+ <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+ </xsd:sequence>
+ </xsd:complexType>
+
+ <xsd:complexType name="structType">
+ <xsd:sequence>
+ <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+ <xsd:choice minOccurs="0" maxOccurs="unbounded">
+ <xsd:element ref="variable"/>
+ <xsd:element ref="function"/>
+ </xsd:choice>
+ </xsd:sequence>
+ <xsd:attribute name="name" type="identifier" use="required"/>
+ </xsd:complexType>
+
+ <xsd:complexType name="typedefType">
+ <xsd:sequence>
+ <xsd:element ref="type" minOccurs="1" maxOccurs="1"/>
+ <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+ </xsd:sequence>
+ <xsd:attribute name="name" type="identifier" use="required"/>
+ </xsd:complexType>
+
+ <xsd:complexType name="unionType">
+ <xsd:sequence>
+ <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+ <xsd:element ref="variable" minOccurs="0" maxOccurs="unbounded"/>
+ </xsd:sequence>
+ <xsd:attribute name="name" type="identifier" use="required"/>
+ </xsd:complexType>
+
+ <xsd:complexType name="variableType">
+ <xsd:sequence>
+ <xsd:element ref="type" minOccurs="1" maxOccurs="1"/>
+ <xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+ </xsd:sequence>
+ <xsd:attribute name="name" type="identifier" use="required"/>
+ </xsd:complexType>
+
+ <!-- data types -->
+ <xsd:simpleType name="direction">
+ <xsd:restriction base="xsd:string">
+ <xsd:enumeration value="I"/>
+ <xsd:enumeration value="O"/>
+ <xsd:enumeration value="IO"/>
+ </xsd:restriction>
+ </xsd:simpleType>
+
+ <xsd:simpleType name="identifier">
+ <xsd:restriction base="xsd:string">
+ <xsd:pattern value="[a-zA-Z_(.]([a-zA-Z_(.,)* 0-9])*"/>
+ </xsd:restriction>
+ </xsd:simpleType>
+
+ <xsd:simpleType name="identifierList">
+ <xsd:list itemType="identifier"/>
+ </xsd:simpleType>
+
+ <xsd:simpleType name="scope">
+ <xsd:restriction base="xsd:string">
+ <xsd:enumeration value=""/>
+ <xsd:enumeration value="private"/>
+ <xsd:enumeration value="protected"/>
+ <xsd:enumeration value="public"/>
+ </xsd:restriction>
+ </xsd:simpleType>
+</xsd:schema>
diff -Naur mxml-2.6/doc/reference.heading mxml-2.6-haiku/doc/reference.heading
--- mxml-2.6/doc/reference.heading 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/reference.heading 2008-01-26 20:50:28.000000000 +0000
@@ -0,0 +1,4 @@
+<h1 align='right'><a name='REFERENCE'><img src="C.gif" align="right"
+hspace="10" width="100" height="100" alt="C"></a>Library
+Reference</h1>
+
diff -Naur mxml-2.6/doc/reference.html mxml-2.6-haiku/doc/reference.html
--- mxml-2.6/doc/reference.html 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/reference.html 2009-10-26 02:35:54.000000000 +0000
@@ -0,0 +1,1635 @@
+<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">
+<html>
+<head>
+<title>Documentation</title>
+<meta name="creator" content="Mini-XML v2.6">
+<style type="text/css"><!--
+body, p, h1, h2, h3, h4 {
+ font-family: lucida grande, geneva, helvetica, arial, sans-serif;
+}
+div.body h1 {
+ font-size: 250%;
+ font-weight: bold;
+ margin: 0;
+}
+div.body h2 {
+ font-size: 250%;
+ margin-top: 1.5em;
+}
+div.body h3 {
+ font-size: 150%;
+ margin-bottom: 0.5em;
+ margin-top: 1.5em;
+}
+div.body h4 {
+ font-size: 110%;
+ margin-bottom: 0.5em;
+ margin-top: 1.5em;
+}
+div.body h5 {
+ font-size: 100%;
+ margin-bottom: 0.5em;
+ margin-top: 1.5em;
+}
+div.contents {
+ background: #e8e8e8;
+ border: solid thin black;
+ padding: 10px;
+}
+div.contents h1 {
+ font-size: 110%;
+}
+div.contents h2 {
+ font-size: 100%;
+}
+div.contents ul.contents {
+ font-size: 80%;
+}
+.class {
+ border-bottom: solid 2px gray;
+}
+.constants {
+}
+.description {
+ margin-top: 0.5em;
+}
+.discussion {
+}
+.enumeration {
+ border-bottom: solid 2px gray;
+}
+.function {
+ border-bottom: solid 2px gray;
+ margin-bottom: 0;
+}
+.members {
+}
+.method {
+}
+.parameters {
+}
+.returnvalue {
+}
+.struct {
+ border-bottom: solid 2px gray;
+}
+.typedef {
+ border-bottom: solid 2px gray;
+}
+.union {
+ border-bottom: solid 2px gray;
+}
+.variable {
+}
+code, p.code, pre, ul.code li {
+ font-family: monaco, courier, monospace;
+ font-size: 90%;
+}
+a:link, a:visited {
+ text-decoration: none;
+}
+span.info {
+ background: black;
+ border: solid thin black;
+ color: white;
+ font-size: 80%;
+ font-style: italic;
+ font-weight: bold;
+ white-space: nowrap;
+}
+h3 span.info, h4 span.info {
+ float: right;
+ font-size: 100%;
+}
+ul.code, ul.contents, ul.subcontents {
+ list-style-type: none;
+ margin: 0;
+ padding-left: 0;
+}
+ul.code li {
+ margin: 0;
+}
+ul.contents > li {
+ margin-top: 1em;
+}
+ul.contents li ul.code, ul.contents li ul.subcontents {
+ padding-left: 2em;
+}
+div.body dl {
+ margin-top: 0;
+}
+div.body dt {
+ font-style: italic;
+ margin-top: 0;
+}
+div.body dd {
+ margin-bottom: 0.5em;
+}
+h1.title {
+}
+h2.title {
+ border-bottom: solid 2px black;
+}
+h3.title {
+ border-bottom: solid 2px black;
+}
+--></style>
+</head>
+<body>
+<div class='body'>
+<h1 align='right'><a name='REFERENCE'><img src="C.gif" align="right"
+hspace="10" width="100" height="100" alt="C"></a>Library
+Reference</h1>
+
+<h2 class="title">Contents</h2>
+<ul class="contents">
+<li><a href="#FUNCTIONS">Functions</a><ul class="code">
+<li><a href="#mxmlAdd" title="Add a node to a tree.">mxmlAdd</a></li>
+<li><a href="#mxmlDelete" title="Delete a node and all of its children.">mxmlDelete</a></li>
+<li><a href="#mxmlElementDeleteAttr" title="Delete an attribute.">mxmlElementDeleteAttr</a></li>
+<li><a href="#mxmlElementGetAttr" title="Get an attribute.">mxmlElementGetAttr</a></li>
+<li><a href="#mxmlElementSetAttr" title="Set an attribute.">mxmlElementSetAttr</a></li>
+<li><a href="#mxmlElementSetAttrf" title="Set an attribute with a formatted value.">mxmlElementSetAttrf</a></li>
+<li><a href="#mxmlEntityAddCallback" title="Add a callback to convert entities to Unicode.">mxmlEntityAddCallback</a></li>
+<li><a href="#mxmlEntityGetName" title="Get the name that corresponds to the character value.">mxmlEntityGetName</a></li>
+<li><a href="#mxmlEntityGetValue" title="Get the character corresponding to a named entity.">mxmlEntityGetValue</a></li>
+<li><a href="#mxmlEntityRemoveCallback" title="Remove a callback.">mxmlEntityRemoveCallback</a></li>
+<li><a href="#mxmlFindElement" title="Find the named element.">mxmlFindElement</a></li>
+<li><a href="#mxmlIndexDelete" title="Delete an index.">mxmlIndexDelete</a></li>
+<li><a href="#mxmlIndexEnum" title="Return the next node in the index.">mxmlIndexEnum</a></li>
+<li><a href="#mxmlIndexFind" title="Find the next matching node.">mxmlIndexFind</a></li>
+<li><a href="#mxmlIndexNew" title="Create a new index.">mxmlIndexNew</a></li>
+<li><a href="#mxmlIndexReset" title="Reset the enumeration/find pointer in the index and
+return the first node in the index.">mxmlIndexReset</a></li>
+<li><a href="#mxmlLoadFd" title="Load a file descriptor into an XML node tree.">mxmlLoadFd</a></li>
+<li><a href="#mxmlLoadFile" title="Load a file into an XML node tree.">mxmlLoadFile</a></li>
+<li><a href="#mxmlLoadString" title="Load a string into an XML node tree.">mxmlLoadString</a></li>
+<li><a href="#mxmlNewCDATA" title="Create a new CDATA node.">mxmlNewCDATA</a></li>
+<li><a href="#mxmlNewCustom" title="Create a new custom data node.">mxmlNewCustom</a></li>
+<li><a href="#mxmlNewElement" title="Create a new element node.">mxmlNewElement</a></li>
+<li><a href="#mxmlNewInteger" title="Create a new integer node.">mxmlNewInteger</a></li>
+<li><a href="#mxmlNewOpaque" title="Create a new opaque string.">mxmlNewOpaque</a></li>
+<li><a href="#mxmlNewReal" title="Create a new real number node.">mxmlNewReal</a></li>
+<li><a href="#mxmlNewText" title="Create a new text fragment node.">mxmlNewText</a></li>
+<li><a href="#mxmlNewTextf" title="Create a new formatted text fragment node.">mxmlNewTextf</a></li>
+<li><a href="#mxmlNewXML" title="Create a new XML document tree.">mxmlNewXML</a></li>
+<li><a href="#mxmlRelease" title="Release a node.">mxmlRelease</a></li>
+<li><a href="#mxmlRemove" title="Remove a node from its parent.">mxmlRemove</a></li>
+<li><a href="#mxmlRetain" title="Retain a node.">mxmlRetain</a></li>
+<li><a href="#mxmlSAXLoadFd" title="Load a file descriptor into an XML node tree
+using a SAX callback.">mxmlSAXLoadFd</a></li>
+<li><a href="#mxmlSAXLoadFile" title="Load a file into an XML node tree
+using a SAX callback.">mxmlSAXLoadFile</a></li>
+<li><a href="#mxmlSAXLoadString" title="Load a string into an XML node tree
+using a SAX callback.">mxmlSAXLoadString</a></li>
+<li><a href="#mxmlSaveAllocString" title="Save an XML node tree to an allocated string.">mxmlSaveAllocString</a></li>
+<li><a href="#mxmlSaveFd" title="Save an XML tree to a file descriptor.">mxmlSaveFd</a></li>
+<li><a href="#mxmlSaveFile" title="Save an XML tree to a file.">mxmlSaveFile</a></li>
+<li><a href="#mxmlSaveString" title="Save an XML node tree to a string.">mxmlSaveString</a></li>
+<li><a href="#mxmlSetCDATA" title="Set the element name of a CDATA node.">mxmlSetCDATA</a></li>
+<li><a href="#mxmlSetCustom" title="Set the data and destructor of a custom data node.">mxmlSetCustom</a></li>
+<li><a href="#mxmlSetCustomHandlers" title="Set the handling functions for custom data.">mxmlSetCustomHandlers</a></li>
+<li><a href="#mxmlSetElement" title="Set the name of an element node.">mxmlSetElement</a></li>
+<li><a href="#mxmlSetErrorCallback" title="Set the error message callback.">mxmlSetErrorCallback</a></li>
+<li><a href="#mxmlSetInteger" title="Set the value of an integer node.">mxmlSetInteger</a></li>
+<li><a href="#mxmlSetOpaque" title="Set the value of an opaque node.">mxmlSetOpaque</a></li>
+<li><a href="#mxmlSetReal" title="Set the value of a real number node.">mxmlSetReal</a></li>
+<li><a href="#mxmlSetText" title="Set the value of a text node.">mxmlSetText</a></li>
+<li><a href="#mxmlSetTextf" title="Set the value of a text node to a formatted string.">mxmlSetTextf</a></li>
+<li><a href="#mxmlSetWrapMargin" title="Set the the wrap margin when saving XML data.">mxmlSetWrapMargin</a></li>
+<li><a href="#mxmlWalkNext" title="Walk to the next logical node in the tree.">mxmlWalkNext</a></li>
+<li><a href="#mxmlWalkPrev" title="Walk to the previous logical node in the tree.">mxmlWalkPrev</a></li>
+</ul></li>
+<li><a href="#TYPES">Data Types</a><ul class="code">
+ <li><a href="#mxml_attr_t" title="An XML element attribute value.">mxml_attr_t</a></li>
+ <li><a href="#mxml_custom_destroy_cb_t" title="Custom data destructor">mxml_custom_destroy_cb_t</a></li>
+ <li><a href="#mxml_custom_load_cb_t" title="Custom data load callback function">mxml_custom_load_cb_t</a></li>
+ <li><a href="#mxml_custom_save_cb_t" title="Custom data save callback function">mxml_custom_save_cb_t</a></li>
+ <li><a href="#mxml_custom_t" title="An XML custom value. ">mxml_custom_t</a></li>
+ <li><a href="#mxml_element_t" title="An XML element value.">mxml_element_t</a></li>
+ <li><a href="#mxml_entity_cb_t" title="Entity callback function">mxml_entity_cb_t</a></li>
+ <li><a href="#mxml_error_cb_t" title="Error callback function">mxml_error_cb_t</a></li>
+ <li><a href="#mxml_index_t" title="An XML node index.">mxml_index_t</a></li>
+ <li><a href="#mxml_load_cb_t" title="Load callback function">mxml_load_cb_t</a></li>
+ <li><a href="#mxml_node_t" title="An XML node.">mxml_node_t</a></li>
+ <li><a href="#mxml_save_cb_t" title="Save callback function">mxml_save_cb_t</a></li>
+ <li><a href="#mxml_sax_cb_t" title="SAX callback function">mxml_sax_cb_t</a></li>
+ <li><a href="#mxml_sax_event_t" title="SAX event type.">mxml_sax_event_t</a></li>
+ <li><a href="#mxml_text_t" title="An XML text value.">mxml_text_t</a></li>
+ <li><a href="#mxml_type_t" title="The XML node type.">mxml_type_t</a></li>
+ <li><a href="#mxml_value_t" title="An XML node value.">mxml_value_t</a></li>
+</ul></li>
+<li><a href="#STRUCTURES">Structures</a><ul class="code">
+ <li><a href="#mxml_attr_s" title="An XML element attribute value.">mxml_attr_s</a></li>
+ <li><a href="#mxml_custom_s" title="An XML custom value. ">mxml_custom_s</a></li>
+ <li><a href="#mxml_element_s" title="An XML element value.">mxml_element_s</a></li>
+ <li><a href="#mxml_index_s" title="An XML node index.">mxml_index_s</a></li>
+ <li><a href="#mxml_node_s" title="An XML node.">mxml_node_s</a></li>
+ <li><a href="#mxml_text_s" title="An XML text value.">mxml_text_s</a></li>
+</ul></li>
+<li><a href="#UNIONS">Unions</a><ul class="code">
+ <li><a href="#mxml_value_u" title="An XML node value.">mxml_value_u</a></li>
+</ul></li>
+<li><a href="#ENUMERATIONS">Constants</a><ul class="code">
+ <li><a href="#mxml_sax_event_e" title="SAX event type.">mxml_sax_event_e</a></li>
+ <li><a href="#mxml_type_e" title="The XML node type.">mxml_type_e</a></li>
+</ul></li>
+<h2 class="title"><a name="FUNCTIONS">Functions</a></h2>
+<h3 class="function"><a name="mxmlAdd">mxmlAdd</a></h3>
+<p class="description">Add a node to a tree.</p>
+<p class="code">
+void mxmlAdd (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *parent,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;int where,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *child,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>parent</dt>
+<dd class="description">Parent node</dd>
+<dt>where</dt>
+<dd class="description">Where to add, MXML_ADD_BEFORE or MXML_ADD_AFTER</dd>
+<dt>child</dt>
+<dd class="description">Child node for where or MXML_ADD_TO_PARENT</dd>
+<dt>node</dt>
+<dd class="description">Node to add</dd>
+</dl>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">Adds the specified node to the parent. If the child argument is not
+NULL, puts the new node before or after the specified child depending
+on the value of the where argument. If the child argument is NULL,
+puts the new node at the beginning of the child list (MXML_ADD_BEFORE)
+or at the end of the child list (MXML_ADD_AFTER). The constant
+MXML_ADD_TO_PARENT can be used to specify a NULL child pointer.</p>
+<h3 class="function"><a name="mxmlDelete">mxmlDelete</a></h3>
+<p class="description">Delete a node and all of its children.</p>
+<p class="code">
+void mxmlDelete (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">Node to delete</dd>
+</dl>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">If the specified node has a parent, this function first removes the
+node from its parent using the mxmlRemove() function.</p>
+<h3 class="function"><span class="info">&nbsp;Mini-XML 2.4&nbsp;</span><a name="mxmlElementDeleteAttr">mxmlElementDeleteAttr</a></h3>
+<p class="description">Delete an attribute.</p>
+<p class="code">
+void mxmlElementDeleteAttr (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *name<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">Element</dd>
+<dt>name</dt>
+<dd class="description">Attribute name</dd>
+</dl>
+<h3 class="function"><a name="mxmlElementGetAttr">mxmlElementGetAttr</a></h3>
+<p class="description">Get an attribute.</p>
+<p class="code">
+const char *mxmlElementGetAttr (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *name<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">Element node</dd>
+<dt>name</dt>
+<dd class="description">Name of attribute</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">Attribute value or NULL</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">This function returns NULL if the node is not an element or the
+named attribute does not exist.</p>
+<h3 class="function"><a name="mxmlElementSetAttr">mxmlElementSetAttr</a></h3>
+<p class="description">Set an attribute.</p>
+<p class="code">
+void mxmlElementSetAttr (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *name,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *value<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">Element node</dd>
+<dt>name</dt>
+<dd class="description">Name of attribute</dd>
+<dt>value</dt>
+<dd class="description">Attribute value</dd>
+</dl>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">If the named attribute already exists, the value of the attribute
+is replaced by the new string value. The string value is copied
+into the element node. This function does nothing if the node is
+not an element.</p>
+<h3 class="function"><span class="info">&nbsp;Mini-XML 2.3&nbsp;</span><a name="mxmlElementSetAttrf">mxmlElementSetAttrf</a></h3>
+<p class="description">Set an attribute with a formatted value.</p>
+<p class="code">
+void mxmlElementSetAttrf (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *name,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *format,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;...<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">Element node</dd>
+<dt>name</dt>
+<dd class="description">Name of attribute</dd>
+<dt>format</dt>
+<dd class="description">Printf-style attribute value</dd>
+<dt>...</dt>
+<dd class="description">Additional arguments as needed</dd>
+</dl>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">If the named attribute already exists, the value of the attribute
+is replaced by the new formatted string. The formatted string value is
+copied into the element node. This function does nothing if the node
+is not an element.
+
+</p>
+<h3 class="function"><a name="mxmlEntityAddCallback">mxmlEntityAddCallback</a></h3>
+<p class="description">Add a callback to convert entities to Unicode.</p>
+<p class="code">
+int mxmlEntityAddCallback (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_entity_cb_t">mxml_entity_cb_t</a> cb<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>cb</dt>
+<dd class="description">Callback function to add</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">0 on success, -1 on failure</p>
+<h3 class="function"><a name="mxmlEntityGetName">mxmlEntityGetName</a></h3>
+<p class="description">Get the name that corresponds to the character value.</p>
+<p class="code">
+const char *mxmlEntityGetName (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;int val<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>val</dt>
+<dd class="description">Character value</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">Entity name or NULL</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">If val does not need to be represented by a named entity, NULL is returned.</p>
+<h3 class="function"><a name="mxmlEntityGetValue">mxmlEntityGetValue</a></h3>
+<p class="description">Get the character corresponding to a named entity.</p>
+<p class="code">
+int mxmlEntityGetValue (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *name<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>name</dt>
+<dd class="description">Entity name</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">Character value or -1 on error</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The entity name can also be a numeric constant. -1 is returned if the
+name is not known.</p>
+<h3 class="function"><a name="mxmlEntityRemoveCallback">mxmlEntityRemoveCallback</a></h3>
+<p class="description">Remove a callback.</p>
+<p class="code">
+void mxmlEntityRemoveCallback (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_entity_cb_t">mxml_entity_cb_t</a> cb<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>cb</dt>
+<dd class="description">Callback function to remove</dd>
+</dl>
+<h3 class="function"><a name="mxmlFindElement">mxmlFindElement</a></h3>
+<p class="description">Find the named element.</p>
+<p class="code">
+<a href="#mxml_node_t">mxml_node_t</a> *mxmlFindElement (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *top,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *name,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *attr,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *value,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;int descend<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">Current node</dd>
+<dt>top</dt>
+<dd class="description">Top node</dd>
+<dt>name</dt>
+<dd class="description">Element name or NULL for any</dd>
+<dt>attr</dt>
+<dd class="description">Attribute name, or NULL for none</dd>
+<dt>value</dt>
+<dd class="description">Attribute value, or NULL for any</dd>
+<dt>descend</dt>
+<dd class="description">Descend into tree - MXML_DESCEND, MXML_NO_DESCEND, or MXML_DESCEND_FIRST</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">Element node or NULL</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The search is constrained by the name, attribute name, and value; any
+NULL names or values are treated as wildcards, so different kinds of
+searches can be implemented by looking for all elements of a given name
+or all elements with a specific attribute. The descend argument determines
+whether the search descends into child nodes; normally you will use
+MXML_DESCEND_FIRST for the initial search and MXML_NO_DESCEND to find
+additional direct descendents of the node. The top node argument
+constrains the search to a particular node's children.</p>
+<h3 class="function"><a name="mxmlIndexDelete">mxmlIndexDelete</a></h3>
+<p class="description">Delete an index.</p>
+<p class="code">
+void mxmlIndexDelete (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_index_t">mxml_index_t</a> *ind<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>ind</dt>
+<dd class="description">Index to delete</dd>
+</dl>
+<h3 class="function"><a name="mxmlIndexEnum">mxmlIndexEnum</a></h3>
+<p class="description">Return the next node in the index.</p>
+<p class="code">
+<a href="#mxml_node_t">mxml_node_t</a> *mxmlIndexEnum (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_index_t">mxml_index_t</a> *ind<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>ind</dt>
+<dd class="description">Index to enumerate</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">Next node or NULL if there is none</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">Nodes are returned in the sorted order of the index.</p>
+<h3 class="function"><a name="mxmlIndexFind">mxmlIndexFind</a></h3>
+<p class="description">Find the next matching node.</p>
+<p class="code">
+<a href="#mxml_node_t">mxml_node_t</a> *mxmlIndexFind (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_index_t">mxml_index_t</a> *ind,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *element,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *value<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>ind</dt>
+<dd class="description">Index to search</dd>
+<dt>element</dt>
+<dd class="description">Element name to find, if any</dd>
+<dt>value</dt>
+<dd class="description">Attribute value, if any</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">Node or NULL if none found</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">You should call mxmlIndexReset() prior to using this function for
+the first time with a particular set of &quot;element&quot; and &quot;value&quot;
+strings. Passing NULL for both &quot;element&quot; and &quot;value&quot; is equivalent
+to calling mxmlIndexEnum().</p>
+<h3 class="function"><a name="mxmlIndexNew">mxmlIndexNew</a></h3>
+<p class="description">Create a new index.</p>
+<p class="code">
+<a href="#mxml_index_t">mxml_index_t</a> *mxmlIndexNew (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *element,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *attr<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">XML node tree</dd>
+<dt>element</dt>
+<dd class="description">Element to index or NULL for all</dd>
+<dt>attr</dt>
+<dd class="description">Attribute to index or NULL for none</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">New index</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The index will contain all nodes that contain the named element and/or
+attribute. If both &quot;element&quot; and &quot;attr&quot; are NULL, then the index will
+contain a sorted list of the elements in the node tree. Nodes are
+sorted by element name and optionally by attribute value if the &quot;attr&quot;
+argument is not NULL.</p>
+<h3 class="function"><a name="mxmlIndexReset">mxmlIndexReset</a></h3>
+<p class="description">Reset the enumeration/find pointer in the index and
+return the first node in the index.</p>
+<p class="code">
+<a href="#mxml_node_t">mxml_node_t</a> *mxmlIndexReset (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_index_t">mxml_index_t</a> *ind<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>ind</dt>
+<dd class="description">Index to reset</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">First node or NULL if there is none</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">This function should be called prior to using mxmlIndexEnum() or
+mxmlIndexFind() for the first time.</p>
+<h3 class="function"><a name="mxmlLoadFd">mxmlLoadFd</a></h3>
+<p class="description">Load a file descriptor into an XML node tree.</p>
+<p class="code">
+<a href="#mxml_node_t">mxml_node_t</a> *mxmlLoadFd (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *top,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;int fd,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_load_cb_t">mxml_load_cb_t</a> cb<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>top</dt>
+<dd class="description">Top node</dd>
+<dt>fd</dt>
+<dd class="description">File descriptor to read from</dd>
+<dt>cb</dt>
+<dd class="description">Callback function or MXML_NO_CALLBACK</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">First node or NULL if the file could not be read.</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The nodes in the specified file are added to the specified top node.
+If no top node is provided, the XML file MUST be well-formed with a
+single parent node like &lt;?xml&gt; for the entire file. The callback
+function returns the value type that should be used for child nodes.
+If MXML_NO_CALLBACK is specified then all child nodes will be either
+MXML_ELEMENT or MXML_TEXT nodes.<br>
+<br>
+The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK,
+MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading
+child nodes of the specified type.</p>
+<h3 class="function"><a name="mxmlLoadFile">mxmlLoadFile</a></h3>
+<p class="description">Load a file into an XML node tree.</p>
+<p class="code">
+<a href="#mxml_node_t">mxml_node_t</a> *mxmlLoadFile (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *top,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;FILE *fp,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_load_cb_t">mxml_load_cb_t</a> cb<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>top</dt>
+<dd class="description">Top node</dd>
+<dt>fp</dt>
+<dd class="description">File to read from</dd>
+<dt>cb</dt>
+<dd class="description">Callback function or MXML_NO_CALLBACK</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">First node or NULL if the file could not be read.</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The nodes in the specified file are added to the specified top node.
+If no top node is provided, the XML file MUST be well-formed with a
+single parent node like &lt;?xml&gt; for the entire file. The callback
+function returns the value type that should be used for child nodes.
+If MXML_NO_CALLBACK is specified then all child nodes will be either
+MXML_ELEMENT or MXML_TEXT nodes.<br>
+<br>
+The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK,
+MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading
+child nodes of the specified type.</p>
+<h3 class="function"><a name="mxmlLoadString">mxmlLoadString</a></h3>
+<p class="description">Load a string into an XML node tree.</p>
+<p class="code">
+<a href="#mxml_node_t">mxml_node_t</a> *mxmlLoadString (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *top,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *s,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_load_cb_t">mxml_load_cb_t</a> cb<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>top</dt>
+<dd class="description">Top node</dd>
+<dt>s</dt>
+<dd class="description">String to load</dd>
+<dt>cb</dt>
+<dd class="description">Callback function or MXML_NO_CALLBACK</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">First node or NULL if the string has errors.</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The nodes in the specified string are added to the specified top node.
+If no top node is provided, the XML string MUST be well-formed with a
+single parent node like &lt;?xml&gt; for the entire string. The callback
+function returns the value type that should be used for child nodes.
+If MXML_NO_CALLBACK is specified then all child nodes will be either
+MXML_ELEMENT or MXML_TEXT nodes.<br>
+<br>
+The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK,
+MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading
+child nodes of the specified type.</p>
+<h3 class="function"><span class="info">&nbsp;Mini-XML 2.3&nbsp;</span><a name="mxmlNewCDATA">mxmlNewCDATA</a></h3>
+<p class="description">Create a new CDATA node.</p>
+<p class="code">
+<a href="#mxml_node_t">mxml_node_t</a> *mxmlNewCDATA (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *parent,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *data<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>parent</dt>
+<dd class="description">Parent node or MXML_NO_PARENT</dd>
+<dt>data</dt>
+<dd class="description">Data string</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">New node</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The new CDATA node is added to the end of the specified parent's child
+list. The constant MXML_NO_PARENT can be used to specify that the new
+CDATA node has no parent. The data string must be nul-terminated and
+is copied into the new node. CDATA nodes use the MXML_ELEMENT type.
+
+</p>
+<h3 class="function"><span class="info">&nbsp;Mini-XML 2.1&nbsp;</span><a name="mxmlNewCustom">mxmlNewCustom</a></h3>
+<p class="description">Create a new custom data node.</p>
+<p class="code">
+<a href="#mxml_node_t">mxml_node_t</a> *mxmlNewCustom (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *parent,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;void *data,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_custom_destroy_cb_t">mxml_custom_destroy_cb_t</a> destroy<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>parent</dt>
+<dd class="description">Parent node or MXML_NO_PARENT</dd>
+<dt>data</dt>
+<dd class="description">Pointer to data</dd>
+<dt>destroy</dt>
+<dd class="description">Function to destroy data</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">New node</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The new custom node is added to the end of the specified parent's child
+list. The constant MXML_NO_PARENT can be used to specify that the new
+element node has no parent. NULL can be passed when the data in the
+node is not dynamically allocated or is separately managed.
+
+</p>
+<h3 class="function"><a name="mxmlNewElement">mxmlNewElement</a></h3>
+<p class="description">Create a new element node.</p>
+<p class="code">
+<a href="#mxml_node_t">mxml_node_t</a> *mxmlNewElement (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *parent,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *name<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>parent</dt>
+<dd class="description">Parent node or MXML_NO_PARENT</dd>
+<dt>name</dt>
+<dd class="description">Name of element</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">New node</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The new element node is added to the end of the specified parent's child
+list. The constant MXML_NO_PARENT can be used to specify that the new
+element node has no parent.</p>
+<h3 class="function"><a name="mxmlNewInteger">mxmlNewInteger</a></h3>
+<p class="description">Create a new integer node.</p>
+<p class="code">
+<a href="#mxml_node_t">mxml_node_t</a> *mxmlNewInteger (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *parent,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;int integer<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>parent</dt>
+<dd class="description">Parent node or MXML_NO_PARENT</dd>
+<dt>integer</dt>
+<dd class="description">Integer value</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">New node</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The new integer node is added to the end of the specified parent's child
+list. The constant MXML_NO_PARENT can be used to specify that the new
+integer node has no parent.</p>
+<h3 class="function"><a name="mxmlNewOpaque">mxmlNewOpaque</a></h3>
+<p class="description">Create a new opaque string.</p>
+<p class="code">
+<a href="#mxml_node_t">mxml_node_t</a> *mxmlNewOpaque (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *parent,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *opaque<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>parent</dt>
+<dd class="description">Parent node or MXML_NO_PARENT</dd>
+<dt>opaque</dt>
+<dd class="description">Opaque string</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">New node</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The new opaque node is added to the end of the specified parent's child
+list. The constant MXML_NO_PARENT can be used to specify that the new
+opaque node has no parent. The opaque string must be nul-terminated and
+is copied into the new node.</p>
+<h3 class="function"><a name="mxmlNewReal">mxmlNewReal</a></h3>
+<p class="description">Create a new real number node.</p>
+<p class="code">
+<a href="#mxml_node_t">mxml_node_t</a> *mxmlNewReal (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *parent,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;double real<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>parent</dt>
+<dd class="description">Parent node or MXML_NO_PARENT</dd>
+<dt>real</dt>
+<dd class="description">Real number value</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">New node</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The new real number node is added to the end of the specified parent's
+child list. The constant MXML_NO_PARENT can be used to specify that
+the new real number node has no parent.</p>
+<h3 class="function"><a name="mxmlNewText">mxmlNewText</a></h3>
+<p class="description">Create a new text fragment node.</p>
+<p class="code">
+<a href="#mxml_node_t">mxml_node_t</a> *mxmlNewText (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *parent,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;int whitespace,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *string<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>parent</dt>
+<dd class="description">Parent node or MXML_NO_PARENT</dd>
+<dt>whitespace</dt>
+<dd class="description">1 = leading whitespace, 0 = no whitespace</dd>
+<dt>string</dt>
+<dd class="description">String</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">New node</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The new text node is added to the end of the specified parent's child
+list. The constant MXML_NO_PARENT can be used to specify that the new
+text node has no parent. The whitespace parameter is used to specify
+whether leading whitespace is present before the node. The text
+string must be nul-terminated and is copied into the new node.</p>
+<h3 class="function"><a name="mxmlNewTextf">mxmlNewTextf</a></h3>
+<p class="description">Create a new formatted text fragment node.</p>
+<p class="code">
+<a href="#mxml_node_t">mxml_node_t</a> *mxmlNewTextf (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *parent,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;int whitespace,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *format,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;...<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>parent</dt>
+<dd class="description">Parent node or MXML_NO_PARENT</dd>
+<dt>whitespace</dt>
+<dd class="description">1 = leading whitespace, 0 = no whitespace</dd>
+<dt>format</dt>
+<dd class="description">Printf-style frmat string</dd>
+<dt>...</dt>
+<dd class="description">Additional args as needed</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">New node</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The new text node is added to the end of the specified parent's child
+list. The constant MXML_NO_PARENT can be used to specify that the new
+text node has no parent. The whitespace parameter is used to specify
+whether leading whitespace is present before the node. The format
+string must be nul-terminated and is formatted into the new node.</p>
+<h3 class="function"><span class="info">&nbsp;Mini-XML 2.3&nbsp;</span><a name="mxmlNewXML">mxmlNewXML</a></h3>
+<p class="description">Create a new XML document tree.</p>
+<p class="code">
+<a href="#mxml_node_t">mxml_node_t</a> *mxmlNewXML (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *version<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>version</dt>
+<dd class="description">Version number to use</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">New ?xml node</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The &quot;version&quot; argument specifies the version number to put in the
+?xml element node. If NULL, version 1.0 is assumed.
+
+</p>
+<h3 class="function"><span class="info">&nbsp;Mini-XML 2.3&nbsp;</span><a name="mxmlRelease">mxmlRelease</a></h3>
+<p class="description">Release a node.</p>
+<p class="code">
+int mxmlRelease (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">Node</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">New reference count</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">When the reference count reaches zero, the node (and any children)
+is deleted via mxmlDelete().
+
+</p>
+<h3 class="function"><a name="mxmlRemove">mxmlRemove</a></h3>
+<p class="description">Remove a node from its parent.</p>
+<p class="code">
+void mxmlRemove (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">Node to remove</dd>
+</dl>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">Does not free memory used by the node - use mxmlDelete() for that.
+This function does nothing if the node has no parent.</p>
+<h3 class="function"><span class="info">&nbsp;Mini-XML 2.3&nbsp;</span><a name="mxmlRetain">mxmlRetain</a></h3>
+<p class="description">Retain a node.</p>
+<p class="code">
+int mxmlRetain (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">Node</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">New reference count</p>
+<h3 class="function"><span class="info">&nbsp;Mini-XML 2.3&nbsp;</span><a name="mxmlSAXLoadFd">mxmlSAXLoadFd</a></h3>
+<p class="description">Load a file descriptor into an XML node tree
+using a SAX callback.</p>
+<p class="code">
+<a href="#mxml_node_t">mxml_node_t</a> *mxmlSAXLoadFd (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *top,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;int fd,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_load_cb_t">mxml_load_cb_t</a> cb,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_sax_cb_t">mxml_sax_cb_t</a> sax_cb,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;void *sax_data<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>top</dt>
+<dd class="description">Top node</dd>
+<dt>fd</dt>
+<dd class="description">File descriptor to read from</dd>
+<dt>cb</dt>
+<dd class="description">Callback function or MXML_NO_CALLBACK</dd>
+<dt>sax_cb</dt>
+<dd class="description">SAX callback or MXML_NO_CALLBACK</dd>
+<dt>sax_data</dt>
+<dd class="description">SAX user data</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">First node or NULL if the file could not be read.</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The nodes in the specified file are added to the specified top node.
+If no top node is provided, the XML file MUST be well-formed with a
+single parent node like &lt;?xml&gt; for the entire file. The callback
+function returns the value type that should be used for child nodes.
+If MXML_NO_CALLBACK is specified then all child nodes will be either
+MXML_ELEMENT or MXML_TEXT nodes.<br>
+<br>
+The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK,
+MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading
+child nodes of the specified type.<br>
+<br>
+The SAX callback must call mxmlRetain() for any nodes that need to
+be kept for later use. Otherwise, nodes are deleted when the parent
+node is closed or after each data, comment, CDATA, or directive node.
+
+</p>
+<h3 class="function"><span class="info">&nbsp;Mini-XML 2.3&nbsp;</span><a name="mxmlSAXLoadFile">mxmlSAXLoadFile</a></h3>
+<p class="description">Load a file into an XML node tree
+using a SAX callback.</p>
+<p class="code">
+<a href="#mxml_node_t">mxml_node_t</a> *mxmlSAXLoadFile (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *top,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;FILE *fp,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_load_cb_t">mxml_load_cb_t</a> cb,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_sax_cb_t">mxml_sax_cb_t</a> sax_cb,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;void *sax_data<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>top</dt>
+<dd class="description">Top node</dd>
+<dt>fp</dt>
+<dd class="description">File to read from</dd>
+<dt>cb</dt>
+<dd class="description">Callback function or MXML_NO_CALLBACK</dd>
+<dt>sax_cb</dt>
+<dd class="description">SAX callback or MXML_NO_CALLBACK</dd>
+<dt>sax_data</dt>
+<dd class="description">SAX user data</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">First node or NULL if the file could not be read.</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The nodes in the specified file are added to the specified top node.
+If no top node is provided, the XML file MUST be well-formed with a
+single parent node like &lt;?xml&gt; for the entire file. The callback
+function returns the value type that should be used for child nodes.
+If MXML_NO_CALLBACK is specified then all child nodes will be either
+MXML_ELEMENT or MXML_TEXT nodes.<br>
+<br>
+The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK,
+MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading
+child nodes of the specified type.<br>
+<br>
+The SAX callback must call mxmlRetain() for any nodes that need to
+be kept for later use. Otherwise, nodes are deleted when the parent
+node is closed or after each data, comment, CDATA, or directive node.
+
+</p>
+<h3 class="function"><span class="info">&nbsp;Mini-XML 2.3&nbsp;</span><a name="mxmlSAXLoadString">mxmlSAXLoadString</a></h3>
+<p class="description">Load a string into an XML node tree
+using a SAX callback.</p>
+<p class="code">
+<a href="#mxml_node_t">mxml_node_t</a> *mxmlSAXLoadString (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *top,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *s,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_load_cb_t">mxml_load_cb_t</a> cb,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_sax_cb_t">mxml_sax_cb_t</a> sax_cb,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;void *sax_data<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>top</dt>
+<dd class="description">Top node</dd>
+<dt>s</dt>
+<dd class="description">String to load</dd>
+<dt>cb</dt>
+<dd class="description">Callback function or MXML_NO_CALLBACK</dd>
+<dt>sax_cb</dt>
+<dd class="description">SAX callback or MXML_NO_CALLBACK</dd>
+<dt>sax_data</dt>
+<dd class="description">SAX user data</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">First node or NULL if the string has errors.</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The nodes in the specified string are added to the specified top node.
+If no top node is provided, the XML string MUST be well-formed with a
+single parent node like &lt;?xml&gt; for the entire string. The callback
+function returns the value type that should be used for child nodes.
+If MXML_NO_CALLBACK is specified then all child nodes will be either
+MXML_ELEMENT or MXML_TEXT nodes.<br>
+<br>
+The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK,
+MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading
+child nodes of the specified type.<br>
+<br>
+The SAX callback must call mxmlRetain() for any nodes that need to
+be kept for later use. Otherwise, nodes are deleted when the parent
+node is closed or after each data, comment, CDATA, or directive node.
+
+</p>
+<h3 class="function"><a name="mxmlSaveAllocString">mxmlSaveAllocString</a></h3>
+<p class="description">Save an XML node tree to an allocated string.</p>
+<p class="code">
+char *mxmlSaveAllocString (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_save_cb_t">mxml_save_cb_t</a> cb<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">Node to write</dd>
+<dt>cb</dt>
+<dd class="description">Whitespace callback or MXML_NO_CALLBACK</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">Allocated string or NULL</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">This function returns a pointer to a string containing the textual
+representation of the XML node tree. The string should be freed
+using the free() function when you are done with it. NULL is returned
+if the node would produce an empty string or if the string cannot be
+allocated.<br>
+<br>
+The callback argument specifies a function that returns a whitespace
+string or NULL before and after each element. If MXML_NO_CALLBACK
+is specified, whitespace will only be added before MXML_TEXT nodes
+with leading whitespace and before attribute names inside opening
+element tags.</p>
+<h3 class="function"><a name="mxmlSaveFd">mxmlSaveFd</a></h3>
+<p class="description">Save an XML tree to a file descriptor.</p>
+<p class="code">
+int mxmlSaveFd (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;int fd,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_save_cb_t">mxml_save_cb_t</a> cb<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">Node to write</dd>
+<dt>fd</dt>
+<dd class="description">File descriptor to write to</dd>
+<dt>cb</dt>
+<dd class="description">Whitespace callback or MXML_NO_CALLBACK</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">0 on success, -1 on error.</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The callback argument specifies a function that returns a whitespace
+string or NULL before and after each element. If MXML_NO_CALLBACK
+is specified, whitespace will only be added before MXML_TEXT nodes
+with leading whitespace and before attribute names inside opening
+element tags.</p>
+<h3 class="function"><a name="mxmlSaveFile">mxmlSaveFile</a></h3>
+<p class="description">Save an XML tree to a file.</p>
+<p class="code">
+int mxmlSaveFile (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;FILE *fp,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_save_cb_t">mxml_save_cb_t</a> cb<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">Node to write</dd>
+<dt>fp</dt>
+<dd class="description">File to write to</dd>
+<dt>cb</dt>
+<dd class="description">Whitespace callback or MXML_NO_CALLBACK</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">0 on success, -1 on error.</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The callback argument specifies a function that returns a whitespace
+string or NULL before and after each element. If MXML_NO_CALLBACK
+is specified, whitespace will only be added before MXML_TEXT nodes
+with leading whitespace and before attribute names inside opening
+element tags.</p>
+<h3 class="function"><a name="mxmlSaveString">mxmlSaveString</a></h3>
+<p class="description">Save an XML node tree to a string.</p>
+<p class="code">
+int mxmlSaveString (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;char *buffer,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;int bufsize,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_save_cb_t">mxml_save_cb_t</a> cb<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">Node to write</dd>
+<dt>buffer</dt>
+<dd class="description">String buffer</dd>
+<dt>bufsize</dt>
+<dd class="description">Size of string buffer</dd>
+<dt>cb</dt>
+<dd class="description">Whitespace callback or MXML_NO_CALLBACK</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">Size of string</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">This function returns the total number of bytes that would be
+required for the string but only copies (bufsize - 1) characters
+into the specified buffer.<br>
+<br>
+The callback argument specifies a function that returns a whitespace
+string or NULL before and after each element. If MXML_NO_CALLBACK
+is specified, whitespace will only be added before MXML_TEXT nodes
+with leading whitespace and before attribute names inside opening
+element tags.</p>
+<h3 class="function"><span class="info">&nbsp;Mini-XML 2.3&nbsp;</span><a name="mxmlSetCDATA">mxmlSetCDATA</a></h3>
+<p class="description">Set the element name of a CDATA node.</p>
+<p class="code">
+int mxmlSetCDATA (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *data<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">Node to set</dd>
+<dt>data</dt>
+<dd class="description">New data string</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">0 on success, -1 on failure</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The node is not changed if it is not a CDATA element node.
+
+</p>
+<h3 class="function"><span class="info">&nbsp;Mini-XML 2.1&nbsp;</span><a name="mxmlSetCustom">mxmlSetCustom</a></h3>
+<p class="description">Set the data and destructor of a custom data node.</p>
+<p class="code">
+int mxmlSetCustom (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;void *data,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_custom_destroy_cb_t">mxml_custom_destroy_cb_t</a> destroy<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">Node to set</dd>
+<dt>data</dt>
+<dd class="description">New data pointer</dd>
+<dt>destroy</dt>
+<dd class="description">New destructor function</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">0 on success, -1 on failure</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The node is not changed if it is not a custom node.
+
+</p>
+<h3 class="function"><a name="mxmlSetCustomHandlers">mxmlSetCustomHandlers</a></h3>
+<p class="description">Set the handling functions for custom data.</p>
+<p class="code">
+void mxmlSetCustomHandlers (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_custom_load_cb_t">mxml_custom_load_cb_t</a> load,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_custom_save_cb_t">mxml_custom_save_cb_t</a> save<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>load</dt>
+<dd class="description">Load function</dd>
+<dt>save</dt>
+<dd class="description">Save function</dd>
+</dl>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The load function accepts a node pointer and a data string and must
+return 0 on success and non-zero on error.<br>
+<br>
+The save function accepts a node pointer and must return a malloc'd
+string on success and NULL on error.</p>
+<h3 class="function"><a name="mxmlSetElement">mxmlSetElement</a></h3>
+<p class="description">Set the name of an element node.</p>
+<p class="code">
+int mxmlSetElement (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *name<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">Node to set</dd>
+<dt>name</dt>
+<dd class="description">New name string</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">0 on success, -1 on failure</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The node is not changed if it is not an element node.</p>
+<h3 class="function"><a name="mxmlSetErrorCallback">mxmlSetErrorCallback</a></h3>
+<p class="description">Set the error message callback.</p>
+<p class="code">
+void mxmlSetErrorCallback (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_error_cb_t">mxml_error_cb_t</a> cb<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>cb</dt>
+<dd class="description">Error callback function</dd>
+</dl>
+<h3 class="function"><a name="mxmlSetInteger">mxmlSetInteger</a></h3>
+<p class="description">Set the value of an integer node.</p>
+<p class="code">
+int mxmlSetInteger (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;int integer<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">Node to set</dd>
+<dt>integer</dt>
+<dd class="description">Integer value</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">0 on success, -1 on failure</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The node is not changed if it is not an integer node.</p>
+<h3 class="function"><a name="mxmlSetOpaque">mxmlSetOpaque</a></h3>
+<p class="description">Set the value of an opaque node.</p>
+<p class="code">
+int mxmlSetOpaque (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *opaque<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">Node to set</dd>
+<dt>opaque</dt>
+<dd class="description">Opaque string</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">0 on success, -1 on failure</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The node is not changed if it is not an opaque node.</p>
+<h3 class="function"><a name="mxmlSetReal">mxmlSetReal</a></h3>
+<p class="description">Set the value of a real number node.</p>
+<p class="code">
+int mxmlSetReal (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;double real<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">Node to set</dd>
+<dt>real</dt>
+<dd class="description">Real number value</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">0 on success, -1 on failure</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The node is not changed if it is not a real number node.</p>
+<h3 class="function"><a name="mxmlSetText">mxmlSetText</a></h3>
+<p class="description">Set the value of a text node.</p>
+<p class="code">
+int mxmlSetText (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;int whitespace,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *string<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">Node to set</dd>
+<dt>whitespace</dt>
+<dd class="description">1 = leading whitespace, 0 = no whitespace</dd>
+<dt>string</dt>
+<dd class="description">String</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">0 on success, -1 on failure</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The node is not changed if it is not a text node.</p>
+<h3 class="function"><a name="mxmlSetTextf">mxmlSetTextf</a></h3>
+<p class="description">Set the value of a text node to a formatted string.</p>
+<p class="code">
+int mxmlSetTextf (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;int whitespace,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;const char *format,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;...<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">Node to set</dd>
+<dt>whitespace</dt>
+<dd class="description">1 = leading whitespace, 0 = no whitespace</dd>
+<dt>format</dt>
+<dd class="description">Printf-style format string</dd>
+<dt>...</dt>
+<dd class="description">Additional arguments as needed</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">0 on success, -1 on failure</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The node is not changed if it is not a text node.</p>
+<h3 class="function"><span class="info">&nbsp;Mini-XML 2.3&nbsp;</span><a name="mxmlSetWrapMargin">mxmlSetWrapMargin</a></h3>
+<p class="description">Set the the wrap margin when saving XML data.</p>
+<p class="code">
+void mxmlSetWrapMargin (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;int column<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>column</dt>
+<dd class="description">Column for wrapping, 0 to disable wrapping</dd>
+</dl>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">Wrapping is disabled when &quot;column&quot; is 0.
+
+</p>
+<h3 class="function"><a name="mxmlWalkNext">mxmlWalkNext</a></h3>
+<p class="description">Walk to the next logical node in the tree.</p>
+<p class="code">
+<a href="#mxml_node_t">mxml_node_t</a> *mxmlWalkNext (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *top,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;int descend<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">Current node</dd>
+<dt>top</dt>
+<dd class="description">Top node</dd>
+<dt>descend</dt>
+<dd class="description">Descend into tree - MXML_DESCEND, MXML_NO_DESCEND, or MXML_DESCEND_FIRST</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">Next node or NULL</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The descend argument controls whether the first child is considered
+to be the next node. The top node argument constrains the walk to
+the node's children.</p>
+<h3 class="function"><a name="mxmlWalkPrev">mxmlWalkPrev</a></h3>
+<p class="description">Walk to the previous logical node in the tree.</p>
+<p class="code">
+<a href="#mxml_node_t">mxml_node_t</a> *mxmlWalkPrev (<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *node,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> *top,<br>
+&nbsp;&nbsp;&nbsp;&nbsp;int descend<br>
+);</p>
+<h4 class="parameters">Parameters</h4>
+<dl>
+<dt>node</dt>
+<dd class="description">Current node</dd>
+<dt>top</dt>
+<dd class="description">Top node</dd>
+<dt>descend</dt>
+<dd class="description">Descend into tree - MXML_DESCEND, MXML_NO_DESCEND, or MXML_DESCEND_FIRST</dd>
+</dl>
+<h4 class="returnvalue">Return Value</h4>
+<p class="description">Previous node or NULL</p>
+<h4 class="discussion">Discussion</h4>
+<p class="discussion">The descend argument controls whether the previous node's last child
+is considered to be the previous node. The top node argument constrains
+the walk to the node's children.</p>
+<h2 class="title"><a name="TYPES">Data Types</a></h2>
+<h3 class="typedef"><a name="mxml_attr_t">mxml_attr_t</a></h3>
+<p class="description">An XML element attribute value.</p>
+<p class="code">
+typedef struct <a href="#mxml_attr_s">mxml_attr_s</a> mxml_attr_t;
+</p>
+<h3 class="typedef"><a name="mxml_custom_destroy_cb_t">mxml_custom_destroy_cb_t</a></h3>
+<p class="description">Custom data destructor</p>
+<p class="code">
+typedef void (*mxml_custom_destroy_cb_t)(void *);
+</p>
+<h3 class="typedef"><a name="mxml_custom_load_cb_t">mxml_custom_load_cb_t</a></h3>
+<p class="description">Custom data load callback function</p>
+<p class="code">
+typedef int (*mxml_custom_load_cb_t)(<a href="#mxml_node_t">mxml_node_t</a> *, const char *);
+</p>
+<h3 class="typedef"><a name="mxml_custom_save_cb_t">mxml_custom_save_cb_t</a></h3>
+<p class="description">Custom data save callback function</p>
+<p class="code">
+typedef char *(*mxml_custom_save_cb_t)(<a href="#mxml_node_t">mxml_node_t</a> *);
+</p>
+<h3 class="typedef"><span class="info">&nbsp;Mini-XML 2.1&nbsp;</span><a name="mxml_custom_t">mxml_custom_t</a></h3>
+<p class="description">An XML custom value. </p>
+<p class="code">
+typedef struct <a href="#mxml_custom_s">mxml_custom_s</a> mxml_custom_t;
+</p>
+<h3 class="typedef"><a name="mxml_element_t">mxml_element_t</a></h3>
+<p class="description">An XML element value.</p>
+<p class="code">
+typedef struct <a href="#mxml_element_s">mxml_element_s</a> mxml_element_t;
+</p>
+<h3 class="typedef"><a name="mxml_entity_cb_t">mxml_entity_cb_t</a></h3>
+<p class="description">Entity callback function</p>
+<p class="code">
+typedef int (*mxml_entity_cb_t)(const char *);
+</p>
+<h3 class="typedef"><a name="mxml_error_cb_t">mxml_error_cb_t</a></h3>
+<p class="description">Error callback function</p>
+<p class="code">
+typedef void (*mxml_error_cb_t)(const char *);
+</p>
+<h3 class="typedef"><a name="mxml_index_t">mxml_index_t</a></h3>
+<p class="description">An XML node index.</p>
+<p class="code">
+typedef struct <a href="#mxml_index_s">mxml_index_s</a> mxml_index_t;
+</p>
+<h3 class="typedef"><a name="mxml_load_cb_t">mxml_load_cb_t</a></h3>
+<p class="description">Load callback function</p>
+<p class="code">
+typedef <a href="#mxml_type_t">mxml_type_t</a> (*mxml_load_cb_t)(<a href="#mxml_node_t">mxml_node_t</a> *);
+</p>
+<h3 class="typedef"><a name="mxml_node_t">mxml_node_t</a></h3>
+<p class="description">An XML node.</p>
+<p class="code">
+typedef struct <a href="#mxml_node_s">mxml_node_s</a> mxml_node_t;
+</p>
+<h3 class="typedef"><a name="mxml_save_cb_t">mxml_save_cb_t</a></h3>
+<p class="description">Save callback function</p>
+<p class="code">
+typedef const char *(*mxml_save_cb_t)(<a href="#mxml_node_t">mxml_node_t</a> *, int);
+</p>
+<h3 class="typedef"><a name="mxml_sax_cb_t">mxml_sax_cb_t</a></h3>
+<p class="description">SAX callback function</p>
+<p class="code">
+typedef void (*mxml_sax_cb_t)(<a href="#mxml_node_t">mxml_node_t</a> *, mxml_sax_event_t, void *);
+</p>
+<h3 class="typedef"><a name="mxml_sax_event_t">mxml_sax_event_t</a></h3>
+<p class="description">SAX event type.</p>
+<p class="code">
+typedef enum <a href="#mxml_sax_event_e">mxml_sax_event_e</a> mxml_sax_event_t;
+</p>
+<h3 class="typedef"><a name="mxml_text_t">mxml_text_t</a></h3>
+<p class="description">An XML text value.</p>
+<p class="code">
+typedef struct <a href="#mxml_text_s">mxml_text_s</a> mxml_text_t;
+</p>
+<h3 class="typedef"><a name="mxml_type_t">mxml_type_t</a></h3>
+<p class="description">The XML node type.</p>
+<p class="code">
+typedef enum <a href="#mxml_type_e">mxml_type_e</a> mxml_type_t;
+</p>
+<h3 class="typedef"><a name="mxml_value_t">mxml_value_t</a></h3>
+<p class="description">An XML node value.</p>
+<p class="code">
+typedef union <a href="#mxml_value_u">mxml_value_u</a> mxml_value_t;
+</p>
+<h2 class="title"><a name="STRUCTURES">Structures</a></h2>
+<h3 class="struct"><a name="mxml_attr_s">mxml_attr_s</a></h3>
+<p class="description">An XML element attribute value.</p>
+<p class="code">struct mxml_attr_s {<br>
+&nbsp;&nbsp;&nbsp;&nbsp;char *name;<br>
+&nbsp;&nbsp;&nbsp;&nbsp;char *value;<br>
+};</p>
+<h4 class="members">Members</h4>
+<dl>
+<dt>name </dt>
+<dd class="description">Attribute name</dd>
+<dt>value </dt>
+<dd class="description">Attribute value</dd>
+</dl>
+<h3 class="struct"><span class="info">&nbsp;Mini-XML 2.1&nbsp;</span><a name="mxml_custom_s">mxml_custom_s</a></h3>
+<p class="description">An XML custom value. </p>
+<p class="code">struct mxml_custom_s {<br>
+&nbsp;&nbsp;&nbsp;&nbsp;void *data;<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_custom_destroy_cb_t">mxml_custom_destroy_cb_t</a> destroy;<br>
+};</p>
+<h4 class="members">Members</h4>
+<dl>
+<dt>data </dt>
+<dd class="description">Pointer to (allocated) custom data</dd>
+<dt>destroy </dt>
+<dd class="description">Pointer to destructor function</dd>
+</dl>
+<h3 class="struct"><a name="mxml_element_s">mxml_element_s</a></h3>
+<p class="description">An XML element value.</p>
+<p class="code">struct mxml_element_s {<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_attr_t">mxml_attr_t</a> *attrs;<br>
+&nbsp;&nbsp;&nbsp;&nbsp;char *name;<br>
+&nbsp;&nbsp;&nbsp;&nbsp;int num_attrs;<br>
+};</p>
+<h4 class="members">Members</h4>
+<dl>
+<dt>attrs </dt>
+<dd class="description">Attributes</dd>
+<dt>name </dt>
+<dd class="description">Name of element</dd>
+<dt>num_attrs </dt>
+<dd class="description">Number of attributes</dd>
+</dl>
+<h3 class="struct"><a name="mxml_index_s">mxml_index_s</a></h3>
+<p class="description">An XML node index.</p>
+<p class="code">struct mxml_index_s {<br>
+&nbsp;&nbsp;&nbsp;&nbsp;int alloc_nodes;<br>
+&nbsp;&nbsp;&nbsp;&nbsp;char *attr;<br>
+&nbsp;&nbsp;&nbsp;&nbsp;int cur_node;<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_node_t">mxml_node_t</a> **nodes;<br>
+&nbsp;&nbsp;&nbsp;&nbsp;int num_nodes;<br>
+};</p>
+<h4 class="members">Members</h4>
+<dl>
+<dt>alloc_nodes </dt>
+<dd class="description">Allocated nodes in index</dd>
+<dt>attr </dt>
+<dd class="description">Attribute used for indexing or NULL</dd>
+<dt>cur_node </dt>
+<dd class="description">Current node</dd>
+<dt>nodes </dt>
+<dd class="description">Node array</dd>
+<dt>num_nodes </dt>
+<dd class="description">Number of nodes in index</dd>
+</dl>
+<h3 class="struct"><a name="mxml_node_s">mxml_node_s</a></h3>
+<p class="description">An XML node.</p>
+<p class="code">struct mxml_node_s {<br>
+&nbsp;&nbsp;&nbsp;&nbsp;struct <a href="#mxml_node_s">mxml_node_s</a> *child;<br>
+&nbsp;&nbsp;&nbsp;&nbsp;struct <a href="#mxml_node_s">mxml_node_s</a> *last_child;<br>
+&nbsp;&nbsp;&nbsp;&nbsp;struct <a href="#mxml_node_s">mxml_node_s</a> *next;<br>
+&nbsp;&nbsp;&nbsp;&nbsp;struct <a href="#mxml_node_s">mxml_node_s</a> *parent;<br>
+&nbsp;&nbsp;&nbsp;&nbsp;struct <a href="#mxml_node_s">mxml_node_s</a> *prev;<br>
+&nbsp;&nbsp;&nbsp;&nbsp;int ref_count;<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_type_t">mxml_type_t</a> type;<br>
+&nbsp;&nbsp;&nbsp;&nbsp;void *user_data;<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_value_t">mxml_value_t</a> value;<br>
+};</p>
+<h4 class="members">Members</h4>
+<dl>
+<dt>child </dt>
+<dd class="description">First child node</dd>
+<dt>last_child </dt>
+<dd class="description">Last child node</dd>
+<dt>next </dt>
+<dd class="description">Next node under same parent</dd>
+<dt>parent </dt>
+<dd class="description">Parent node</dd>
+<dt>prev </dt>
+<dd class="description">Previous node under same parent</dd>
+<dt>ref_count </dt>
+<dd class="description">Use count</dd>
+<dt>type </dt>
+<dd class="description">Node type</dd>
+<dt>user_data </dt>
+<dd class="description">User data</dd>
+<dt>value </dt>
+<dd class="description">Node value</dd>
+</dl>
+<h3 class="struct"><a name="mxml_text_s">mxml_text_s</a></h3>
+<p class="description">An XML text value.</p>
+<p class="code">struct mxml_text_s {<br>
+&nbsp;&nbsp;&nbsp;&nbsp;char *string;<br>
+&nbsp;&nbsp;&nbsp;&nbsp;int whitespace;<br>
+};</p>
+<h4 class="members">Members</h4>
+<dl>
+<dt>string </dt>
+<dd class="description">Fragment string</dd>
+<dt>whitespace </dt>
+<dd class="description">Leading whitespace?</dd>
+</dl>
+<h2 class="title"><a name="UNIONS">Unions</a></h2>
+<h3 class="union"><a name="mxml_value_u">mxml_value_u</a></h3>
+<p class="description">An XML node value.</p>
+<p class="code">union mxml_value_u {<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_custom_t">mxml_custom_t</a> custom;<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_element_t">mxml_element_t</a> element;<br>
+&nbsp;&nbsp;&nbsp;&nbsp;int integer;<br>
+&nbsp;&nbsp;&nbsp;&nbsp;char *opaque;<br>
+&nbsp;&nbsp;&nbsp;&nbsp;double real;<br>
+&nbsp;&nbsp;&nbsp;&nbsp;<a href="#mxml_text_t">mxml_text_t</a> text;<br>
+};</p>
+<h4 class="members">Members</h4>
+<dl>
+<dt>custom <span class="info">&nbsp;Mini-XML 2.1&nbsp;</span></dt>
+<dd class="description">Custom data </dd>
+<dt>element </dt>
+<dd class="description">Element</dd>
+<dt>integer </dt>
+<dd class="description">Integer number</dd>
+<dt>opaque </dt>
+<dd class="description">Opaque string</dd>
+<dt>real </dt>
+<dd class="description">Real number</dd>
+<dt>text </dt>
+<dd class="description">Text fragment</dd>
+</dl>
+<h2 class="title"><a name="ENUMERATIONS">Constants</a></h2>
+<h3 class="enumeration"><a name="mxml_sax_event_e">mxml_sax_event_e</a></h3>
+<p class="description">SAX event type.</p>
+<h4 class="constants">Constants</h4>
+<dl>
+<dt>MXML_SAX_CDATA </dt>
+<dd class="description">CDATA node</dd>
+<dt>MXML_SAX_COMMENT </dt>
+<dd class="description">Comment node</dd>
+<dt>MXML_SAX_DATA </dt>
+<dd class="description">Data node</dd>
+<dt>MXML_SAX_DIRECTIVE </dt>
+<dd class="description">Processing directive node</dd>
+<dt>MXML_SAX_ELEMENT_CLOSE </dt>
+<dd class="description">Element closed</dd>
+<dt>MXML_SAX_ELEMENT_OPEN </dt>
+<dd class="description">Element opened</dd>
+</dl>
+<h3 class="enumeration"><a name="mxml_type_e">mxml_type_e</a></h3>
+<p class="description">The XML node type.</p>
+<h4 class="constants">Constants</h4>
+<dl>
+<dt>MXML_CUSTOM <span class="info">&nbsp;Mini-XML 2.1&nbsp;</span></dt>
+<dd class="description">Custom data </dd>
+<dt>MXML_ELEMENT </dt>
+<dd class="description">XML element with attributes</dd>
+<dt>MXML_IGNORE <span class="info">&nbsp;Mini-XML 2.3&nbsp;</span></dt>
+<dd class="description">Ignore/throw away node </dd>
+<dt>MXML_INTEGER </dt>
+<dd class="description">Integer value</dd>
+<dt>MXML_OPAQUE </dt>
+<dd class="description">Opaque string</dd>
+<dt>MXML_REAL </dt>
+<dd class="description">Real value</dd>
+<dt>MXML_TEXT </dt>
+<dd class="description">Text fragment</dd>
+</dl>
+</div>
+</body>
+</html>
diff -Naur mxml-2.6/doc/relnotes.html mxml-2.6-haiku/doc/relnotes.html
--- mxml-2.6/doc/relnotes.html 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/relnotes.html 2009-05-17 17:31:51.000000000 +0000
@@ -0,0 +1,518 @@
+<html>
+<body>
+
+<h1 align='right'><a name='RELNOTES'><img src="B.gif" align="right"
+hspace="10" width="100" height="100" alt="B"></a>Release Notes</h1>
+
+
+<h2 _hd_omit_toc>Changes in Mini-XML 2.6</h2>
+
+<ul>
+
+ <li>Documentation fixes (STR #91, STR #92)</li>
+
+ <li>The mxmldoc program did not handle typedef comments properly (STR
+ #72)</li>
+
+ <li>Added support for &quot;long long&quot; printf formats.</li>
+
+ <li>The XML parser now ignores BOMs in UTF-8 XML files (STR #89)</li>
+
+ <li>The mxmldoc program now supports generating Xcode documentation
+ sets.</li>
+
+ <li>mxmlSave*() did not output UTF-8 correctly on some platforms.</li>
+
+ <li>mxmlNewXML() now adds encoding=&quot;utf-8&quot; in the ?xml
+ directive to avoid problems with non-conformant XML parsers that assume
+ something other than UTF-8 as the default encoding.</li>
+
+ <li>Wrapping was not disabled when mxmlSetWrapMargin(0) was called, and
+ &quot;&lt;?xml ... ?&gt;&quot; was always followed by a newline
+ (STR #76)</li>
+
+ <li>The mxml.pc.in file was broken (STR #79)</li>
+
+ <li>The mxmldoc program now handles &quot;typedef enum name {}
+ name&quot; correctly (STR #72)</li>
+
+</ul>
+
+
+<h2 _hd_omit_toc>Changes in Mini-XML 2.5</h2>
+
+<ul>
+
+ <li>The mxmldoc program now makes greater use of CSS and
+ supports a --css option to embed an alternate stylesheet.</li>
+
+ <li>The mxmldoc program now supports --header and --footer
+ options to insert documentation content before and
+ after the generated content.</li>
+
+ <li>The mxmldoc program now supports a --framed option to
+ generate framed HTML output.</li>
+
+ <li>The mxmldoc program now creates a table of contents
+ including any headings in the --intro file when
+ generating HTML output.</li>
+
+ <li>The man pages and man page output from mxmldoc did
+ not use "\-" for dashes (STR #68)</li>
+
+ <li>The debug version of the Mini-XML DLL could not be
+ built (STR #65)</li>
+
+ <li>Processing instructions and directives did not work
+ when not at the top level of a document (STR #67)</li>
+
+ <li>Spaces around the "=" in attributes were not supported
+ (STR #67)</li>
+
+</ul>
+
+
+<h2 _hd_omit_toc>Changes in Mini-XML 2.4</h2>
+
+<ul>
+
+ <li>Fixed shared library build problems on HP-UX and Mac OS X.</li>
+
+ <li>The mxmldoc program did not output argument descriptions
+ for functions properly.</li>
+
+ <li>All global settings (custom, error, and entity callbacks
+ and the wrap margin) are now managed separately for each
+ thread.</li>
+
+ <li>Added mxmlElementDeleteAttr() function (STR #59)</li>
+
+ <li>mxmlElementSetAttrf() did not work (STR #57)</li>
+
+ <li>mxmlLoad*() incorrectly treated declarations as parent
+ elements (STR #56)</li>
+
+ <li>mxmlLoad*() incorrectly allowed attributes without
+ values (STR #47)</li>
+
+ <li>Fixed Visual C++ build problems (STR #49)</li>
+
+ <li>mxmlLoad*() did not return NULL when an element
+ contained an error (STR #46)</li>
+
+ <li>Added support for the apos character entity (STR
+ #54)</li> <li>Fixed whitespace detection with Unicode
+ characters (STR #48)</li>
+
+ <li>mxmlWalkNext() and mxmlWalkPrev() did not work correctly
+ when called with a node with no children as the top node
+ (STR #53)</li>
+
+</ul>
+
+
+<h2 _hd_omit_toc>Changes in Mini-XML 2.3</h2>
+
+<ul>
+
+ <li>Added two exceptions to the LGPL to support static
+ linking of applications against Mini-XML</li>
+
+ <li>The mxmldoc utility can now generate man pages,
+ too.</li>
+
+ <li>Added a mxmlNewXML() function</li>
+
+ <li>Added a mxmlElementSetAttrf() function (STR #43)</li>
+
+ <li>Added a snprintf() emulation function for the test
+ program (STR #32)</li>
+
+ <li>Added the _CRT_SECURE_NO_DEPRECATE definition when
+ building on VC++ 2005 (STR #36)</li>
+
+ <li>mxmlLoad*() did not detect missing > characters in
+ elements (STR #41)</li>
+
+ <li>mxmlLoad*() did not detect missing close tags at the
+ end of an XML document (STR #45)</li>
+
+ <li>Added user_data and ref_count members to mxml_node_t
+ structure</li>
+
+ <li>Added mxmlReleaseNode() and mxmlRetainNode() APIs for
+ reference-counted nodes</li>
+
+ <li>Added mxmlSetWrapMargin() to control the wrapping of
+ XML output</li>
+
+ <li>Added conditional check for EINTR error code for
+ certain Windows compilers that do not define it (STR
+ #33)</li>
+
+ <li>The mxmldoc program now generates correct HTML 4.0
+ output - previously it generated invalid XHTML</li>
+
+ <li>The mxmldoc program now supports "@deprecated@,
+ "@private@", and "@since version@" comments</li>
+
+ <li>Fixed function and enumeration type bugs in
+ mxmldoc</li>
+
+ <li>Fixed the XML schema for mxmldoc</li>
+
+ <li>The mxmldoc program now supports --intro, --section,
+ and --title options</li>
+
+ <li>The mxmlLoad*() functions could leak a node on an
+ error (STR #27)</li>
+
+ <li>The mxml_vsnprintf() function could get in an
+ infinite loop on a buffer overflow (STR #25)</li>
+
+ <li>Added new mxmlNewCDATA() and mxmlSetCDATA() functions
+ to create and set CDATA nodes, which are really just
+ special element nodes</li>
+
+ <li>Added new MXML_IGNORE type and MXML_IGNORE_CB
+ callback to ignore non-element nodes, e.g.
+ whitespace</li>
+
+ <li>mxmlLoad*() did not treat custom data as opaque, so
+ whitespace characters would be lost</li>
+
+</ul>
+
+
+<h2 _hd_omit_toc>Changes in Mini-XML 2.2.2</h2>
+
+<ul>
+
+ <li>mxmlLoad*() did not treat custom data as opaque, so
+ whitespace characters would be lost.</li>
+
+</ul>
+
+
+<h2 _hd_omit_toc>Changes in Mini-XML 2.2.1</h2>
+
+<ul>
+
+ <li>mxmlLoadFd(), mxmlLoadFile(), and mxmlLoadString()
+ now correctly return NULL on error (STR #21)</li>
+
+ <li>mxmlNewInteger(), mxmlNewOpaque(), mxmlNewReal(),
+ mxmlNewText(), and mxmlNewTextf() incorrectly required a
+ parent node (STR #22)</li>
+
+ <li>Fixed an XML output bug in mxmldoc.</li>
+
+ <li>The "make install" target now uses the install
+ command to set the proper permissions on
+ UNIX/Linux/OSX.</li>
+
+ <li>Fixed a MingW/Cygwin compilation problem (STR
+ #18)</li>
+
+</ul>
+
+
+<h2 _hd_omit_toc>Changes in Mini-XML 2.2</h2>
+
+<ul>
+
+ <li>Added shared library support (STR #17)</li>
+
+ <li>mxmlLoad*() now returns an error when an XML stream
+ contains illegal control characters (STR #10)</li>
+
+ <li>mxmlLoad*() now returns an error when an element
+ contains two attributes with the same name in
+ conformance with the XML spec (STR #16)</li>
+
+ <li>Added support for CDATA (STR #14, STR #15)</li>
+
+ <li>Updated comment and processing instruction handling -
+ no entity support per XML specification.</li>
+
+ <li>Added checking for invalid comment termination ("--->"
+ is not allowed)</li>
+
+</ul>
+
+<h2 _hd_omit_toc>Changes in Mini-XML 2.1</h2>
+
+<ul>
+
+ <li>Added support for custom data nodes (STR #6)</li>
+
+ <li>Now treat UTF-8 sequences which are longer than
+ necessary as an error (STR #4)</li>
+
+ <li>Fixed entity number support (STR #8)</li>
+
+ <li>Fixed mxmlLoadString() bug with UTF-8 (STR #7)</li>
+
+ <li>Fixed entity lookup bug (STR #5)</li>
+
+ <li>Added mxmlLoadFd() and mxmlSaveFd() functions.</li>
+
+ <li>Fixed multi-word UTF-16 handling.</li>
+
+</ul>
+
+<h2 _hd_omit_toc>Changes in Mini-XML 2.0</h2>
+
+<ul>
+
+ <li>New programmers manual.</li>
+
+ <li>Added Visual C++ project files for Microsoft Windows
+ users.</li>
+
+ <li>Added optimizations to mxmldoc, mxmlSaveFile(), and
+ mxmlIndexNew() (STR #2)</li>
+
+ <li>mxmlEntityAddCallback() now returns an integer
+ status (STR #2)</li>
+
+ <li>Added UTF-16 support (input only; all output is
+ UTF-8)</li>
+
+ <li>Added index functions to build a searchable index of
+ XML nodes.</li>
+
+ <li>Added character entity callback interface to support
+ additional character entities beyond those defined in
+ the XHTML specification.</li>
+
+ <li>Added support for XHTML character entities.</li>
+
+ <li>The mxmldoc utility now produces XML output which
+ conforms to an updated XML schema, described in the file
+ "doc/mxmldoc.xsd".</li>
+
+ <li>Changed the whitespace callback interface to return
+ strings instead of a single character, allowing for
+ greater control over the formatting of XML files written
+ using Mini-XML. THIS CHANGE WILL REQUIRE CHANGES TO
+ YOUR 1.x CODE IF YOU USE WHITESPACE CALLBACKS.</li>
+
+ <li>The mxmldoc utility now produces XML output which
+ conforms to an updated XML schema, described in the file
+ "doc/mxmldoc.xsd".</li>
+
+ <li>Changed the whitespace callback interface to return
+ strings instead of a single character, allowing for
+ greater control over the formatting of XML files written
+ using Mini-XML. THIS CHANGE WILL REQUIRE CHANGES TO
+ YOUR 1.x CODE IF YOU USE WHITESPACE CALLBACKS.</li>
+
+ <li>The mxmldoc utility is now capable of documenting C++
+ classes, functions, and structures, and correctly
+ handles C++ comments.</li>
+
+ <li>Added new modular tests for mxmldoc.</li>
+
+ <li>Updated the mxmldoc output to be more compatible with
+ embedding in manuals produced with HTMLDOC.</li>
+
+ <li>The makefile incorrectly included a "/" separator
+ between the destination path and install path. This
+ caused problems when building and installing with
+ MingW.</li>
+
+</ul>
+
+<h2 _hd_omit_toc>Changes in Mini-XML 1.3</h2>
+
+<ul>
+
+ <li>Fixes for mxmldoc.</li>
+
+ <li>Added support for reading standard HTML entity names.</li>
+
+ <li>mxmlLoadString/File() did not decode character
+ entities in element names, attribute names, or
+ attribute values.</li>
+
+ <li>mxmlLoadString/File() would crash when loading non-
+ conformant XML data under an existing parent (top)
+ node.</li>
+
+ <li>Fixed several bugs in the mxmldoc utility.</li>
+
+ <li>Added new error callback function to catch a variety
+ of errors and log them to someplace other than stderr.</li>
+
+ <li>The mxmlElementSetAttr() function now allows for NULL
+ attribute values.</li>
+
+ <li>The load and save functions now properly handle quoted
+ element and attribute name strings properly, e.g. for
+ !DOCTYPE declarations.</li>
+
+</ul>
+
+<h2 _hd_omit_toc>Changes in Mini-XML 1.2</h2>
+
+<ul>
+
+ <li>Added new "set" methods to set the value of a node.</li>
+
+ <li>Added new formatted text methods mxmlNewTextf() and
+ mxmlSetTextf() to create/set a text node value using
+ printf-style formats.</li>
+
+ <li>Added new standard callbacks for use with the mxmlLoad
+ functions.</li>
+
+ <li>Updated the HTML documentation to include examples of
+ the walk and load function output.</li>
+
+ <li>Added --with/without-ansi configure option to control
+ the strdup() function check.</li>
+
+ <li>Added --with/without-snprintf configure option to
+ control the snprintf() and vsnprintf() function
+ checks.</li>
+
+</ul>
+
+<h2 _hd_omit_toc>Changes in Mini-XML 1.1.2</h2>
+
+<ul>
+
+ <li>The mxml(3) man page wasn't updated for the string
+ functions.</li>
+
+ <li>mxmlSaveString() returned the wrong number of
+ characters.</li>
+
+ <li>mxml_add_char() updated the buffer pointer in the
+ wrong place.</li>
+
+</ul>
+
+<h2 _hd_omit_toc>Changes in Mini-XML 1.1.1</h2>
+
+<ul>
+
+ <li>The private mxml_add_ch() function did not update the
+ start-of-buffer pointer which could cause a crash when
+ using mxmlSaveString().</li>
+
+ <li>The private mxml_write_ws() function called putc()
+ instead of using the proper callback which could cause
+ a crash when using mxmlSaveString().</li>
+
+ <li>Added a mxmlSaveAllocString() convenience function for
+ saving an XML node tree to an allocated string.</li>
+
+</ul>
+
+<h2 _hd_omit_toc>Changes in Mini-XML 1.1</h2>
+
+<ul>
+
+ <li>The mxmlLoadFile() function now uses dynamically
+ allocated string buffers for element names, attribute
+ names, and attribute values. Previously they were
+ capped at 16383, 255, and 255 bytes, respectively.</li>
+
+ <li>Added a new mxmlLoadString() function for loading an
+ XML node tree from a string.</li>
+
+ <li>Added a new mxmlSaveString() function for saving an
+ XML node tree to a string.</li>
+
+ <li>Add emulation of strdup() if the local platform does
+ not provide the function.</li>
+
+</ul>
+
+<h2 _hd_omit_toc>Changes in Mini-XML 1.0</h2>
+
+<ul>
+
+ <li>The mxmldoc program now handles function arguments,
+ structures, unions, enumerations, classes, and
+ typedefs properly.</li>
+
+ <li>Documentation provided via mxmldoc and more in-line
+ comments in the code.</li>
+
+ <li>Added man pages and packaging files.</li>
+
+</ul>
+
+<h2 _hd_omit_toc>Changes in Mini-XML 0.93</h2>
+
+<ul>
+
+ <li>New mxmldoc example program that is also used to
+ create and update code documentation using XML and
+ produce HTML reference pages.</li>
+
+ <li>Added mxmlAdd() and mxmlRemove() functions to add and
+ remove nodes from a tree. This provides more
+ flexibility over where the nodes are inserted and
+ allows nodes to be moved within the tree as needed.</li>
+
+ <li>mxmlLoadFile() now correctly handles comments.</li>
+
+ <li>mxmlLoadFile() now supports the required "gt", "quot",
+ and "nbsp" character entities.</li>
+
+ <li>mxmlSaveFile() now uses newlines as whitespace
+ when valid to do so.</li>
+
+ <li>mxmlFindElement() now also takes attribute name and
+ attribute value string arguments to limit the search
+ to specific elements with attributes and/or values.</li>
+ NULL pointers can be used as "wildcards".</li>
+
+ <li>Added uninstall target to makefile, and auto-reconfig
+ if Makefile.in or configure.in are changed.</li>
+
+ <li>mxmlFindElement(), mxmlWalkNext(), and mxmlWalkPrev()
+ now all provide "descend" arguments to control whether
+ they descend into child nodes in the tree.</li>
+
+ <li>Fixed some whitespace issues in mxmlLoadFile().</li>
+
+ <li>Fixed Unicode output and whitespace issues in
+ mxmlSaveFile().</li>
+
+ <li>mxmlSaveFile() now supports a whitespace callback to
+ provide more human-readable XML output under program
+ control.</li>
+
+</ul>
+
+<h2 _hd_omit_toc>Changes in Mini-XML 0.92</h2>
+
+<ul>
+
+ <li>mxmlSaveFile() didn't return a value on success.</li>
+
+</ul>
+
+<h2 _hd_omit_toc>Changes in Mini-XML 0.91</h2>
+
+<ul>
+
+ <li>mxmlWalkNext() would go into an infinite loop.</li>
+
+</ul>
+
+<h2 _hd_omit_toc>Changes in Mini-XML 0.9</h2>
+
+<ul>
+
+ <li>Initial public release.</li>
+
+</ul>
+
+</body>
+</html>
diff -Naur mxml-2.6/doc/schema.html mxml-2.6-haiku/doc/schema.html
--- mxml-2.6/doc/schema.html 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/schema.html 2007-04-26 22:21:37.000000000 +0000
@@ -0,0 +1,201 @@
+<html>
+<body>
+
+<h1 align='right'><a name='SCHEMA'><img src="D.gif" align="right"
+hspace="10" width="100" height="100" alt="D"></a>XML Schema</h1>
+
+<p>This appendix provides the XML schema that is used for the XML
+files produced by <tt>mxmldoc</tt>. This schema is available on-line
+at:</p>
+
+<pre>
+ http://www.easysw.com/~mike/mxmldoc.xsd
+</pre>
+
+<h2 _hd_omit_toc>mxmldoc.xsd</h2>
+
+<pre><small>
+&lt;?xml version="1.0"?>
+&lt;xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema">
+ &lt;xsd:annotation>
+ &lt;xsd:documentation xml:lang="en">
+ Mini-XML 2.3 documentation schema for mxmldoc output.
+ Copyright 2003-2007 by Michael Sweet.
+ &lt;/xsd:documentation>
+ &lt;/xsd:annotation>
+
+ &lt;!-- basic element definitions -->
+ &lt;xsd:element name="argument" type="argumentType"/>
+ &lt;xsd:element name="class" type="classType"/>
+ &lt;xsd:element name="constant" type="constantType"/>
+ &lt;xsd:element name="description" type="xsd:string"/>
+ &lt;xsd:element name="enumeration" type="enumerationType"/>
+ &lt;xsd:element name="function" type="functionType"/>
+ &lt;xsd:element name="mxmldoc" type="mxmldocType"/>
+ &lt;xsd:element name="namespace" type="namespaceType"/>
+ &lt;xsd:element name="returnvalue" type="returnvalueType"/>
+ &lt;xsd:element name="seealso" type="identifierList"/>
+ &lt;xsd:element name="struct" type="structType"/>
+ &lt;xsd:element name="typedef" type="typedefType"/>
+ &lt;xsd:element name="type" type="xsd:string"/>
+ &lt;xsd:element name="union" type="unionType"/>
+ &lt;xsd:element name="variable" type="variableType"/>
+
+ &lt;!-- descriptions of complex elements -->
+ &lt;xsd:complexType name="argumentType">
+ &lt;xsd:sequence>
+ &lt;xsd:element ref="type" minOccurs="1" maxOccurs="1"/>
+ &lt;xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+ &lt;/xsd:sequence>
+ &lt;xsd:attribute name="default" type="xsd:string" use="optional"/>
+ &lt;xsd:attribute name="name" type="identifier" use="required"/>
+ &lt;xsd:attribute name="direction" type="direction" use="optional"
+ default="I"/>
+ &lt;/xsd:complexType>
+
+ &lt;xsd:complexType name="classType">
+ &lt;xsd:sequence>
+ &lt;xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+ &lt;xsd:choice minOccurs="0" maxOccurs="unbounded">
+ &lt;xsd:element ref="class"/>
+ &lt;xsd:element ref="enumeration"/>
+ &lt;xsd:element ref="function"/>
+ &lt;xsd:element ref="struct"/>
+ &lt;xsd:element ref="typedef"/>
+ &lt;xsd:element ref="union"/>
+ &lt;xsd:element ref="variable"/>
+ &lt;/xsd:choice>
+ &lt;/xsd:sequence>
+ &lt;xsd:attribute name="name" type="identifier" use="required"/>
+ &lt;xsd:attribute name="parent" type="xsd:string" use="optional"/>
+ &lt;/xsd:complexType>
+
+ &lt;xsd:complexType name="constantType">
+ &lt;xsd:sequence>
+ &lt;xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+ &lt;/xsd:sequence>
+ &lt;xsd:attribute name="name" type="identifier" use="required"/>
+ &lt;/xsd:complexType>
+
+ &lt;xsd:complexType name="enumerationType">
+ &lt;xsd:sequence>
+ &lt;xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+ &lt;xsd:element ref="constant" minOccurs="1" maxOccurs="unbounded"/>
+ &lt;/xsd:sequence>
+ &lt;xsd:attribute name="name" type="identifier" use="required"/>
+ &lt;/xsd:complexType>
+
+ &lt;xsd:complexType name="functionType">
+ &lt;xsd:sequence>
+ &lt;xsd:element ref="returnvalue" minOccurs="0" maxOccurs="1"/>
+ &lt;xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+ &lt;xsd:element ref="argument" minOccurs="1" maxOccurs="unbounded"/>
+ &lt;xsd:element ref="seealso" minOccurs="0" maxOccurs="1"/>
+ &lt;/xsd:sequence>
+ &lt;xsd:attribute name="name" type="identifier" use="required"/>
+ &lt;xsd:attribute name="scope" type="scope" use="optional"/>
+ &lt;/xsd:complexType>
+
+ &lt;xsd:complexType name="mxmldocType">
+ &lt;xsd:choice minOccurs="0" maxOccurs="unbounded">
+ &lt;xsd:element ref="class"/>
+ &lt;xsd:element ref="enumeration"/>
+ &lt;xsd:element ref="function"/>
+ &lt;xsd:element ref="namespace"/>
+ &lt;xsd:element ref="struct"/>
+ &lt;xsd:element ref="typedef"/>
+ &lt;xsd:element ref="union"/>
+ &lt;xsd:element ref="variable"/>
+ &lt;/xsd:choice>
+ &lt;/xsd:complexType>
+
+ &lt;xsd:complexType name="namespaceType">
+ &lt;xsd:sequence>
+ &lt;xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+ &lt;xsd:choice minOccurs="0" maxOccurs="unbounded">
+ &lt;xsd:element ref="class"/>
+ &lt;xsd:element ref="enumeration"/>
+ &lt;xsd:element ref="function"/>
+ &lt;xsd:element ref="struct"/>
+ &lt;xsd:element ref="typedef"/>
+ &lt;xsd:element ref="union"/>
+ &lt;xsd:element ref="variable"/>
+ &lt;/xsd:choice>
+ &lt;/xsd:sequence>
+ &lt;xsd:attribute name="name" type="identifier" use="required"/>
+ &lt;/xsd:complexType>
+
+ &lt;xsd:complexType name="returnvalueType">
+ &lt;xsd:sequence>
+ &lt;xsd:element ref="type" minOccurs="1" maxOccurs="1"/>
+ &lt;xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+ &lt;/xsd:sequence>
+ &lt;/xsd:complexType>
+
+ &lt;xsd:complexType name="structType">
+ &lt;xsd:sequence>
+ &lt;xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+ &lt;xsd:choice minOccurs="0" maxOccurs="unbounded">
+ &lt;xsd:element ref="variable"/>
+ &lt;xsd:element ref="function"/>
+ &lt;/xsd:choice>
+ &lt;/xsd:sequence>
+ &lt;xsd:attribute name="name" type="identifier" use="required"/>
+ &lt;/xsd:complexType>
+
+ &lt;xsd:complexType name="typedefType">
+ &lt;xsd:sequence>
+ &lt;xsd:element ref="type" minOccurs="1" maxOccurs="1"/>
+ &lt;xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+ &lt;/xsd:sequence>
+ &lt;xsd:attribute name="name" type="identifier" use="required"/>
+ &lt;/xsd:complexType>
+
+ &lt;xsd:complexType name="unionType">
+ &lt;xsd:sequence>
+ &lt;xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+ &lt;xsd:element ref="variable" minOccurs="0" maxOccurs="unbounded"/>
+ &lt;/xsd:sequence>
+ &lt;xsd:attribute name="name" type="identifier" use="required"/>
+ &lt;/xsd:complexType>
+
+ &lt;xsd:complexType name="variableType">
+ &lt;xsd:sequence>
+ &lt;xsd:element ref="type" minOccurs="1" maxOccurs="1"/>
+ &lt;xsd:element ref="description" minOccurs="0" maxOccurs="1"/>
+ &lt;/xsd:sequence>
+ &lt;xsd:attribute name="name" type="identifier" use="required"/>
+ &lt;/xsd:complexType>
+
+ &lt;!-- data types -->
+ &lt;xsd:simpleType name="direction">
+ &lt;xsd:restriction base="xsd:string">
+ &lt;xsd:enumeration value="I"/>
+ &lt;xsd:enumeration value="O"/>
+ &lt;xsd:enumeration value="IO"/>
+ &lt;/xsd:restriction>
+ &lt;/xsd:simpleType>
+
+ &lt;xsd:simpleType name="identifier">
+ &lt;xsd:restriction base="xsd:string">
+ &lt;xsd:pattern value="[a-zA-Z_(.]([a-zA-Z_(.,)* 0-9])*"/>
+ &lt;/xsd:restriction>
+ &lt;/xsd:simpleType>
+
+ &lt;xsd:simpleType name="identifierList">
+ &lt;xsd:list itemType="identifier"/>
+ &lt;/xsd:simpleType>
+
+ &lt;xsd:simpleType name="scope">
+ &lt;xsd:restriction base="xsd:string">
+ &lt;xsd:enumeration value=""/>
+ &lt;xsd:enumeration value="private"/>
+ &lt;xsd:enumeration value="protected"/>
+ &lt;xsd:enumeration value="public"/>
+ &lt;/xsd:restriction>
+ &lt;/xsd:simpleType>
+&lt;/xsd:schema>
+</small></pre>
+
+</body>
+</html>
diff -Naur mxml-2.6/doc/title.html mxml-2.6-haiku/doc/title.html
--- mxml-2.6/doc/title.html 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/doc/title.html 2009-05-17 06:04:58.000000000 +0000
@@ -0,0 +1,37 @@
+<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN">
+<html>
+<head>
+ <title>Mini-XML Programmers Manual</title>
+ <meta name="author" content="Michael R Sweet">
+ <meta name="copyright" content="Copyright 2003-2009">
+</head>
+<body>
+
+<table width="100%" height="100%" border="0" cellpadding="0" cellspacing="0" summary="">
+<tr><td height="100%">
+
+<H1 ALIGN="CENTER"><FONT SIZE="-1">Mini-XML Programmers Manual<br>
+Version 2.6</H1>
+
+<P ALIGN="CENTER">MICHAEL R. SWEET</P>
+
+</td></tr>
+</table>
+
+<!-- NEW PAGE -->
+<P><FONT SIZE="+1"><B>Mini-XML Programmers Manual, Version 2.6</B></FONT></P>
+
+<P><B>Copyright &copy; 2003-2009 by Michael R. Sweet</B></P>
+
+<P><SMALL>Permission is granted to copy, distribute and/or modify
+this document under the terms of the GNU Library General Public
+License, Version 2. A copy of this license is included in <A
+HREF="#LICENSE">Appendix A - Mini-XML License</A>.</SMALL></P>
+
+<P><SMALL>This book was created solely using free software
+tools.</SMALL></P>
+
+<P><SMALL>First Printing: April 2007</SMALL></P>
+
+</body>
+</html>
diff -Naur mxml-2.6/install-sh mxml-2.6-haiku/install-sh
--- mxml-2.6/install-sh 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/install-sh 2005-04-24 23:23:59.000000000 +0000
@@ -0,0 +1,251 @@
+#!/bin/sh
+#
+# install - install a program, script, or datafile
+# This comes from X11R5 (mit/util/scripts/install.sh).
+#
+# Copyright 1991 by the Massachusetts Institute of Technology
+#
+# Permission to use, copy, modify, distribute, and sell this software and its
+# documentation for any purpose is hereby granted without fee, provided that
+# the above copyright notice appear in all copies and that both that
+# copyright notice and this permission notice appear in supporting
+# documentation, and that the name of M.I.T. not be used in advertising or
+# publicity pertaining to distribution of the software without specific,
+# written prior permission. M.I.T. makes no representations about the
+# suitability of this software for any purpose. It is provided "as is"
+# without express or implied warranty.
+#
+# Calling this script install-sh is preferred over install.sh, to prevent
+# `make' implicit rules from creating a file called install from it
+# when there is no Makefile.
+#
+# This script is compatible with the BSD install script, but was written
+# from scratch. It can only install one file at a time, a restriction
+# shared with many OS's install programs.
+
+
+# set DOITPROG to echo to test this script
+
+# Don't use :- since 4.3BSD and earlier shells don't like it.
+doit="${DOITPROG-}"
+
+
+# put in absolute paths if you don't have them in your path; or use env. vars.
+
+mvprog="${MVPROG-mv}"
+cpprog="${CPPROG-cp}"
+chmodprog="${CHMODPROG-chmod}"
+chownprog="${CHOWNPROG-chown}"
+chgrpprog="${CHGRPPROG-chgrp}"
+stripprog="${STRIPPROG-strip}"
+rmprog="${RMPROG-rm}"
+mkdirprog="${MKDIRPROG-mkdir}"
+
+transformbasename=""
+transform_arg=""
+instcmd="$mvprog"
+chmodcmd="$chmodprog 0755"
+chowncmd=""
+chgrpcmd=""
+stripcmd=""
+rmcmd="$rmprog -f"
+mvcmd="$mvprog"
+src=""
+dst=""
+dir_arg=""
+
+while [ x"$1" != x ]; do
+ case $1 in
+ -c) instcmd="$cpprog"
+ shift
+ continue;;
+
+ -d) dir_arg=true
+ shift
+ continue;;
+
+ -m) chmodcmd="$chmodprog $2"
+ shift
+ shift
+ continue;;
+
+ -o) chowncmd="$chownprog $2"
+ shift
+ shift
+ continue;;
+
+ -g) chgrpcmd="$chgrpprog $2"
+ shift
+ shift
+ continue;;
+
+ -s) stripcmd="$stripprog"
+ shift
+ continue;;
+
+ -t=*) transformarg=`echo $1 | sed 's/-t=//'`
+ shift
+ continue;;
+
+ -b=*) transformbasename=`echo $1 | sed 's/-b=//'`
+ shift
+ continue;;
+
+ *) if [ x"$src" = x ]
+ then
+ src=$1
+ else
+ # this colon is to work around a 386BSD /bin/sh bug
+ :
+ dst=$1
+ fi
+ shift
+ continue;;
+ esac
+done
+
+if [ x"$src" = x ]
+then
+ echo "install: no input file specified"
+ exit 1
+else
+ :
+fi
+
+if [ x"$dir_arg" != x ]; then
+ dst=$src
+ src=""
+
+ if [ -d $dst ]; then
+ instcmd=:
+ chmodcmd=""
+ else
+ instcmd=$mkdirprog
+ fi
+else
+
+# Waiting for this to be detected by the "$instcmd $src $dsttmp" command
+# might cause directories to be created, which would be especially bad
+# if $src (and thus $dsttmp) contains '*'.
+
+ if [ -f $src -o -d $src ]
+ then
+ :
+ else
+ echo "install: $src does not exist"
+ exit 1
+ fi
+
+ if [ x"$dst" = x ]
+ then
+ echo "install: no destination specified"
+ exit 1
+ else
+ :
+ fi
+
+# If destination is a directory, append the input filename; if your system
+# does not like double slashes in filenames, you may need to add some logic
+
+ if [ -d $dst ]
+ then
+ dst="$dst"/`basename $src`
+ else
+ :
+ fi
+fi
+
+## this sed command emulates the dirname command
+dstdir=`echo $dst | sed -e 's,[^/]*$,,;s,/$,,;s,^$,.,'`
+
+# Make sure that the destination directory exists.
+# this part is taken from Noah Friedman's mkinstalldirs script
+
+# Skip lots of stat calls in the usual case.
+if [ ! -d "$dstdir" ]; then
+defaultIFS='
+ '
+IFS="${IFS-${defaultIFS}}"
+
+oIFS="${IFS}"
+# Some sh's can't handle IFS=/ for some reason.
+IFS='%'
+set - `echo ${dstdir} | sed -e 's@/@%@g' -e 's@^%@/@'`
+IFS="${oIFS}"
+
+pathcomp=''
+
+while [ $# -ne 0 ] ; do
+ pathcomp="${pathcomp}${1}"
+ shift
+
+ if [ ! -d "${pathcomp}" ] ;
+ then
+ $mkdirprog "${pathcomp}"
+ else
+ :
+ fi
+
+ pathcomp="${pathcomp}/"
+done
+fi
+
+if [ x"$dir_arg" != x ]
+then
+ $doit $instcmd $dst &&
+
+ if [ x"$chowncmd" != x ]; then $doit $chowncmd $dst; else : ; fi &&
+ if [ x"$chgrpcmd" != x ]; then $doit $chgrpcmd $dst; else : ; fi &&
+ if [ x"$stripcmd" != x ]; then $doit $stripcmd $dst; else : ; fi &&
+ if [ x"$chmodcmd" != x ]; then $doit $chmodcmd $dst; else : ; fi
+else
+
+# If we're going to rename the final executable, determine the name now.
+
+ if [ x"$transformarg" = x ]
+ then
+ dstfile=`basename $dst`
+ else
+ dstfile=`basename $dst $transformbasename |
+ sed $transformarg`$transformbasename
+ fi
+
+# don't allow the sed command to completely eliminate the filename
+
+ if [ x"$dstfile" = x ]
+ then
+ dstfile=`basename $dst`
+ else
+ :
+ fi
+
+# Make a temp file name in the proper directory.
+
+ dsttmp=$dstdir/#inst.$$#
+
+# Move or copy the file name to the temp name
+
+ $doit $instcmd $src $dsttmp &&
+
+ trap "rm -f ${dsttmp}" 0 &&
+
+# and set any options; do chmod last to preserve setuid bits
+
+# If any of these fail, we abort the whole thing. If we want to
+# ignore errors from any of these, just make sure not to ignore
+# errors from the above "$doit $instcmd $src $dsttmp" command.
+
+ if [ x"$chowncmd" != x ]; then $doit $chowncmd $dsttmp; else :;fi &&
+ if [ x"$chgrpcmd" != x ]; then $doit $chgrpcmd $dsttmp; else :;fi &&
+ if [ x"$stripcmd" != x ]; then $doit $stripcmd $dsttmp; else :;fi &&
+ if [ x"$chmodcmd" != x ]; then $doit $chmodcmd $dsttmp; else :;fi &&
+
+# Now rename the file to the real destination.
+
+ $doit $rmcmd -f $dstdir/$dstfile &&
+ $doit $mvcmd $dsttmp $dstdir/$dstfile
+
+fi &&
+
+
+exit 0
diff -Naur mxml-2.6/libmxml.so.2.6 mxml-2.6-haiku/libmxml.so.2.6
--- mxml-2.6/libmxml.so.2.6 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/libmxml.so.2.6 2009-10-26 02:44:10.000000000 +0000
@@ -0,0 +1,414 @@
+ELF4<1C>4 (DzDzDzD<>D<><00><00>l<>l<>l<><00><00>ar^]oDY Tig0eZ#jdfA\UR`)c-Imanb',?1/O 8V! 2PqQ6(
+Wp4hSE>M.l &+"%5=9;*:FH<3@KJX$GNB[_7LCk|<00><00>k <00>k
+D<> \<5C> d<> <00><><00><><00>G<00><00>c\<00>d <00>_(UI<00>)B<00><00>(<00>k<00><00>d<00>g"<00><00>2<00>b6<00><<00>,c]<00><00><00>i H<00>aO<00>0 C<00>h<00>j{<00><00>\$5<00><00><00>;x)fdC<00>h%<00>y<00>$N|<00><00><00><00>i 
+\(<00>_*<00><00>g<00>#<00><00>,<00>J<00>!<00><00>.<00>'<00>" <00>eWkd*3/<00><00>LbS<00><00>&<<00><00>j*<00>J@;<00><00>*$<^p̗<00>h&`-,fG:<00>fR`4<dB)`'<00><00> <00>T<00><><00><>Dp#WZ<00>i<00>H<00>f~s<00>gZ<00><00>i <00>C<00>!f<00>b2<00>e<00><00>UTgZ<00>a<6}<00>@'<00>Y$*@<00>)* iv<00>'9<00>k <00>0h"w<00>Y)W.<00><00>*(<00>t[r<00><00>Th`<00>Zr
+<00>cT<00><00>i <00>bUM<00><><00><>`<10><00><>g<00>YT<00>|!n<00><00>hd<00><00>C<00><00>$w<00><00>'<00>?<00>"Uȗ<00>0aVc<00><00>_init_init_before_fini_term_before__deregister_frame_info__register_frame_info_gSharedObjectHaikuVersion_gSharedObjectHaikuABIget_image_symbol_init_after_term_aftermxmlElementDeleteAttrstrcmpfreememmovemxmlElementGetAttrmxmlElementSetAttrstrdupmxmlElementSetAttrf_mxml_vstrdupfmxml_errormallocreallocmxmlEntityAddCallback_mxml_globalmxmlEntityGetNamemxmlEntityGetValuemxmlEntityRemoveCallback_mxml_entity_cbmxmlLoadFdmxmlLoadFilemxmlLoadStringmxmlSaveAllocStringmxmlSaveStringmxmlSaveFdmxmlSaveFile_single_threadedputc_unlockedputcmxmlSAXLoadFdmxmlSAXLoadFilemxmlSAXLoadStringmxmlSetCustomHandlersmxmlSetErrorCallbackmxmlSetWrapMargin_errnopreadwritegetc_unlockedgetc__ctype_bstrtolmxmlNewIntegermxmlNewOpaquestrtodmxmlNewRealmxmlNewTextmxmlNewCustommxmlDeletemxmlReleasestrncmpmxmlNewElementsprintfstrrchrmxmlIndexDeletemxmlIndexEnummxmlIndexFindmxmlIndexNewcallocstrerrormxmlFindElementmxmlIndexResetmxmlAddmxmlRemovemxmlNewCDATA_mxml_strdupfmxmlNewTextfmxmlNewXMLmxmlRetainmxmlWalkNextmxmlWalkPrevmxmlSetCustommxmlSetCDATAmxmlSetElementmxmlSetIntegermxmlSetOpaquemxmlSetRealmxmlSetTextmxmlSetTextfvsnprintfstderrfprintfmxml_ignore_cbmxml_integer_cbmxml_opaque_cbmxml_real_cbpthread_oncepthread_getspecificpthread_setspecificpthread_key_createlibroot.so_edata__bss_start_endlibmxml.so.2`<60><00><><00><>̊<00><>(<28>L<>h<><00><><00><><00><><08>,<2C>P<>p<><00><>Č<00><><14><<3C>`<60><00><><00><>ȍ<00><><10>4<>X<><00><><00><>̎<00><><14>8<>\<5C><00><><00><><00><><00><> <20>X<>|<7C><00><><00><><00><><08>,<2C>P<><00><><00><>ԑ<00><><18><<3C>\<5C><00><><00><>Ē<00><><04>(<28>H<>`<60><00><><00><>ԓ<00>$<24>H<>l<><00><><00><><00><><00><><1C>D<>\<5C>t<><00><><00><>ȕ<00><><1C><<3C><00><><00><>Зؗ<00><><00><><00><><00><><00><08><10><18> <20>(<28>0<>8<>@<40>H<>P<>X<>`<60>h<>p<>x<><00><><00><><00><><00><><00><><00><><00><><00><><00><>ȘИؘ<00><><00><><00><><00><><00><08><10><18> <20>(<28>0<>8<>@<40>H<>P<>X<>`<60>h<>p<>x<><00><><00><><00><><00><><00><><00><><00><><00><><00><>șЙؙ<00><><00><><00><><00><><00><08><10><18> <20>(<28>0<>8<>@<40>H<>P<>X<>`<60>h<>p<>x<><00><><00><><00><><00><><00><><00><><00><><00><><00><>ȚКؚ<00><><00><><00><><00><><00><08><10><18> <20>(<28>0<>8<>@<40>H<>P<>X<>`<60>h<>p<>x<><00><><00><><00><><00><><00><><00><><00><><00><><00><>țЛ؛<00><><00><><00><><00><><00><08><10><18> <20>(<28>0<>8<>@<40>H<>P<>X<>`<60>h<>p<>x<><00><><00><><00><><00><><00><><00><><00><><00><><00><>ȜМ؜<00><><00><><00><><00><><00><08><10><18> <20>(<28>0<>8<>@<40>H<>P<>X<>`<60>h<>p<>x<><00><><00><><00><><00><><00><><00><><00><><00><><00><>ȝН؝<00><><00><><00><><00><><00><08><10><18> <20>(<28>0<>8<>@<40>H<>P<>X<>`<60>h<>p<>x<><00><><00><><00><><00><><00><><00><><00><><00><><00><>ȞО؞<00><><00><><00><><00><><00><08><10><18> <20>(<28>0<>8<>@<40>H<>P<>X<>`<60>h<>p<>x<><00><><00><><00><><00><><00><><00><><00><><00><><00><>ȟП؟ܟ<00><><00><><00><><00><><00><><00><>2<00><>^<00><>_<00><>m0<>
+4<>8<><<3C>@<40>D<>H<>L<>P<> T<>!X<>'\<5C>*`<60>+d<>-h<>.l<>0p<>1t<>2x<>5|<7C>9<00><>:<00><><<00><>A<00><>O<00><>R<00><>U<00><>[<00><>m<00><>p<00><>qU<><55><89>u<08><><00><><00><>N<00><00><>]<5D><00><><00><><00><> h<00><><E9><E0><FF><FF><FF>h<00><><E9><D0><FF><FF><FF>h<00><><E9><C0><FF><FF><FF>h<00><><E9><B0><FF><FF><FF>h <00><><E9><A0><FF><FF><FF> h(<00><><E9><90><FF><FF><FF>$h0<00><><E9><80><FF><FF><FF>(h8<00>p<E9><70><FF><FF><FF>,h@<00>`<60><><FF><FF><FF>0hH<00>P<E9><50><FF><FF><FF>4hP<00>@<40><><FF><FF><FF>8hX<00>0<E9><30><FF><FF><FF><h`<00> <20><><FF><FF><FF>@hh<00><10><><FF><FF><FF>Dhp<00><00><><FF><FF><FF>Hhx<00><><E9><F0><FE><FF><FF>Lh<><00><><E9><E0><FE><FF><FF>Ph<><00><><E9><D0><FE><FF><FF>Th<><00><><E9><C0><FE><FF><FF>Xh<><00><><E9><B0><FE><FF><FF>\h<><00><><E9><A0><FE><FF><FF>`h<><00><><E9><90><FE><FF><FF>dh<><00><><E9><80><FE><FF><FF>hh<><00>p<E9><70><FE><FF><FF>lh<><00>`<60><><FE><FF><FF>ph<><00>P<E9><50><FE><FF><FF>th<><00>@<40><><FE><FF><FF>xh<><00>0<E9><30><FE><FF><FF>|h<><00> <20><><FE><FF><FF><FF>h<><00><10><><FE>U<><55><89><E5>S<>[<5B>Èx<00><><83>uD<75><15><><89><F6><8B><00>P<04><><89><00><00>Ћ<FF><D08B><00>8u⃻<75>t<0F><><83><C4><F4> <20><><F3>P<FF><50><E8><D6><FE>ǃ<FF><00>]<5D><><E8>]ÐU<C390><55><89><E5>S<>[<5B><> x[<5B><>]<5D>U<C3><55><89><E5>S<>[<5B><>x<00><><83>t<16><><83><C4><F8><8D>P<><50> <20><><F3>P<FF><1A><><FF><FF>]<5D><><E8>]ÍvU<><55><89><E5>S<>[<5B><><81>w[<5B><>]<5D>U<C3><55><89><E5>VS<56>[<5B>ów<00>u<08>E<8D>Pj<02><><8D><83><BC><D4>PV<50><1E><><FD><FF><FF><10><>u <09><><83>V<F4>E<8B><45>Ѝe<D08D>[^<5E><>]ÐU<C390><55><89><E5>VS<56>[<5B><>ow<00>u<08>E<8D>Pj<02><><8D><83><CE><D4>PV<50><56><E8><DA><FC><FF><FF><10><>u <09><><83>V<F4>E<8B><45>Ѝe<D08D>[^<5E><>]ÐU<C390><55><89><E5>VS<56>[<5B><>+w<00>u<08>E<8D>Pj<02><><8D><83><DF><D4>PV<50><56><E8><96><FC><FF><FF><10><>u <09><><83>V<F4>E<8B><45>Ѝe<D08D>[^<5E><>]ÐU<C390><55><89><E5>VS<56>[<5B><><81>v<00>u<08>E<8D>Pj<02><><8D><83><F0><D4>PV<50>R<E8><52><FC><FF><FF><10><>u <09><><83>V<F4>E<8B><45>Ѝe<D08D>[^<5E><>]Ð<><C390><90><90><90><90><90><90><90><90><90><90>U<90><55><89><E5> WVS<56>[<5B>Öv<00>}tn<74>E<08>8uf<75>} t`<60>p<1C>x <20><>~V<>E <0C><><83>P<F8>P<>z<E8><7A><FD><FF><FF><10><>u8<75><07><><83>P<F4><50><E8><A8><FD><FF>G<04><><83>P<F4><50><E8><9C><FD>N<FF><4E> <20><>~<11><><83><C4><FC>V<>GPW<50><57><E8><F3><FB><FF>E<08>H<1C>N<><4E><08><><F6><7F>e<8D>[^_<><5F>]ÐU<C390><55><89><E5> WVS<56>[<5B><>v<00>E<08><>t><3E>8u9<75>} u
+<2B>1<EB>v<00>G<04>+<2B>p<1C>x <20><>~<1F><>E <0C><><83>P<F8>P<><50><E8><DD><FC><FF><FF><10><>t<C0>N<DA><4E><08><><F6>1<E2><31>e<8D>[^_<><5F>]É<>U<F6><55><89><E5> WVS<56>[<5B>Úu<00>}<08>E<10><>tE<74>?u@<40>} t:<3A><>t<16><><83>P<F4>Y<E8><59><FC><FF>ƃ<89><10><08><>1<><31><F6><83>V<FC>E PW<50><57><00><><10><>t <09><><83>V<F4><56><E8><9C><FC><FF>e<8D>[^_<><5F>]É<>U<F6><55><89><E5> WVS<56>[<5B><>*u<00>}<08>U<10><>tc<74>?u^<5E>} tX<74><58>tT<74>E<14><><83>PR<50><52>H<00>ƃ<89><10><>u <20>G<18><><83>P<FC>E P<><50><1C><><D5>P<FF><50>F<00>%<25><>&<00><><83>V<FC>E PW<50><00><><10><>t <09><><83>V<F4><0E><><FC><FF>e<8D>[^_<><5F>]<5D>U<C3><55><89><E5> WVS<56>[<5B>Þt<00>E<08>x<1C>p <20><>~A<><41><00>U <0C><><83>R<F8>P<><50><E8><8D><FB><FF><FF><10><>u<1D>F<04><>t <09><><83>P<F4><50><E8><B6><FB><FF>E<10>F1<><31><C0>O<><4F><08><>ŋU<08>B<1C><>u <0C><><83>j<08>=<3D><><FA><FF><17><><83><C4><04>P<>U<08>B P<><50><E8><F4><FA><FF>ƃ<89><10><>t3<74>U<08>r <20><><83><C4>B<1C><>ƋE P<><50><E8><E1><FA><FF><06><><10><>t<10>U<10>E<08>V<04>@1<><31><1F>U<08><><83><C4>BP<>E P<><50><1C><><D5>P<FF><50>E<00><><B8><FF><FF><FF>e<8D>[^_<><5F>]Ð<><C390>U<90><55><89><E5>VS<56>[<5B>çs<00>?F<00><><89>q<04><>c~<1D><><83><C4><F4>\<5C><><D5>P<FF>~E<00><><B8><FF><FF><FF><15><>&<00>E<08>Q<08><04><>A1<><31>e<8D>[^<5E><>]ÐU<C390><55>S<E5>[<5B><>Ss<00>E<08><>ރ<C0><0F><><00><>+<2B><>܌<83><DC8C><FF>⍴&<00><>'<00>r<00>r<00>r<00>r<00>r<00>r<00>r<00>r<00>r<00>r<00>r<00>r<00>r<00>r<00>r<00>r<00>r<00>r<00>r<00>r<00>r<00>r<00>r<00>r<00>r<00>r<00>r<00>r<00>r<00><>{<7B><><D5><FF><1E>t&<00><><83><7F><D5><FF><12><><8D><83><82><D5><FF>
+<2B><><8D><83><85><D5><FF>1<>[<5B><>]ÐU<C390><55><89><E5> WVS<56>[<5B><>vr<00>E<00><>1<C6>;~}<1C>U<08><><83><C4>FR<><04><>Ѓ<FF><10><>} G;~|<7C><><E4><B8><FF><FF><FF>e<8D>[^_<><5F>]É<>U<F6><55><89><E5>WVS<56>[<5B><>&r<00><>D<00><>1<C2><31>B<04><>9<C1>}F<>B <0C>E<89><45>z<08>}<7D><>B<08>};<<3C>u"<22>A<8D><41>B9<>}%<25><><83>)<29><><F0>P<>}<7D>W<F4>E<8B>P<FC><50><E8><9E><F7><FF> <0A>E<83><04>E<83>F9<46>|ƍe<C68D>[^_<><5F>]ÐU<C390><55><89><E5>WVS<56>[<5B>îq<00>E<C7><00>E<C7><00><>t&<00>E<8B>E<><45><F8><89><C2><1F><<02><><D1><FF><83><C4><F8><8D><00><><89><FE><03>E<89><45>P<>UR<>~<7E><><F8><FF><FF><10><>t]} <09>}<7D><><07>t&<00>}<7D><>E<8B>+E<><45><FC><><7F>u<8B><75>U<8B><55><F4><03><><83><C4>P<>EP<>E<E8><45><F8><FF><FF><10><>t$<24>u<8B><75>U<8B><55><F4><03><><83><C4>P<>EP<>%<25><><F8><FF><FF>t<07><><B8><FF><FF><FF><07>U<8B><55>D<04>e<8D>[^_<><5F>]Ð<><C390><90><90><90><90><90><90><90><90><90><90>U<90><55>1<E5><31>U<08><> t<0F><> t
+<2B><> t<05><>
+u<05><00><>]ÍvU<><55><89><E5> VS<56>[<5B>ìp<00>u<08>E <0C>M<10><><89><85><F4><DF><FF><FF><8D><95><F4><DF><FF><FF><00><><E0><FF><FF><89><85><F8><DF><FF><FF><89><85><FC><DF><FF><FF><83>jj<00><><8D><83><E8><94>PQRV<52><56><00><><8D><A5><D8><DF>[^<5E><>]<5D>U<C3><55><89><E5>VS<56>[<5B><>Op<00>u<08>M <0C>U<10><><83>jj<00><>@<40><><9B>PRQV<51><56><00>e<8D>[^<5E><>]<5D>U<C3><55><89><E5>S<>[<5B><>p<00>M<08>U<10><><83>jj<00><><8D><83><84><B3>PR<50>E PQ<50>V<00>]<5D><><E8>]ÍvU<><55><89><E5> WVS<56>[<5B><><81>o<00>E Ph <00><><00><><E0>V<FF>EP<>{<00><><10><>~@=<3D><11><><83>V<F4><56><E8><84><F6><FF>0<EB><30><00><><83><C4>xW<><57><E8><90><F5><FF>ƃ<89><10><>t<13>E PWV<57>EP<>8<00><><89>1<><31><C0><8D><A5><E8><DF>[^_<><5F>]ÐU<C390><55><89><E5> WVS<56>[<5B><>Ko<00>u <0C>}<10><>A<00><><89><B5><F4><DF><FF><FF><8D><B5><F4><DF><FF><FF><00><><E0><FF><FF><89><95><F8><DF><FF><FF><89><AD><FC><DF><FF><FF><83>P<F8><50> <0C><><9A>PjWV<57>EP<>;'<00><> <20><>|~<19><><83>Vj
+<2B><><00><><10><>}<07><><B8><FF><FF><FF> <09><><83>V<F4><56> <00><><8D><A5><D8><DF>[^_<><5F>]ÍvU<><55><89><E5> WVS<56>[<5B>ún<00>}<08>u<10>LA<00><><83>P<F8><50><8D><83><94><A0>PjV<>E PW<50><57>&<00><> <20><>|7~C<><43><8B><00>8t<18>E <0C><><83>Pj
+<2B><06><><F4><FF><FF>|<18>$<24>t&<00>E <0C><><83>Pj
+<2B>^<5E><><F5><FF><FF>}<0E><><B8><FF><FF><FF> <09><>&1<><31>e<8D>[^_<><5F>]<5D>U<C3><55><89><E5>WVS<56>[<5B><>*n<00>u<14><>@<00>U <0C>U<89><55>}<7D>U<10>W<04><><83>P<F8><50><00><><B7>PjVW<56>EP<>,&<00><> <20><>} <09><><B8><FF><FF><FF>/<2F><><89><F6>~ <0B><><83>Wj
+<2B><>$<00>E<8B>;Gr <0A>U<10>E <0C>D<10><00><03><00>E<8B>+E <0C>e<8D>[^_<><5F>]ÐU<C390><55><89><E5> WVS<56>[<5B>Ûm<00>E <0C>}<10>M<14>U<18><><89><85><F4><DF><FF><FF><8D><B5><F4><DF><FF><FF><00><><E0><FF><FF><89><85><F8><DF><FF><FF><89><85><FC><DF><FF><FF><83>RQ<52><51><8D><83><E8><94>PWV<57>EP<><50><00><><8D><A5><D8><DF>[^_<><5F>]É<>U<F6><55><89><E5> WVS<56>[<5B><>6m<00>}<08>u <0C>M<10>U<14>E<18><><83>PR<50><52>@<40><><9B>PQVW<56>t<00>e<8D>[^_<><5F>]É<>U<F6><55><89><E5>VS<56>[<5B><><81>l<00>u<08>M<10>U<14>E<18><><83>PR<50><52><8D><83><84><B3>PQ<50>E PV<50>1<00>e<8D>[^<5E><>]<5D>U<C3><55><89><E5> WVS<56>[<5B>òl<00>u<08>} <0C>D?<00><><89><00><><89>[^_<><5F>]ÐU<C390><55><89><E5>VS<56>[<5B><>l<00>u<08>?<00>0[^<5E><>]<5D>U<C3><55><89><E5>VS<56>[<5B><>[l<00>u<08><>><00><><89>[^<5E><>]<5D>U<C3><55><89><E5> WVS<56>[<5B><>2l<00>}<08>u <0C>E<14>M<10><10><><01><><83>9rz<72><7A><81> <09>E҉<10> <0B>M<14><><00><11>U<14><><83><C4>P<>M<10>P<><50><E8><BA><F2><FF>ƒ<89><10><>u-<2D>U<10><><83><C4>P<>#<23><><F3><FF>M<14><><83><C4>P<><50><<3C><><DB>P<FF><50>=<00><><B8><FF><FF><FF><FF><00>M<10><01>)<29><><C1>Љ<06>E<10><10><><0F><06><><89><10>b<EB><62>&<00><><81> <0B><16><><89><F8> <0C><>:<3A><><81><FF> <0B><16><><89><F8> <0C><><18><16><><89><F8> <0C><><02><06><16><><89><F8> $? <0C><><02><06><16><><89><F8>$? <0C><><02><06><16><>$? <0C><><02>1<><31>e<8D>[^_<><5F>]ÍvU<><55><89><E5> WVS<56>[<5B><>
+k<00>} <0C>U<08>B9Br<14><><83>R<F4>D<00><><10><><0F>S<00>U<08>B<0F>0<B6>B<04><07><><0F>6 <09><>t<13><><00><><0F><><00><><00><><89><F0>|)<29><><0F><><00><>
+<0F><><00><> <0F><><00><> <0F><><00><><00><><81>uF<75>U<08>B9Br<14><><83>R<F4><52><00><><10><><0F><><00>U<08>B<0F>0<B6>B<04><><81><0F><><00><00>8<E9><38><FF><FF>t&<00><><81>uH<75>U<08>B9Br<14><><83>R<F4>p<00><><10><><0F><00>U<08>B<0F>0<B6>B<04><><81><0F>g<00><00><><E9><EA><FE><FF><FF><00><>%<25>=<3D>ud<75>U<08>B9Br<14><><83>R<F4><00><><10><><0F>)<00>U<08>B1Ҋ<10>E<08>@<04><>%<25>=<3D><0F><00><><1F><><06><>? փ<><0F><00><><83>V<F8><56><8D><83><BC><DB><FF><FF><00><>%<25>=<3D><0F><><00>U<08>B9Br<14><><83>R<F4><52><00><><10><><0F><><00>U<08>B1Ҋ<10>E<08>@<04><>%<25>=<3D><0F><><00><><0F><><06><>? ֋U<08>B9Br<14><><83>R<F4>X<00><><10><><0F>g<00>U<08>B1Ҋ<10>E<08>@<04><>%<25>=<3D><0F>E<00><><06><>? ց<><D681><0F><><83>V<F8><56><8D><83><BC><DB><FF> <00><><81><FE><0F><><00><><E9><A3><FD><FF><FF>%<25>=<3D><0F><00>U<08>B9Br<14><><83>R<F4><52><00><><10><><0F><><00>U<08>B1Ҋ<10>E<08>@<04><>%<25>=<3D><0F><><00><><07><><06><>? ֋U<08>B9Br<14><><83>R<F4><52><00><><10><><0F><><00>U<08>B1Ҋ<10>E<08>@<04><>%<25>=<3D><0F>v<00><><06><>? ֋U<08>B9Br<14><><83>R<F4>@<00><><10><><0F>O<00>U<08>B1Ҋ<10>E<08>@<04><>%<25>=<3D><0F>-<00><><06><>? ց<><D681><FE><0F><><00><><83>V<F8><56><8D><83><BC><DB><FF><00>t&<00>U<08>B9Br<14><><83>R<F4><52><00><><10><><0F><><00>U<08><><08>B1Ҋ<10>E <09><>@<04><><13><>
+t<0E><> t <09><> <0F><><00><>(<28><>=<3D><0F>5<00>U<08>B9Br<14><><83>R<F4>{<00><><10><><0F><><00>U<08>B<0F>8<B6>B<08>B9Br <0A><><83>R<F4>S<00><>|i<>U<08><><08>B1Ҋ<10>E<08><><00>U<08>B9Br<10><><83>R<F4>&<00><><10><>|9<>U<08>B1Ҋ<10>E<08><> <09><>@<04><>)<29><>
+t$<24><> t<1F><> t<1A><><83>V<F8><56>|<7C><><DB>P<FF><50>8<00><><B8><FF><FF><FF><FF><00><>(<28><>=<3D>wu<77>U<08>B9Br<10><><83>R<F4><52><00><><10><>|΋U<08>B<0F>8<B6>B<08>B9Br <0A><><83>R<F4><52><00><>|<7C><>U<08>B1Ҋ<10>E<08><> <09><>@<04><>$<24><>=<3D>w<><77><8B><81><00><>
+<2B><><81> <09><><F7><00><><89>e<8D>[^_<><5F>]É<>U<F6><55><89><E5>VS<56>[<5B><><81>e<00>u <0C>F9Fr<14><><83>V<F4><56><00><>}<07><><B8><FF><FF><FF> <0A>V<04>E<08><02>F1<><31>e<8D>[^<5E><>]ÍvU<><55><89><E5> WVS<56>[<5B>Úe<00>}<08><>u"<22>K<EB><4B><00>w<E8><77><EC><FF>8 <00>t <0A>j<E8><6A><EC><FF>8
+<00>u+<2B><><83>h <00>w V<>P<><0E><><EC><FF><FF><10><>|<7C>t<0E>w<04>D <0C>G1<><31><05><><B8><FF><FF><FF>e<8D>[^_<><5F>]<5D>U<C3><55><89><E5> WVS<56>[<5B><>"e<00>}<08><>u<07><><B8><FF><FF><FF>A<EB>G <0C>E<89><45>G;E<>t1<74>u<8B>9<FC>s$<24>t&<00>G<04><><83>)<29>PV<50>P<>J<E8><4A><EB><FF><FF><10><>|<7C><01>;wr<><72>E<8B><45>G1<><31>e<8D>[^_<><5F>]É<>U<F6><55><89><E5> WVS<56>[<5B>òd<00>} <0C><><8B><00>8t<0E>E<08><><83>P<F4>y<E8><79><EA><FF> <0C>E<08><><83>P<F4>{<7B><><EA><FF><FF><10>ƃ<89><C683><0F><><00><07><><0F>V <09><>t<13><><00><><0F><><00><><00><><89><F0>|)<29><><0F><><00><>
+<0F><><00><> <0F><><00><> <0F> <00><><00><><81>uF<75><46><8B><00>8t<0E>E<08><><83>P<F4><50><E8><EB><E9><FF> <0C>E<08><><83>P<F4><50><E8><ED><E9><FF><FF><10>Ɓ<89><C681><0F><><00><00>1<E9><31><FF><FF><FF>t&<00><><81>uH<75><48><8B><00>8t<0E>E<08><><83>P<F4><50><E8><9D><E9><FF> <0C>E<08><><83>P<F4><50><E8><9F><E9><FF><FF><10>Ɓ<89><C681><0F><><00><00><><E9><E3><FE><FF><FF>&<00><>%<25>=<3D>uh<75><68><8B><00>8t<0E>E<08><><83>P<F4>G<E8><47><E9><FF> <0C>E<08><><83>P<F4>I<E8><49><E9><FF><FF><10><><83><0F>9<00><89><C281><00><><81><0F>%<00><><1F><><06><>? ƃ<><0F><><00><><83>V<F8><56><8D><83><BC><DB><FF><FF><00><>%<25>=<3D><0F><><00><><8B><00>8t<0E>E<08><><83>P<F4><50><E8><CD><E8><FF> <0C>E<08><><83>P<F4><50><E8><CF><E8><FF><FF><10><><83><0F><><00><89><C281><00><><81><0F><><00><><0F><><06><>? Ƌ<><C68B><00>8t<0E>E<08><><83>P<F4>}<7D><><E8><FF> <0C>E<08><><83>P<F4><E8><7F><E8><FF><FF><10><><83><0F>o<00><89><C281><00><><81><0F>[<00><><06><>? Ɓ<><C681><13><><83>V<F8><56><8D><83><BC><DB><FF>6<00>t&<00><><81><FE><0F><><00><><E9><8B><FD><FF><FF>%<25>=<3D><0F><00><><8B><00>8t<12>E<08><><83>P<F4><50><E8><F2><E7><FF><10>t&<00>E<08><><83>P<F4><50><E8><F0><E7><FF><FF><10><><83><0F><><00><89><C281><00><><81><0F><><00><><07><><06><>? Ƌ<><C68B><00>8t<0E>E<08><><83>P<F4><50><E8><9E><E7><FF> <0C>E<08><><83>P<F4><50><E8><A0><E7><FF><FF><10><><83><0F><><00><89><C281><00><><81><0F>|<00><><06><>? Ƌ<><C68B><00>8t<11>E<08><><83>P<F4>Q<E8><51><E7><FF><0F>v<00>E<08><><83>P<F4>P<E8><50><E7><FF><FF><10><><83><0F>@<00><89><C281><00><><81><0F>,<00><><06><>? Ɓ<><C681><FE><0F><><00><><83>V<F8><56><8D><83><BC><DB><FF><00><><90><8B><00><><89><F7><08>8t<10>E<08><><83>P<F4><50><E8><E0><E6><FF><0E><><89>E<08><><83>P<F4><50><E8><E0><E6><FF><FF><10><> <09><><FE><13><>
+t<0E><> t <09><> <0F><><00><>(<28><>=<3D><0F>=<00><><8B><00>8t<0E>E<08><><83>P<F4><50><E8><89><E6><FF> <0C>E<08><><83>P<F4><50><E8><8B><E6><FF><FF><10><><89><C7><08><><8B><00>8t<0E>E<08><><83>P<F4>\<5C><><E6><FF> <0C>E<08><><83>P<F4>^<5E><><E6><FF><FF><89><C2><00><><8B><00>8t<10>E<08><><83>P<F4>0<E8><30><E6><FF><0E><><89>E<08><><83>P<F4>0<E8><30><E6><FF><FF><10><> ƃ<>)<29><>
+t$<24><> t<1F><> t<1A><><83>V<F8><56>|<7C><><DB>P<FF>2<00><><B8><FF><FF><FF><FF><00><>(<28><>=<3D>wz<77><7A><8B><00>8t<0E>E<08><><83>P<F4><50><E8><C6><E5><FF> <0C>E<08><><83>P<F4><50><E8><C8><E5><FF><FF><10>Nj<89><C78B><00>8t<0E>E<08><><83>P<F4><50><E8><9C><E5><FF> <0C>E<08><><83>P<F4><50><E8><9E><E5><FF><FF><89><C2> <09><><FA>$<24><>=<3D>w<><77><86><81><00><>
+<2B><><81> <09><><F2><00><><89>e<8D>[^_<><5F>]ÍvU<><55><89><E5>S<>[<5B><>`_<00>M<08><><8B><00>U <0C>8t<14><><83>RQ<52><51><E8><D6><E4><FF><FF><83>t<14><19>v<00><><83>RQ<52>2<E8><32><E6><FF><FF><83>u<07><><B8><FF><FF><FF>1<><31>]<5D><><E8>]ÐU<C390><55><89><E5>LWVS<56>[<5B><>_<00>}<7D><>}<7D><>C<EB>v<00>E<8D>9E<39>s <0A>U<8B><55><BC><89>B<>U<89><55>+<2B><><83><C4><F8><8D><83><E9><DB><FF>}t<06>U<08>BP<><50><8D><83><FC><DB>P<FF><50>0<00><><10>6<EB>t&<00>E<10><><83>P<F8>U R<>U<14>҉ƃ<D289><10><><83>t<18><>~<13><><8B><00><00>pu<><75><93>#t<><74>E<8B><45><00><>;t%<25><><83><C4><FC><8D><83><E9><DB><FF>}t<06>U<08>BP<>E<8D>P<C0><50><<3C><><DC><FF><FF><00>}<7D>#u.<2E>}<7D>xu<14><><83>jj<00>E<8D>P<C2>^<5E><><E4><FF><FF><89>I<EB><49><83>j
+j<00>E<8D>P<C1>J<E8><4A><E4><FF><FF><89>5<EB><35><83>W<F4><57><E8><91><EB><FF>ƃ<89><10><>}&<26><><83><C4><FC><8D><83><E9><DB><FF>}t<06>U<08>BPW<50><57>|<7C><><DC>P<FF><50>/<00><><10><>=<3D><>
+t8<74><38> t3<74><33> t.<2E><><83><C4><FC><8D><83><E9><DB><FF>}t<06>U<08>BPV<50><56><8D><83><BC><DC>P<FF><50>/<00><><B8><FF><FF><FF><06>t&<00><><89>e<8D>[^_<><5F>]<5D>U<C3><55><89><E5><WVS<56>[<5B>Ê]<00>"0<00>E܃<45><DC83>j@<40>y<E8><79><E3><FF>E<89><45><F0><10><>u<14><><83><C4><F4>\<5C><><DD>P<FF>T/<00><> <00>E<89><45>E<08>E<C7>@<00>E<89><45>E<C7><00>E<C7><00>E<C7><00>}t<1A><>t<16><><83><C4><F4>R<C2>M<10>щE<D189><45><E0><10><>
+<00>E<C7><00>}
+<00>}<7D><t+<2B>}Ѓ<><D083>W<F4> <0C><><EC><FF><FF><10><><0F>!<00>}<7D><0F><00>}<7D><0F> <00>E<8B>;E<><0F><00><00>E<8B><45><E0><01><><0F><00><>+<2B><>\<5C><><A3><FF><FF><FF>t&<00>\o\]\1\\<00><><83><C4><F8><83>j<00>E<8D>P<FC>E<8B>P<F0><50><E8><A3><E2>P<FF>M<8B>Q<E8>a'<00>4<EB>E<8B><45><F0><83>P<F8>}<7D>W<E8><57>'<00>@<40><><83><C4><FC><83><C4>E<8D>P<FC>E<8B>P<F0><50><E8><A2><E2><FF><FF><08>$<24>E<8B>P<E8><50>'<00>ƃ<89> <20><><00>E<8B><45><F0><83>P<FC>U<8B>R<E4>M<8B>Q<E8><51>'<00>ƃ<89><10>t<EB><74><89>}܃<><DC83>td<74><64><83>jj<00>E<8B>P<E8>\&<00>ƋE<C68B><45><F0><83>PV<50><56><8B><00>Ѓ<FF> <20><>t=<3D><><83><C4><FC><8D><83><E9><DB><FF>}<7D>t<06>U<8B><55>BP<>E<8B>P<F0><50><8D><83><9C><DD>P<FF><50>-<00><><83>V<F4><56>$1<><31><F6> <20><07><>t&1<><31>E<8B><45>8t6<74><36><8D><83><E9><DB><FF>}<7D>t<06>M<8B><4D>AP<>E<8B>P<F0><50><8D><83><CA><DD><FF>}<7D>u<06><><8D><83><C2><DD>P<FF><50><8D><83><DC><DD><FF>&<00><>E<8B><45>}ЉE<D089><45>E<C7><00><><83>W<F4>g<E8><67><EA><FF><FF><10><>t <0A>}<7D><0F><><0F><><B6>E<89><45><E4>u2<75>}<7D><>t,<2C><><83><C4><FC><8D><83><E9><DB><FF>}<7D>t<06>U<8B><55>BP<>M<8B><4D><E0><8B><84>P<><50><1C><><DE><FF><FF> <00>}t!<21>}<1C><><83>WjV<>E<18>Ѓ<FF><D083>V<F4><56>'<00><> <20><>u1<><31>}<7D>u0<75><30>t,<2C>u<89><75>'<27><>&<00>UЃ<55><D083>R<F4><52><E8><D4><E9><FF><FF><10><>t <0A>}<7D>u<07>E<C7><00>}<7D><<0F><><00>}<7D>t]<5D>}<7D>uW<75><57><83><C4><FC>P<83><50><DE>P<FF>M<8B>Q<E4>}<7D>W<E8>'&<00>ƃ<89><10>}t!<21>E<1C><><83>PjV<>U<18>҃<FF><D283>V<F4>l'<00><> <20><>u1<><31>}<7D>u<07><>t<03>u<89><75>E<C7><00>}<7D><<0F>)<00>E<8B><45>E<89><45><FC><00>}<7D><<0F><><00>}<7D>&uF<75>MQ<>}<7D>W<D4>E P<>U<8B>R<E8><52><E8><E9><FA><FF>EЃ<45><10><><83><0F><><00>E<8D>P<F4>E<8D>P<F0>E<8D>P<FC>M<8B>Q<D0><51><E8><99><ED><FF><FF><10><><0F>a<00>z<EB>E<8D>P<F4>E<8D>P<F0>E<8D>P<FC>}<7D>W<D0>w<E8><77><ED><FF><FF><10><><0F>?<00>U<8B><55>E<8B>)Ѓ<>u <09>:?<0F><><00><>u<19><><83>j<03><>d<83><64><DE>PR<50>G<E8><47><E0><FF><FF><10><>tp<74>U<8B><55>E<8B>)Ѓ<>u<19><><83>j<08><>h<83><68><DE>PR<50>!<21><><E0><FF><FF><10><>tJ<74><4A><83><C4>E<8D><45>E<89>P<D4>U R<>M<14>щEЃ<45><10><><83>t,<2C><><83>P<F4>G<E8><47><E8><FF><FF><10><>u<1C>}<7D>>t<16>}<7D>/<0F><><85><F2><FE><FF>E<8B>9E<39><0F><><86><E6><FE><FF>E<8B><45><00>U<8B><55>֍<89>d<83><64><DE><FF>ǹ<00><><00><><0F><><00> <20>E<8D>P<F4>E<8D>P<F0>E<8D>P<FC>E<8B>P<D0><50><E8><8E><EC><FF><FF><10><><0F>V<00>Uԃ<55><D483>R<F8>M Q<>}<14>׉EЃ<45><10><><83>t$<24><>>u<><75>E<8B><45>U<8B><55><FC>9<>v<C2><76>z<80>-t<><74>z<80>-u<><75>z<80>-u<><75>}<7D>><0F><><00>E<8B><45><00>E<8B><45><F0><83>P<F8>E<8B>P<E8>#<00>ƃ<89><10><>u*<2A><><83><C4><F8><8D><83><E9><DB><FF>}<7D>t<06>U<8B><55>BP<><50><8D><83><9C><DE>P<FF>5*<00><><10><><00>}<0F><00>M<1C><><83>QjV<>}<18>׃<FF><D783>V<F4>'%<00><> <20><><0F><>1<><31><F6><00>֍<89>h<83><68><DE><FF>ǹ <00><><00><><0F><><00> <20>E<8D>P<F4>E<8D>P<F0>E<8D>P<FC>E<8B>P<D0><50><E8><8C><EB><FF><FF><10><><0F>T<00>Uԃ<55><D483>R<F8>M Q<>}<14>׉EЃ<45><10><><83>t$<24><>>u<><75><C0><83>j<02><><8D><83><C7><DE>P<FF>E<8B><45><FC><83>P<FE>Q<E8><51><DE><FF><FF><10><>u<C0><75>}<7D>><0F><><00>E<8B><45><00>E<8B><45><F0><83>P<F8>E<8B>P<E8>"<00>ƃ<89><10><>u%<25><><83><C4><F8><8D><83><E9><DB><FF>}<7D>t<06>U<8B><55>BP<><50><8D><83><FC><DE><FF><FF><00>t&<00>}t!<21>M<1C><><83>QjV<>}<18>׃<FF><D783>V<F4>.$<00><> <20><>u1<><31><F6><0F><><00>}<7D><0F><><00>u<89><75><EC><00><?<0F><><00>#<23>v<00>E<8D>P<F4>E<8D>P<F0>E<8D>P<FC>E<8B>P<D0><50><E8><8F><EA><FF><FF><10><><0F>W<00>Uԃ<55><D483>R<F8>M Q<>}<14>׉EЃ<45><10><><83>t<13><>>u<><75>E<8B>;E<>v<F0><76>x<80>?u<><75>}<7D>><0F><><00>E<8B><45><00>E<8B><45><F0><83>P<F8>E<8B>P<E8>!<00>ƃ<89><10><>u!<21><><83><C4><F8><8D><83><E9><DB><FF>}<7D>t<06>U<8B><55>BP<><50>|<7C><><DF><FF><FF><00>}<0F> <00>M<1C><><83>QjV<>}<18>׃<FF><D783>V<F4>B#<00><> <20><><0F><>1<><31><00>t&<!<0F><00>}<7D>>tj<74>}<7D>&u$<24>MQ<>E<8D>P<F8>} W<>E<8B>P<E8><50><E8><D7><F6><FF>EЃ<45><10><><83><0F>o<00>E<8D>P<F4>E<8D>P<F0>E<8D>P<FC>U<8B>R<D0><52><E8><87><E9><FF><FF><10><><0F>O<00><><83><C4>E<8D>P<F8>M Q<>}<14>׉EЃ<45><10><><83>u<FF><75><95><00>E<8B><45><00>E<8B><45><F0><83>P<F8>E<8B>P<E8>& <00>ƃ<89><10><>u!<21><><83><C4><F8><8D><83><E9><DB><FF>}<7D>t<06>U<8B><55>BP<><50><8D><83><DC><DF><FF><FF><00>}t!<21>M<1C><><83>QjV<>}<18>׃<FF><D783>V<F4>V"<00><> <20><>u1<><31><F6><0F><00>}<7D>u<03>u<89><75>}<7D><0F><00>u<89><75>}<0F><><00><><00>t&</<0F><><00>}<7D>t<1A>M<8B><4D><E8><83><C4>AP<>BP<><50><E8><FB><DB><FF><FF><10><>t(<28><><83><C4><FC> <0B><><E0><FF>}<7D>t<06>}<7D><>GP<>E<8B>P<F0><50><1C><><E0><FF>A<00>v<00>}<7D>>t*<2A>}<7D><>t$<24>t&<00>Eԃ<45><D483>P<F8>U R<>M<14>щEЃ<45><10><>>t<05><><83>u<FF><75>u<8B><75>~ <0C>}<7D><>}t<1B>E<1C><><83>PjV<>U<18>҃<FF><D283>V<F4>u!<00><> <20>}<0F>=<00>}<7D><0F>3<00>M<8B><4D><E8><83>Q<F4>}<10><><FF><D7><00><><90><83>R<F8>E<8B>P<E8><50><00>ƃ<89><10><>u!<21><><83><C4><F8><8D><83><E9><DB><FF>}<7D>t<06>U<8B><55>BP<><50>\<5C><><E0><FF><FF><00>MЃ<4D><D083>Q<F4> <0A><><E3><FF><FF><10><>t&<26>}W<>E<8B>P<D4>U RV<52><56><00>EЃ<45><10><><83><0F>\<00>/<2F>v<00>}<7D>/u&<26>Mԃ<4D><D483>Q<F8>} W<>U<14>҉EЃ<45><10><>><0F><><00>E<C7>/<00>}t<12>M<1C><><83>QjV<>}<18>׃<FF><10>}<7D>u<03>u<89><75>}<7D><><0F>
+<00>}<7D>/t#<23>u<89><75>}tK<74><4B>tG<74><47><83>V<F4>U<10>҉E<D289><45><E0><10>6<EB><36>t&<00>}t+<2B>M<1C><><83>QjV<>}<18>׃<FF><D783>V<F4>> <00><> <20><>u 9u<39>u<07>E<C7><00>E<8B><45>E<89><45><FC><00>t&<00>}<7D>&u:<3A>EP<>U<8B>R<D8>M Q<>}<7D>W<E8><57><E8><D5><F3><FF>EЃ<45><10><><83><0F>m<00>E<8D>P<F4>E<8D>P<F0>E<8D>P<FC>E<8B>P<D0>3<EB>t&<00>}<7D>t<19>}<7D>t<13>UЃ<55><D083>R<F4><52><E8><C8><E1><FF><FF><10><>u <20>E<8D>P<F4>E<8D>P<F0>E<8D>P<FC>M<8B>Q<D0>P<E8><50><E6><FF><FF><10><><0F><00><><83><C4>}<7D><>}<7D>W<D8>E P<>U<14>҉EЃ<45><10><><83><0F>a<85><61><F5><FF>E<8B><45><F0><83>P<F4><50><E8><AF><D9><FF><FF><10>}<7D>tj<74>u<8B><75>F <0C><0E><><89>M<8B><4D>I <0C>M<89><4D>A ;Et<04><>u<C0>;u<>t6<74>V <0C><><83><C4><FC> <0B><><E0><FF><FF>t<03>BP<>FP<><50><8D><83><DC><E0>P<FF>$<00>}<7D><><EC><83>W<F4><57><00><><00><><90>t <0C><><89><F0><00><>t&<00>E<8B><45><EC><00><><83><C4><F4>q<83><71><DE><FF>[<5B><><83><C4><F4><8D><83><CA><DE><FF>P<EB><50><89><F6><83><C4><F4><<3C><><DF><FF>C<EB><43>t&<00><>􍃼<C4><F48D83BC><DF><FF>3<EB><33>t&<00>E<8B><45><F0><83>P<FC>E<8B>P<D0><50><8D><83><9C><E0>P<FF><50>#<00><><83>V<F4>h<00><> <20><12><><83><C4><F4>Q<83><51><DE>P<FF>l#<00><><10>U<8B><55><EC><83>R<F4>E<00>E<8B><45><F0><83>P<F4><50><E8><AD><D8>1<FF><31>e<8D>[^_<><5F>]ÐU<C390><55><89><E5>WVS<56>[<5B><>:Q<00><><83>j@<40>1<E8><31><D7><FF>E<89><45><F8><10><>u<1B><><83><C4><F4><1C><><E1>P<FF> #<00><><00><>&<00>E<C7>@<00><><83>j@<40><><E8><FB><D6><FF>E<89><45><EC><10><>u%<25>E<8B><45><F8><83>P<F4>5<E8><35><D8><FF><FF><83><C4><F4>\<5C><><E1>P<FF><50>"<00>><00><>t&<00>E<C7>@<00><><00>t&<00><><83>V<F4><56><E8><C7><DF><FF><FF><10><><0F><><00><>/t<05><>?u2<75>E<10><><83>P<F8>U R<>U<14>҉ǃ<D289><10><>><0F><>W<>U<08>BPV<50><56><8D><83><9C><E1><FF><FF><00><><<0F><><00><>><0F>d<00>E<8B><45><F8><89><10>E<8B>@<40>E<89><45><F4>"t <09><>'<0F><><00><><89>M<EB><4D>&u#<23>UR<>EP<>U R<>EP<><04><><F1><FF>ƃ<89><10><><83><0F>g<00>E<8D>P<FC>E<8D>P<F8>E<8D>PV<50><56><E8><B8><E3><FF><FF><10><><0F>J9<><0F><><00>U<10><><83>R<F8>E P<>U<14>҉ƃ<D289><10><><83>u<FF><75><99><00><><89><F6>&u#<23>EP<>UR<>E P<>UR<><52><E8><96><F0><FF>ƃ<89><10><><83><0F><><00>E<8D>P<FC>E<8D>P<F8>E<8D>PV<50>J<E8><4A><E3><FF><FF><10><><0F><><00>E<10><><83>P<F8>U R<>U<14>҉ƃ<D289><10><><83>t(<28><><83>V<F4>x<E8><78><DE><FF><FF><10><>u<18><>=t<13><>/t<0E><>>t <09><>?<0F>y<85><79><FF><FF>E<8B><45><00>E<8B><45><F8><83>P<F8>EP<><17><><D9><FF><FF><10><><0F>y<00><1B><><00>U<10><><83>R<F8>E P<>U<14>҉ƃ<D289><10><><83>t<10><><83>V<F4> <0A><><DE><FF><FF><10><>uփ<75>=<0F>m<00>E<10><><83>P<F8>U R<>U<14>҉ƃ<D289><10><><83><0F><><00><><83>V<F4><56><E8><D6><DD><FF><FF><10><>u҃<75><D283><0F><><00><>'t<05><>"u|<7C>E<8B><45><EC><89>E<89><45>G<EB><47><89><F6>&u#<23>EP<>UR<>E P<>UR<>f<E8><66><EF><FF>ƃ<89><10><><83><0F><><00>E<8D>P<F0>E<8D>P<EC>E<8D>PV<50><1A><><E2><FF><FF><10><><0F><><00>E<10><><83>P<F8>U R<>U<14>҉ƃ<D289><10><><83><0F><>9<>u<FE><75><99><00>t&<00>E<8B><45><EC><89><10>E<8B>@<40>E<89><45>E<EB><45>&u#<23>UR<>EP<>U R<>EP<><50><E8><E6><EE><FF>ƃ<89><10><><83><0F>I<00>E<8D>P<F0>E<8D>P<EC>E<8D>PV<50><56><E8><9A><E1><FF><FF><10><><0F>,<00>U<10><><83>R<F8>E P<>U<14>҉ƃ<D289><10><><83>t<1F><><83>V<F4><56><E8><C8><DC><FF><FF><10><>u<0F><>=t
+<2B><>/t<05><>>u<><75>E<8B><45><00>E<8B><45><EC><83>P<FC>E<8B>P<F8>EP<><50><E8><D4><D7><FF><FF><10>#<23>v<00>U<08><><83><C4>BP<>E<8B>P<F8><50><8D><83><FC><E1><FF><FF><00><>&<00><>/t<05><>?u9<75>E<10><><83>P<F8>U R<>U<14>҉ǃ<D289><10><>>tBW<42>U<08>BPV<50><56><8D><83><9C><E1>P<FF><00><><BE><FF><FF><FF><FF><10>#<23><>>t<1E>E<10><><83>P<F8>U R<>U<14>҉ƃ<D289><10><><83><0F>:<3A><><FC><FF>E<8B><45><F8><83>P<F4>:<3A><><D4><FF>E<8B><45><EC><83>P<F4>.<2E><><D4><FF><FF><89>L<EB>U<08><><83><C4>BP<>E<8B>P<F8><50><8D><83><FC><E1><FF><10>U<08><><83><C4>BP<><50><8D><83><D2><E1>P<FF><50><00><><10>E<8B><45><F8><83>P<F4><50><E8><EF><D3><FF>E<8B><45><EC><83>P<F4><50><E8><E3><D3><FF><FF><B8><FF><FF><FF>e<8D>[^_<><5F>]<5D>U<C3><55><89><E5> WVS<56>[<5B><>nL<00>}<08><0F>2<BE><32><89><F1><81>u <0C>E <0C>8<0F>:<00>B<01><07>E <0C><00>E<89><45><FC><0F> <0A><>t<19><00>t&<00>}<7D><0F><><00><00><><90>|<<3C><><0F>G<00><>
+<0F>><00><> <0F>5<00><> <0F>,<00><><83>Q<F8><51>|<7C><><DB>P<FF><50><00><><00>v<00><><81>u<1A>z<01><0F><><00>E <0C><00><07>N<E9><4E><FF><FF><FF><81>u<1A>z<01><0F><><00>E <0C><00><07>,<2C><><FF><FF><FF>%<25>=<3D>uC<0F>B%<25>=<3D><0F>_<00><><89><F1><1F><><06>B$?<0F><> <09><><C1><02><17><><0F><><00><><83>Q<F8><51><8D><83><BC><DB><FF>]<5D><><FF><FF><FF>%<25>=<3D>u}<7D>r<0F>B%<25>=<3D><0F> <0F>F%<25>=<3D><0F><><00><17><><0F><><06>$?<0F><> <09><><C1><06>B$?<0F><> <09><><C1><02><17><><81><0F><><83>Q<F8><51><8D><83><BC><DB><FF><FF><E9><EA><FE><FF><FF><81><F9><0F>\<5C><><FE><FF><FF><89><C8><00><>t&<00><><81><00><><81><0F><><00>r<0F>B%<25>=<3D><0F>|<0F>F%<25>=<3D><0F>h<0F>F%<25>=<3D><0F>T<00><17><><07><><06>$?<0F><> <09><><C1><06>B$?<0F><> <09><><C1><06>B$?<0F><> <09><><C1><03><17><><81><F9><0F>g<8F><67><FF><FF><FF><83>Q<F8><51><8D><83><BC><DB><FF>6<E9><36><FE><FF>t&<00><>1<><31>B <09><><C1><02><17><><13><>
+t<0E><> t <09><> <0F><01><><FE><FF><FF>(<28><>=<3D><0F><1C><><FF><FF>7<8B>><0F><>1Ҋ<16><>1<><31>F ƒ<><02>7<89><37>$<24><>=<3D><0F><><00><><81><00><>
+<2B><><81> ʍ<><00><><E9><D1><FE>1<FF><31>B<01><> <09>u<04><17>r<EB><72><02><17><><13><>
+t<0E><> t <09><> <0F>x<85><78><FD><FF><FF>(<28><>=<3D><0F><><87><93><FE><FF>7<8B>~t<1ҊV<01><>1<><31> ƒ<><02>7<89><37>$<24><>=<3D>w<1C><><81><00><>
+<2B><><81> ʍ<><00>O<E9><4F><FE><FF><FF><B8><FF><FF><FF>e<8D>[^_<><5F>]<5D>U<C3><55><89>U <0C>
+;Js<05>E<08><01>1<><31><C0>]É<>U<F6><55><89><E5> WVS<56>[<5B><><81>H<00>u<08><"t<'<0F><><00>E <0C><><83>P<0F>P<>U<10>҃<FF><10><>|l<>F<>E<88><45>y<00><><83><0F>P<>4<E8><34><D5><FF>ǃ<89><10><>tS<74>U <0C><><83>Rj&<26>U<10>҃<FF><10><>|7<>?t<1D>E <0C><><83>P<0F>P<>U<10>҃<FF><10><>|G<>?u<><75>E <0C><><83>Pj;<3B>U<10>҃<FF><10><>}<17><><B8><FF><FF><FF>_<EB>E <0C><><83>P<0F>P<><50><EB>vF<><06><>t :E<><0F>x<85><78><FF><FF>E <0C><><83>P<0F>E<BE>P<FF>U<10>҅<FF>}(<28>„<EB>t"<22><>t&<00>E <0C><><83>P<0F>P<>U<10>҃<FF><10><>|<7C>F<A2>>u<>1<E3><31>e<8D>[^_<><5F>]ÍvU<><55><89><E5>WVS<56>[<5B>÷G<00>}<14>}<0F><><00>U<08><02><><0F><><00><>+<2B><>|<7C><><B8><FF>⍶lGaB<00>A<00>A<00>@@<00>E<18><><83>PWj<00>UR<>E P<>UR<> <00>NjE <0C><> <20><><83>Pj<<3C>U<18>҃<FF><10><><0F>$<00>U<08>B<18>8?t;<3B><><83>j<03><>d<83><64><DE>P<FF>BP<><50><E8><DB><CD><FF><FF><10><>t<1F><><83>j<08><>h<83><68><DE>P<FF>U<08>BP<><50><E8><BC><CD><FF><FF><10><>u.<2E>E<08>p<18>>tE<74>U <0C><><83>R<0F>P<>U<18>҃<FF><10><><0F><>F<>>u<><75>"<22>E<18><><83>P<FC>U R<>U<08>BP<><50><E8><C4><FD><FF><FF><10><><0F><><00>U<08>B<18>‰<89><C289><C1>tz<0F><>t8*t1B8*t,B8*t'B<>
+<2B><>u<08><>t<1C><>t<17><><00>t<0E><><04><><00>u߃<75>BB)‹E<08>|:<01>U<08>@<1C><><89><85><FC><FE><FF>R <20><><89><95><F8><FE><FF><FF><0F><><00><><8B><95><F8><FE><FF><02>Ɖƒ<C689>tz<0F><>t86t1F86t,F86t'F<><16><>u<08><>t<1C><>t<17><><00>t<0E><><04><><00>u߃<75>FF)Ƌ<><C68B><85><F8><FE><FF>H<04><>tK<74>ȉʃ<C889>tz<0F><>t80t1@80t,@80t'@<40><10><>u<08><>t<1C><>t<17><><00>t<0E><><04><><00>u߃<75>@@)ȍt0<03>E<1C><><8B><00><>~$<24>>9<>~<1D>U <0C><><83>Rj
+<2B>U<18>҃<FF><10><><0F>I1<><31><1A>E <0C><><83>Pj <20>U<18>҃<FF><10><><0F>,G<>E<18><><83>P<FC>U R<><52><8B><95><F8><FE><FF>P<>=<3D><><FC><FF><FF><10><><0F><00><><8B><85><F8><FE><FF>xtp<74>U <0C><><83>Rj=<3D>U<18>҃<FF><10><><0F><><00>E <0C><><83>Pj"<22>U<18>҃<FF><10><><0F><><00>E<18><><83>P<FC>U R<><52><8B><95><F8><FE><FF>BP<><50><00><><10><><0F><><00>E <0C><><83>Pj"<22>U<18>҃<FF><10><><0F><><01><><F7><FF><8D><FC><FE><FF><FF><83><85><F8><FE><08><><83><BD><FC><FE><0F>R<8F><52><FE><FF>E<08>x<0F>m<00>U <0C><><83>Rj><3E>U<18>҃<FF><10><><0F>I<00>EG<><47><83>PWj<01>UR<>E P<>UR<><00>NjE<1C><> <20><><83>P<F8>URW<52>EP<>U R<>U<08>BP<>O<E8><4F><FC><FF>ǃ<89> <20><><0F><><00>U<08>B<18><!<0F><><?<0F><><00>E<18><><83>PWj<02>UR<>E P<>UR<><52><00>NjE <0C><> <20><><83>Pj<<3C>U<18>҃<FF><10><><0F><><00>E <0C><><83>Pj/<2F>U<18>҃<FF><10><><0F><><00>E<18><><83>P<FC>U R<>U<08>BP<><50><00><><10><><0F>o<00>E <0C><><83>Pj><3E>U<18>҃<FF><10><><0F>V<00>U<08><><83><C4>B<18>‰<89><C289><C1>tz<0F><>t8*t1B8*t,B8*t'B<>
+<2B><>u<08><>t<1C><>t<17><><00>t<0E><><04><><00>u߃<75>BB)‹E<18>|:PWj<03><><00><>U<08>B<18><!t<?u <20>E <0C><><83>Pj><3E>U<18>҃<FF><10><><0F><><00>EG<>R<EB><52>E <0C><><83>Pj <20>U<18>҃<FF><10><><0F><><00>E <0C><><83>Pj/<2F>U<18>҃<FF><10><><0F><><00>E <0C><><83>Pj><3E>U<18>҃<FF><10><><0F>z<00>E<18><><03><><83>PWj<01>UR<>E P<>UR<>/<00>ǃ<89> <20>]<00>E<08>xtN<74>U<1C><><8B><00><>~'9<>~#<23>E <0C><><83>Pj
+<2B>U<18>҃<FF><10><><0F>1<><31> <20><><00>E <0C><><83>Pj <20>U<18>҃<FF><10><><0F><>G<>U<08><><83><C4><FC><00><><FF><FF>BP<><50>,<2C><><E2>PV<50><15><><C9><FF>E<18><><83>P<FC>U RV<52><56><00><> <20><><0F><><00><><89><F0><8B><95><F4><FE><FF><FF><00>E<18><><83>P<FC>U R<>U<08>BP<><50><00><><10><><0F><><00>U<08>B<18>E<00>v<00>E<08>xtH<74>U<1C><><8B><00><>~!9<>~<1D>E <0C><><83>Pj
+<2B>U<18>҃<FF><10><><0F>R1<><31><1A>E <0C><><83>Pj <20>U<18>҃<FF><10><><0F>5G<>E<08><><08><><00><><FF><FF>@<18>$<24><>/<2F><><E2>PV<50>L<E8><4C><C8><FF>U<18><><83>R<FC>E PV<50>/<00><> <20><><0F><><00><><89><F0><8B><95><F0><FE><FF><10><>u<08><>t<1C><>t<17><><00>t<0E><><04><><00>u߃<75>@@)<29><01><><C7><00>E<08>xtN<74><4E>~J<>U<1C><><8B><00><>~#9<>~<1F>E <0C><><83>Pj
+<2B>U<18>҃<FF><10><><0F><>1<><31><1C><><89>E <0C><><83>Pj <20>U<18>҃<FF><10><><0F>lG<>E<18><><83>P<FC>U R<>U<08>BP<><00><><10><><0F>I<00>U<08>B<1C>‰<89><C289><C1>tz<0F><>t8*t1B8*t,B8*t'B<>
+<2B><>u<08><>t<1C><>t<17><><00>t<0E><><04><><00>u߃<75>BB)<29><01><><00>U<1C><><8B><00><><0F><><00>U<08><><83>R<F4>Љƃ<D089><10><><0F><><00>E<18><><83>P<FC>U RV<52><56><00><><10><><0F><><00><><83>j
+V<><56><E8><EE><C5><FF><FF><10><>uK<75><4B><89><F0><89><F2>tz<0F><>t80t1@80t,@80t'@<40><10><>u<08><>t<1C><>t<17><><00>t<0E><><04><><00>u߃<75>@@)<29><01><>G<EB>ljƒ<C789>tz<0F><>t87t1G87t,G87t'G<><17><>u<08><>t<1C><>t<17><><00>t<0E><><04><><00>u߃<75>GG)ǃ<><C783>V<F4>l<E8><6C><C6><FF><FF><10> <0B><><B8><FF><FF><FF><17>t&<00>E<08>@<04>E<08><><0F>P<85><50><F7><FF><FF><89><F8><8D><A5><D8><FE>[^_<><5F>]<5D>U<C3><55><89><E5> WVS<56>[<5B><><81>><00>}<08>?t<74>v<00><><83><0F>P<>\<5C><><CB><FF>ƃ<89><10><>tC<74>E <0C><><83>Pj&<26>U<10>҃<FF><10><>|E<><1C>t&<00>E <0C><><83>P<0F>P<>U<10>҃<FF><10><>|(F<>>u<><75>E <0C><><83>Pj;<3B> <0B>E <0C><><83>P<0F>P<>U<10>҃<FF><10><>}<07><><B8><FF><FF><FF>G<>?u<>1<84><31>e<8D>[^_<><5F>]<5D>U<C3><55><89><E5> WVS<56>[<5B><>.><00>U<10>u<18><>te<74>E<14><><83>P<F8>EP<>҉ǃ<D289><10><>tO<74>?tJ<74>E <0C><><83>P<0F>P<>U<1C>҃<FF><10><>}<07><><B8><FF><FF><FF>.<2E><
+u
+1<><31><1C><>< u<11><><08><>y<03>F<07>ƃ<89><C683><E6>FG<46>?u<><75><B6><89>e<8D>[^_<><5F>]Ð<><C390><90><90><90><90><90>U<90><55><89><E5>VS<56>[<5B>×=<00>u<08><>t0<74><06><>t <0C><><83>P<F4><50><E8><D2><C4><FF><FF><10>~t<0F>F<10><><83>P<F4><50><E8><BD><C4><FF><FF><10><><83>V<F4><56><E8><B1><C4><FF>e<8D>[^<5E><>]<5D>U<C3><55><89>U<08><>t<08>J ;J|
+1<><31><0F><><00>B<10><04><>B <0C><>]ÍvU<><55><89><E5>WVS<56>[<5B><>=<00>}<08><><0F>F<00>?u
+<2B>}<0F>7<00>} u<1B>}u<15><><83>W<F4><57><E8><90><FF><FF><00><>&<00>G<04><><0F> <00>W <0C><><0F><><00>E<C7>H<>E<89><45><F8>~x<>U<8B>U<><55><F8><89><D0><1F>4<10>G<10><><D1><04>P<B0>EP<>E PW<50><57><00><><10><>u.<2E>N<><4E><0F><><00>G<10>D<8B><44>P<FC>EP<>E PW<50><57><00><><10><>t<C0><74><DA><00><><90>} <0C>u<89><75>
+<2B><>&<00>u<89><75>E<8B>+E<><45><FC><><7F>u<8B>;u<>j<7F>G<10><04>P<B0>EP<>E PW<50>u<00><><10><>t>F;u<>~<7E><>F<EB><46>9<>}<<3C>G<10><04>P<90>EP<>E PW<50>G<00><>u#<23>W <0C>G<10><04><>G <0C><1D><>t&<00>F<01>G <0C>G<10><04><>
+<2B><><89>G<04>G 1<><31>e<8D>[^_<><5F>]É<>U<F6><55><89><E5> WVS<56>[<5B>â;<00>}u1<><31>F<00><><83>jj<01><><E8><CA><C1><FF>ƃ<89><10><>u)<29><><83><C4><FC><83><C4>f<E8><66><C2><FF>P<><1E><><C1>Pj<14><><<3C><><E2>P<FF>S 1<><31><00>}t<11>E<10><><83>P<F4>&<26><><C2><FF><06><><10>} uO<75>}uI<75>}<08><><00><><90><83><C4><FC><83><C4><11><><C2><FF>P<><50><E8><C9><C0>P<FF>F<08><>@<40><>P<><50>|<7C><><E2>P<FF><50> <00><> <20><><83>V<F4>J<E8><4A><FD>1<FF><31><C0><00>v<00><><83>jj<00>EP<>E P<>EPP<50>a<EB>F9F|9<><39>u<0F><><83>h<00><><E8><BD><C0><FF><14><><83><C4><04>P<>FP<>w<E8><77><C1><FF><FF><10><><0F>p<84><70><FF><FF>F<10>F@<40>V<04>F<10><<3C><>F<04><><83>jj<00>EP<>E P<>EPW<50>D<00>ǃ<89> <20><>u<FF><75>F<04><>~ <0A><><83>HPjV<>
+<00><><89>e<8D>[^_<><5F>]É<>U<F6><55><89>E<08><>t <0A>@ <00>xu1<><31><05>@<10><00><>]<5D>U<C3><55><89><E5> WVS<56>[<5B><>
+:<00>}<08>u<10><><83><C4>FP<>U <0C>BP<><02><><C1><FF><FF><10><>u2<75><07><>t*<2A><><83><C4><F8><83>PV<50><56><E8><C0><C3>P<FF><07><><83>P<F8>E P<><50><E8><B0><C3><FF><FF>P<><50><E8><CF><C0><FF><FF>u1<><31>e<8D>[^_<><5F>]ÍvU<><55><89><E5> WVS<56>[<5B>Ö9<00>U <0C>}<10>u<14><>t<14>F<18><><83>PR<50><52><E8><8D><C0><FF><FF><10><>u#<23><>t<1D>E<08><><83><C4><F8><83><C4>PV<50>H<E8><48><C3>PW<50>i<E8><69><C0><FF><FF>u1<><31>e<8D>[^_<><5F>]ÐU<C390><55><89><E5> WVS<56>[<5B><>29<00><>&<00>U<08>M <0C>u<10>B<10>ϋ<04><>E<89>9<FC>}p<><07><>G;}}!<21>E<8B><45><FC><83>P<FC>U<08>B<10><04>PR<50><52><E8><CF><FE><FF><FF><10><>~<7E><>N;u ~<1E>M<8B><4D><FC><83>Q<FC>U<08>B<10><04>PR<50><52><E8><A9><FE><FF><FF><10><><C0>9<DC>}<1A>M<08>A<10> <0C><><14><><14><>U<08>B<10> <0C>뙋M<08>A<10><><83><C4><04>P<B0>E<8B>PQ<50>m<E8><6D><FE><FF><FF><10><>~<1B>U<08>B<10>M <0C><14><><14><>U<08>M<8B><4D>B<10> <0C><>F<8D>9E }<14><><83>P<FC>E P<>UR<>
+<2B><><FF><FF><FF>F<>u 9u<0F><16><><FF><FF>e<8D>[^_<><5F>]Ð<><C390><90><90><90><90><90><90><90><90><90>U<90><55><89><E5> WVS<56>[<5B><>8<00>}<08>u<14><><0F><><00><><0F><><00>~ t <09><><83>V<F4>R<00>~ <0C>} t <0A>} tZ<74><5A><00><><89>}t <0A>E;Gt9x t<1D>G<10>F<04>G<10><>t<05>p<08><03>w<14>w<10><EB>v<00>U<10>V<04>B<08>F<08>B<08><>t<05>p<04><03>w<10>E<10>p<08>Y<EB>}t <0A>U;Wt9z t"<22>~ <0C>G<14>F<08>G<14><>t
+<2B>p<04><08><>t&<00>w<10>w<14>$<24>E<10>U<10>F<08>B<04>F<04>B<04><>t<05>p<08><03>w<14>E<10>p<04>e<8D>[^_<><5F>]É<>U<F6><55><89><E5> WVS<56>[<5B><>7<00>u<08><><0F><><00><><83>V<F4>[<00> <0C>F<10><><83>P<F4><50><E8><C9><FF><FF><FF><10>~u<><75><06><><0F><><00><>+<2B><><<3C><><C9><FF><FF><FF><E2><89>66C66166<00>F<18><>t <0C><><83>P<F4><50><E8><F4><BD><FF><FF><10>F<1C><><0F><>1<>9<FF>}7<>t&<00>F <20><04><><F8>t <0C><><83>P<F4>ɽ<E8><C9BD><FF><FF><10>F <20>D<8B><04><>t <0C><><83>P貽<50><E8B2BD><FF><FF>G;~|͋F <20><><83>P蝽<50><E89DBD><FF>8<EB>F<18><>t4<74><34><83>P苽<50><E88BBD><FF>&<26>F<1C><>t"<22><><83>P<F4>y<E8><79><BD><FF><14>V<18><>t<10>F<1C><>t <09><><83>R<F4>Ѓ<FF><10><><83>V<F4>W<E8><57><BD><FF>e<8D>[^_<><5F>]ÐU<C390><55><89><E5> WVS<56>[<5B><><81>5<00>} <0C><>u1<><31>,<2C><><83>j<00>EP<>B<00>ƃ<89><10><>t<13><><83>W<F8><57><8D><83><BC><E2>P<FF>9 <00>F<18><><89>e<8D>[^_<><5F>]É<>U<F6><55><89><E5>S<>[<5B>Ð5<00>E<08><><83>jP<><50><00>…<89>t <0C>E <0C>B<18>E<10>B<1C>Ћ]<5D><><E8>]<5D>U<C3><55><89><E5> WVS<56>[<5B><>R5<00>} <0C><>u1<><31>%<25><><83>j<00>EP<><50><00>ƃ<89><10><>t <0C><><83>W<F4><08><><BC><FF>F<18><><89>e<8D>[^_<><5F>]ÐU<C390><55><89><E5>S<>[<5B><>5<00>E<08><><83>jP<>k<00>…<89>t<06>E <0C>B<18>Ћ]<5D><><E8>]É<>U<F6><55><89><E5> WVS<56>[<5B><><81>4<00>} <0C><>u1<><31>)<29>t&<00><><83>j<02>EP<>"<00>ƃ<89><10><>t <0C><><83>W<F4>|<7C><><BB><FF>F<18><><89>e<8D>[^_<><5F>]ÐU<C390><55><89><E5>S<>[<5B><>x4<00>E<08><><83>jP<><50><00><>t<06>E <0C>X<18>]<5D><><E8>]É<>U<F6><55><89><E5> WVS<56>[<5B><>B4<00>}<10><>u1<><31>+<2B><><83>j<04>EP<><50><00>ƃ<89><10><>t<12>E <0C>F<18><><83>W<F4><57><E8><F2><BA><FF>F<1C><><89>e<8D>[^_<><5F>]ÍvU<><55><89><E5> WVS<56>[<5B><><81>3<00>}<10><>u1<><31>3<EB>t&<00><><83>j<04>EP<>B<00>ƃ<89><10><>t<16>E <0C>U<14>F<18><><83>RW<52>b<00>F<1C><><89>e<8D>[^_<><5F>]ÍvU<><55>V<E5>M<08><>tL<74>q <0C><>tE<74>Q<08><>t <0B>A<04>B<04> <09>v<00>A<04>F<10>Q<04><>t<08>A<08>B<08> <09>Q <0C>A<08>B<14>A <00>A<00>A^<5E><>]<5D>U<C3><55><89><E5>VS<56>[<5B><>,3<00>E<08><>u<06><><8D><83><C9><E2>P<FF><50><8D><83><DC><E2>Ph<00><><00><><FC>V<FF>׸<E8><D7B8><FF><FF><83>Vj<00><><E8><94><FD><FF><FF><8D><A5><E8><FB>[^<5E><>]<5D>U<C3><55><89><E5>S<>[<5B><><81>2<00>U<08><>t<1C>B$<24>H<8D><48>J$<24>ȅ<89><12><><83>R<F4><52><E8><9A><FB>1<FF><31><05><><B8><FF><FF><FF>]<5D><><E8>]É<>U<F6><55><89>U<08><>u<07><><B8><FF><FF><FF> <0B>B$<24>H<01>J$<24>ȉ<89>]<5D>U<C3><55><89><E5> WVS<56>[<5B><>v2<00>}<08><><83>j,j訸<><E8A8B8><FF>ƃ<89><10><>u1<><31><1D>E <0C><06>F$<00><>t VjjW<><14><><FA><FF><FF><89>e<8D>[^_<><5F>]Ð<><C390><90><90><90><90><90>U<90><55><89><E5> WVS<56>[<5B><>2<00>u<08>}<18><><0F><><00>} <0F><><00>}u<08><><0F><><00>E<1C><><83>P<FC>E PV<50><56><00>ƃ<89><10><>tp<74>>uY<75>~tS<74>}t<1A>E<10><><83>P<F8>FP<>Ƹ<E8><C6B8><FF><FF><10><>u6<75>v<00>}t)<29>E<14><><83>PV聻<56><E881BB><FF><FF><10><>t<19><>t<11><><83>PW蔸<57><E894B8><FF><FF><10><>u<04><><89><14>}u<07><><83>j낋v<04><>1<8C><31>e<8D>[^_<><5F>]ÍvU<><55><89>E<08>M <0C><>tD<74>P<10><>t<06>}u 9<>t3<74>P<04><>t<07><><89>*<2A>v<00>@ <0C><>t9<>t<1A>xu<0F>@ 9<>t <0A><>t <09><><EB><ED><89>@<04>1<><31><C0>]ÐU<C390><55><89>E<08>M <0C><>t49<34>t0<74>P<08><>t"<22>B<14><>t<17>}t<11>xt<18>@<14>xu<><75> <0A><><89> <09>@ 9<>u1<><31><C0>]Ð<><C390><90><90><90><90><90><90><90><90><90><90>U<90><55><89><E5>VS<56>[<5B>×0<00>u<08><>t<05>>t<07><><B8><FF><FF><FF>"<22>V<18><>t <0A>F<1C><>t<06><><83>R<F4>ЋE <0C>F<18>E<10>F1<><31>e<8D>[^<5E><>]É<>U<F6><55><89><E5> WVS<56>[<5B><>B0<00>u<08>} <0C><>t%<25>>u <20><>t<1C><><83>j<08><><00><><E3>P<FF>FP<>۶<E8><DBB6><FF><FF><10><>t<08><><B8><FF><FF><FF>)<29><>F<18><>t <0C><><83>P<F4>L<E8><4C><B7><FF><FF><10><><83>W<F8><57> <09><><E3>P<FF>m<00>F1<><31>e<8D>[^_<><5F>]É<>U<F6><55><89><E5> WVS<56>[<5B><><81>/<00>u<08>} <0C><>t <09>>u<04><>u<07><><B8><FF><FF><FF>!<21>F<18><>t <0C><><83>P<F4><50><E8><E9><B6><FF><FF><10><><83>W<F4>m<E8><6D><B6><FF>F1<><31>e<8D>[^_<><5F>]É<>U<F6><55><89>U<08><>t<05>:t<07><><B8><FF><FF><FF><08>E <0C>B1<><31><C0>]É<>U<F6><55><89><E5> WVS<56>[<5B><>B/<00>u<08>} <0C><>t <09>>u<04><>u<07><><B8><FF><FF><FF>!<21>F<18><>t <0C><><83>P<F4>i<E8><69><B6><FF><FF><10><><83>W<F4><57><E8><ED><B5><FF>F1<><31>e<8D>[^_<><5F>]É<>U<F6><55><89>E<08><>t<05>8t<07><><B8><FF><FF><FF><08>E <0C>X1<><31><C0>]É<>U<F6><55><89><E5> WVS<56>[<5B><><81>.<00>u<08>}<10><>t <09>>u<04><>u<07><><B8><FF><FF><FF>'<27>F<1C><>t <0C><><83>P<F4><50><E8><E9><B5><FF><FF><10>E <0C>F<18><><83>W<F4>g<E8><67><B5><FF>F1<><31>e<8D>[^_<><5F>]<5D>U<C3><55><89><E5> WVS<56>[<5B><>b.<00>u<08>}<10><>t <09>>u<04><>u<07><><B8><FF><FF><FF>+<2B>F<1C><>t <0C><><83>P艵<50><E889B5><FF><FF><10>E <0C>U<14>F<18><><83>RW<52><57><00>F1<><31>e<8D>[^_<><5F>]Ð<><C390><90><90><90><90><90>U<90><55><89><E5> WVS<56>[<5B><><81>-<00>u<08><><00>Dž<89>tC<74>E PVh<00><><00><><FC>V<FF><56><E8><E0><B3><FF><FF><10>?t <0C><><83>V<F4><07><><FF><1B><><89><F6><83>V<FC><56><16><><E3>P<FF><50><8B><00>P<><13><><B4><FF><FF><8D><A5><E8><FB>[^_<><5F>]É<>U<F6><55><89><E5><B8><FF><FF><FF><FF>]<5D>U<C3><55><89><00><>]<5D>U<C3><55><89><00><>]<5D>U<C3><55><89><00><>]<5D>U<C3><55><89><E5>VS<56>[<5B><>O-<00><><83><C4><F8>,<2C><><D3>P<FF><50><8D>P躳<50><E8BAB3><FF><FF><8B><00><><83>P<F4>˲<E8><CBB2><FF>ƃ<89> <20><>u;<3B><><83>h<F8>j<01>S<E8><53><B3><FF>ƃ<89><C683>V<F8><56><8B>P<>A<E8><41><B4><FF><FF><8B><00>F<00>Fdž<>H<00><><89>e<8D>[^<5E><>]<5D>U<C3><55><89><E5>S<>[<5B><><81>,<00><><83><C4><F8>\<5C><><D3>P<FF><50><8D>P<>S<E8><53><B3><FF>]<5D><><E8>]<5D>U<C3><55><89><E5>S<>[<5B>Ø,<00>E<08><><83>P<F4>ݳ<E8><DDB3><FF>]<5D><><E8>]Ð<><C390><90><90><90><90><90><90><90>U<90><55><89><E5>S<>[<5B><>h,<00>U<08>E <0C><><83>PR<50> <00>]<5D><><E8>]É<>U<F6><55><89><E5> WVS<56>[<5B><>7,<00>E P<>EPh<00><><00><><FF>V<FF>/<2F><><B2><FF><FF>=<3D>w <0B><><83>V<F4><56><E8><EC><B2><FF>(<28><><83><C4>xWj<01><<3C><><B2><FF>ƃ<89><10><>t<0F>E P<>EPWV<57><56><E8><F4><B1><FF><FF><89><F0><8D><A5><E8><FE>[^_<><5F>]Ð<><C390><90><90><90><90><90><90>U<90><55><89><E5>VS<56>[<5B>÷+<00><>8<B3><38><FF><FF><FF>8<BB><38><FF><FF>t <0C><06>Ѓ<FF><D083><C6>><3E>u<FF>[^<5E><>]ÍvU<><55><89><E5>S<>[<5B>À+[<5B><>]<5D>U<C3><55><89>u<08>1<E8><31><B4><FF>в<E8><D0B2><FF>k<E8><6B><B4><FF><FF>]<5D>initialize_beforeinitialize_afterterminate_beforeterminate_afterUnable to allocate memory for attribute '%s' in element %s!Unable to add entity callback!ampltgtquotzwnjzwjzetayumlyenyacutexiweierpuumlupsilonupsihumlugraveucircuarruacuteuArrtradetimestildethornthinspthetasymthetathere4tauszligsupesup3sup2sup1supsumsubesubspadessimsigmafsigmashysectsdotscaronsbquorsquorsaquorlmrhorfloorregrealrdquorceilrarrraquorangradicrArrpsipropprodprimepoundplusmnpivpiphiperppermilpartparaoumlotimesotildeoslashordmordforoplusomicronomegaolineograveoeligocircoacutenuntildensubnotinnotninendashnbspnablamuminusmiddotmicromdashmacrlsquolsaquolrmlozlowastlfloorleldquolceillarrlaquolanglambdalArrkappaiumlisiniquestiotaintinfinimageigraveiexclicirciacutehibarhellipheartsharrhArrgegammafraslfrac34frac14frac12forallfnofexisteuroeumlethetaequivepsilonenspemspemptyegraveecirceacutedividediediamsdeltadegdarrdaggerdArrcurrencupcrarrcopycongclubscircchicentcedilccedilcapbullbrvbarbrkbarbetabdquoaumlatildeasymparingaposangandalphaalefsymagraveaeligacuteacircaacuteZetaYumlYacuteXiUumlUpsilonUgraveUcircUacuteThetaTauTHORNSigmaScaronRhoPsiPrimePiPhiOumlOtildeOslashOmicronOmegaOgraveOcircOacuteOEligNuNtildeMuLambdaKappaIumlIotaIgraveIcircIacuteGammaEumlEtaEpsilonEgraveEcircEacuteETHDstrokDeltaDaggerChiCcedilBetaAumlAtildeAringAlphaAgraveAcircAacuteAEligUnable to expand string buffer to %d bytes!Bad control character 0x%02x not allowed by XML standard!Invalid UTF-8 sequence for character 0x%04x!nullEntity name too long under parent <%s>!Character entity "%s" not terminated under parent <%s>!Entity name "%s;" not supported under parent <%s>!Bad control character 0x%02x under parent <%s> not allowed by XML standard!MXML_CUSTOMMXML_TEXTMXML_REALMXML_OPAQUEMXML_INTEGERMXML_ELEMENTUnable to allocate string buffer!Bad custom value '%s' in parent <%s>!integerrealBad %s value '%s' in parent <%s>!Unable to add value node of type %s to parent <%s>!Bare < in element!!--![CDATA[Early EOF in comment node!Unable to add comment node to parent <%s>!]]Early EOF in CDATA node!Unable to add CDATA node to parent <%s>!Early EOF in processing instruction node!Unable to add processing instruction node to parent <%s>!Early EOF in declaration node!Unable to add declaration node to parent <%s>!(null)Mismatched close tag <%s> under parent <%s>!Unable to add element node to parent <%s>!Expected > but got '%c' instead for element <%s/>!Missing close tag </%s> under parent <%s>!Unable to allocate memory for name!Unable to allocate memory for value!Expected '>' after '%c' for element %s, but got '%c'!Bare < in element %s!Missing value for attribute '%s' in element %s!%d%fUnable to allocate %d bytes for index - %sUnable to allocate %d bytes for index: %s![CDATA[%s]]1.0?xml version="%s" encoding="utf-8"?![CDATA[![CDATA[%s]]mxml: %s
+| <04> <00> <00>A<08>B D<>A<>A<>t. <!fA<08>B D<>A<>A<>}. `|!nA<08>B D<>A<>A<>i. <00><00>!<00>A<08>B D<>A<>A<>m. <00>x"<00>A<08>B D<>A<>A<>i.| <04> p#WA<08>B D<>A<>e.<<00>#<00>A<08>B A<> X<00>$NA<08>B D<>A<>A<>g.$|<00>$wA<08>B D<>
+A<> A<> P.$<00>h%<00>A<08>B D<>
+A<> A<> H.| <04>@&%A<08>B  0h&`A<08>B G<><47>A<><41>D. T<00>&<A<08>B D<>A<>f. x'9A<08>B D<>f. $<00>@'<00>A<08>B G<><47>A<><41>A<><41>`.(<00><00>'<00>A<08>B G<><47>A<><41>A<><41>H. T.$<00>\(<00>A<08>B D<>A<>A<>j. b.$<00>(<00>A<08>B D<>
+A<> A<> v. _.$<x)fA<08>B G<><47>A<><41>A<><41>H. d<00>)BA<08>B D<>A<>A<>j. <00>$*@A<08>B D<>A<>j. <00>d*3A<08>B D<>A<>A<><00><00>*$A<08>B D<>A<><00><00>*(A<08>B D<>A<>$<00>*%A<08>B D<>A<>A<>P. 8 ,"A<08>B D<>A<>A<>^. \01IA<08>B D<>A<>[.$<00>|1xA<08>B D<>A<>A<>D.$<00><00>1nA<08>B D<>A<>A<>@. <00>d2QA<08>B D<>A<>A<>a.<00><00>7WA<08>B D<>b.$8|A<08>B D<>A<>A<>I. <<00>9O A<08>B D<>A<>A<>Y. `<00>E<00>A<08>B D<>
+A<> A<> Q.$<00><00>J|A<08>B D<>A<>A<><02>.<00>$NA<08>B  <00>@NA<08>B D<>A<>A<>k.8<00>\O<00>A<08>B G<>JA<4A>KA<4B>Lf. V.<03>. {.V. u. $@X<00>A<08>B D<>A<>A<>^. H<00>X<00>A<08>B D<>A<>A<>a.| <04> <00>YTA<08>B D<>A<>].<<00>Y)A<08>B  TZrA<08>B D<>
+A<> A<> v.4xt[rA<08>B D<>A<>A<>`.T.H.M.H.<02>. ^.<00><00>\$A<08>B  <00> ]qA<08>B D<>A<>A<>`. <00><00>]cA<08>B D<>A<>A<>a.$<00>]A<08>B D<>A<>A<>K.| <04> _A<08>B D<>A<>A<>l. <`'A<08>B D<>A<>A<>[. `0aVA<08>B D<>A<>A<>`.<00><00>a<A<08>B D<>U. <00><00>aOA<08>B D<>A<>A<>`.<00>b6A<08>B D<>U. <00>LbSA<08>B D<>A<>A<>d. <00>b2A<08>B D<>U. ,<00>bUA<08>B D<>A<>A<>`. P,c]A<08>B D<>A<>A<>d.t<00>c\A<08>B A<> <00><00>cTA<08>B G<><47>A<><41>m.<00><dBA<08>B D<>f.<00><00>d A<08>B  <00><00>dXA<08>B D<>A<>A<>V.| <04> e<00>A<08>B D<>A<>A<>~.<<00>eWA<08>B T,fGA<08>B | <04> <00>fRA<08>B D<>A<>q. <<00>f~A<08>B D<>A<>A<>o. `TgZA<08>B D<>A<>A<>q.<00><00>g"A<08>B  <00><00>gZA<08>B D<>A<>A<>q.<00>0h"A<08>B  <00>Th`A<08>B D<>A<>A<>q. <00><00>hdA<08>B D<>A<>A<>q.| <04>$ ivA<08>B G<><47>A<><41>A<><41>k.@<00>i A<08>B X<00>i A<08>B p<00>i A<08>B <00><00>i A<08>B  <00><00>i<00>A<08>B D<>A<>].<00>Pj0A<08>B D<>].<00><00>j&A<08>B D<>S.| <04><00>j*A<08>B D<>W. 8<00>j{A<08>B G<>FA<46>GA<47>H`.<00><><FF><FF><00><><FF><FF>Be | <00>k<00> <00>
+r $<24><00><00>| <00><><FA>o]l<><00><00><00><00><00>"2BRbr<00><00><00><00><00><00><00><00>"2BRbr<00>h%h<>>r<00>7r<00>1r<00>*r<00>$r<00>r<00>r<00>r<00> r<00>r<00>r<00><00>q! <00>q<00><00>q<00><00>q<00><00>q<00><00>q<00><00>q<00><00>q<00><00>q<00><00>q<00><00>q<00><00>q<00><00>q<00><00>q<00><00>q<00><00>q<00><00>q<00><00>q<00><00>q<00><00>q<00><00>q<00><00>qRzq<00>tq<00>mq<00>gq<00>_q<00>Xq<00>Qq<00>Lq<00>Hq<00>Eq<00>?q3 ;q<00>7q<00>0q`*q<00>$q<00> q<00>q<00>q<00> q<00>q<00><00>p<00><00>p<00><00>p<00><00>p<00><00>px<00>p<00><00>p<00><00>p<00><00>p<00><00>p<00><00>p<00><00>p5!<00>p<00><00>l&<00>p'"<00>p "<00>p'<00>p<00><00>pH"<00>p<00><00>p<00><00>p <00>p<00><00>p<00>yp<00>tp" pp)"ip<00>cp<00>^p<00>Zp<00>Up<00>Opc&JpE"Ep<00>?p<00>!;p*"4p<00>/p<00>!(p #p<00>!p<00>p<00>pf&p<00>p<00>p<00><00>o<00><00>o<00><00>o"<00>o <00>o <00>o<00><00>oa"<00>o<00><00>o<00><00>o<00><00>o<00> <00>o"<00>o<00><00>o"<00>o<00><00>o<00><00>o<00><00>oD <00>o<00><00>oe"<00>l><00>o<00>!<00>o<00>!}oe&vo& po<00>io<00>co<00>]o<00>Vo<00>Po!Jo"Fo+"Ao<00>:o<00>5o"0o<00>*o<00>%o<00>!o<00>o)#o<00>o<00>!o#o <00>nd"<00>n
+#<00>n"<00>n<00>%<00>n <00>n9 <00>n <00>l<<00>n<00><00>n <00>n<00><00>n<00><00>n"<00>n<00><00>n"<00>n<00><00>n <00>n`"<00>n "<00>n<00><00>n "<00>n<00>"<00>n<00><00>n<00><00>n<00>~n<00>xnSqn<00>kn> en<00>]n<00>Wn<00>"Tn("On<00>Jn<00>Cn<00><n<00>5n<00>"0n<00>+n<00>&n"n0 n<00>"n<00>n<00>n<00>n<00>n<00><00>m2 <00>m"<00>m"<00>m<00><00>l"<00>m<00>!<00>m"<00>m*#<00>m<00><00>m<00>!<00>m #<00>m <00>m!<00>m<00><00>m #<00>m<00><00>m <00>m: <00>m <00>m <00>ma<00>m<00>"<00>m<00><00>m<00><00>m<00>zm<00>vm<"om`&km<00>"fm<00>"bm"^m<00>"Ym<00>Tm<00>Om<00>Jm<00>"Dm<00>@m<00>9m4"3m<00>*m<00>#m m<00>m<00>m<00> m"!m<00>!<00>l<00><00>l<00>!<00>l<00><00>l<00><00>l<00><00>l<00><00>l<00><00>l<00><00>l!<00>l<00><00>l<00><00>l<00><00>l<00><00>l<00><00>l <00>l etXtLtBt8t,t<00><><FF><FF><FF><FF><FF><FF>GCC: (GNU) 2.95.3-haiku-090629GCC: (GNU) 2.95.3-haiku-090629GCC: (GNU) 2.95.3-haiku-090629GCC: (GNU) 2.95.3-haiku-090629GCC: (GNU) 2.95.3-haiku-090629GCC: (GNU) 2.95.3-haiku-090629GCC: (GNU) 2.95.3-haiku-090629GCC: (GNU) 2.95.3-haiku-090629GCC: (GNU) 2.95.3-haiku-090629GCC: (GNU) 2.95.3-haiku-090629GCC: (GNU) 2.95.3-haiku-090629GCC: (GNU) 2.95.3-haiku-090629<00> <00>?p#<00>M%@&83<00>F<00>YtZ_<00>
+oesu<><00>f<00> <0C> i<00>0<><00>j<00>n?[mxmlElementDeleteAttr<00>mxmlElementGetAttr<00>mxmlElementSetAttrRmxmlElementSetAttrf<00>?]mxmlEntityAddCallback<00>mxmlEntityGetName<00>mxmlEntityGetValue!mxmlEntityRemoveCallbackv_mxml_entity_cbM%a!*mxmlLoadFd:mxmlLoadFile<00>mxmlLoadString<00>mxmlSaveAllocStringtmxmlSaveFd<00> mxmlSaveFilej
+mxmlSaveString mxmlSAXLoadFdC mxmlSAXLoadFile<00> mxmlSAXLoadString/ mxmlSetCustomHandlers<00> mxmlSetErrorCallback<00> mxmlSetWrapMarginj<00>FU\mxmlIndexDelete<00>mxmlIndexEnummxmlIndexFind<00>mxmlIndexNew+mxmlIndexReset<00>Z[mxmlAdd|mxmlDelete<00>mxmlNewCDATAmxmlNewCustom|mxmlNewElement<00>mxmlNewInteger-mxmlNewOpaque<00>mxmlNewReal<00>mxmlNewTextDmxmlNewTextf<00>mxmlRemove<00>mxmlNewXMLImxmlRelease}mxmlRetainD
+ok<00>mxmlFindElement<00>mxmlWalkNextmxmlWalkPrev<00>u<><00>ZmxmlSetCustomtmxmlSetCDATA<00>mxmlSetElementmxmlSetIntegerImxmlSetOpaque<00>mxmlSetReal<00>mxmlSetText#mxmlSetTextfy <0C>$^mxml_error<00>mxml_ignore_cb<00>mxml_integer_cbmxml_opaque_cbFmxml_real_cbz_mxml_global30<># ]_mxml_strdupf<00>_mxml_vstrdupf;mxml-attr.c/boot/home/Desktop/mxml-2.6GNU C 2.95.3-haiku-090629<01> m#<02>mxmlElementDeleteAttr4<01> !Unode2l<02>name3r<02> i5<>Vattr6<>Wlmxml_node_s,<02>type<02><>#next<02>D#prev<02>D#parent<02>D# child<02>D#last_child<02>D#value<02>J#ref_count<02><>#$user_data<02><>#(<04>x} char int<05>mxml_attr_sfnameg<>#valueh<>#<04>}
+Dmxml_type_eU MXML_IGNORE<00><><FF><FF> MXML_ELEMENT MXML_INTEGER MXML_OPAQUE MXML_REAL MXML_TEXT MXML_CUSTOM<04> <0A>mxml_value_u element<02><>integer<02><>opaque<02><>real<02><>text<02> custom<02>D<05>mxml_element_s lnamem<>#num_attrsn<>#attrso<># doubleDmxml_text_sswhitespacet<>#stringu<>#|mxml_custom_sydataz<>#destroy{<7B>#<10><11>|<12>mxmlElementGetAttror!z!UnodemlPnamenr<02> ip<>Vattrq<>WRmxmlElementSetAttr<01>|!<00>!Unode<01>lWname<01>r<02> value<01>rPvaluec<01><>V<02>mxmlElementSetAttrf<01><01>!x"Unode<01>lWname<01>r<02> format<01>rRap<01><>value<01><>V}8mxml_set_attr<01>x"m#Unode<01>l<02>namer<02> value<01><02>i<01>Wattr<01>Vu_long F long unsigned intu_inth unsigned intu_short<0F> short unsigned intu_char<10> unsigned charulongFushort<16>uinthunchar<19>blkcnt_t long long intblksize_t<1D>fsblkcnt_tfsfilcnt_toff_t ino_t!cnt_t"<22>dev_t#{ long intpid_t${id_t%{uid_t'hgid_t(hmode_t)humode_t*hnlink_t+<2B>daddr_t-<2D>caddr_t.<2E>addr_t0Fkey_t1{ptrdiff_tv{size_t<04>Fssize_t<04>{wchar_t<04><>wint_thclock_t {time_t {suseconds_t{useconds_tF<05>timespectv_secz#tv_nsec{#itimerspecit_interval<1D>#it_value<1E>#<05>tm,!tm_sec"<22>#tm_min#<23>#tm_hour$<24>#tm_mday%<25># tm_mon&<26>#tm_year'<27>#tm_wday(<28>#tm_yday)<29>#tm_isdst*<2A># tm_gmtoff+<2B>#$tm_zone,<2C>#(__gnuc_va_listG<>va_list<06><>fpos_t6Gg _IO_marker i_nextpg #_sbufq<> #_posr<>#$ <05> _IO_FILE<00>q_flagsv<>#_IO_read_ptr{<7B>#_IO_read_end|<7C>#_IO_read_base}<7D># _IO_write_base~<7E>#_IO_write_ptr<>#_IO_write_end<08><>#_IO_buf_base<08><>#_IO_buf_end<08><># _IO_save_base<08><>#$_IO_backup_base<08><>#(_IO_save_end<08><>#,_markers<08>g #0_chain<08><> #4_fileno<08><>#8_flags2<08><>#<_old_offset<08>G#@_cur_column<08><>#H_vtable_offset<08><> #J_shortbuf<08><> #K_lock<08><> #L_offset<08>G#P_codecvt<08><> #X_wide_data<08><> #\_mode<08><>#`_unused2<08><> #dm signed char<1A> }_IO_codecvt<04> _IO_wide_data<04> <1A> }3_IO_lock_tl_IO_FILE<08>m FILE m L 
+ quot
+ <09>#rem
+
+<2B>#div_t
+ &  
+quot
+{#rem
+{#ldiv_t
+Y <1E> 
+quot
+#rem
+#lldiv_t
+<15>  __convert_long_double O__convert_long_double_i P __convert_long_double_d Q+ + h long double <05> random_data fptr <19> #rptr <1A> #state <1B> #rand_type <1C># rand_deg <1D>#rand_sep <1E>#end_ptr <1F> #<04>(drand48_data "x #(#a $(#c %<25># old_x &(#init '<27>#4<00>_compare_function <0C>MSh<01>hhn !  _ISblank _IScntrl _ISpunct _ISalnum"_ISupper"_ISlower"_ISalpha"_ISdigit"_ISxdigit"_ISspace "_ISprint@"_ISgraph<00>
+<2B>mxml_sax_event_eK MXML_SAX_CDATA MXML_SAX_COMMENT MXML_SAX_DATA MXML_SAX_DIRECTIVE MXML_SAX_ELEMENT_CLOSE MXML_SAX_ELEMENT_OPENmxml_sax_event_tRmxml_type_t]<5D>mxml_custom_destroy_cb_t_<>|mxml_error_cb_tbrmxml_attr_ti<>mxml_element_tp<>mxml_text_tv mxml_custom_t|Dmxml_value_t<02>Jmxml_node_t<02><><05>mxml_index_s<02>attr<02><>#num_nodes<02><>#alloc_nodes<02><>#cur_node<02><># nodes<02><>#lmxml_index_t<02><>mxml_custom_load_cb_t<02>4:O<01>lrmxml_custom_save_cb_t<02>lr<1F><01>lmxml_entity_cb_t<02><><04><1F><01>rmxml_load_cb_t<02><><04><1F><01>lmxml_save_cb_t<02><><04> rl<11>mxml_sax_cb_t<02>"(>l<11><11>
+<00>mxml-entity.c/boot/home/Desktop/mxml-2.6GNU C 2.95.3-haiku-090629p#3&<00><02>mxmlEntityAddCallback-<01>p#<00>#Ucb,<2C>Pglobal.uQint<06><01><07><04> <09>char<04>
+u_mxml_global_s<00> error_cb!<21># num_entity_cbs"<22># entity_cbs#<23># wrap$<24>#<23> custom_load_cb%j#<23> custom_save_cb&<26>#<23><04> <0C><07>{ <0A><00>c<04><06><01><07><07><04>jmxml_node_s,<03> type<03><># next<03># prev<03># parent<03># child<03># last_child<03># value<03>
+# ref_count<03><>#$ user_data<03>r#(<04><06><01><07><04>pmxml_type_eUMXML_IGNORE<00><><FF><FF>MXML_ELEMENTMXML_INTEGERMXML_OPAQUEMXML_REALMXML_TEXTMXML_CUSTOM<04>rmxml_value_u element<03>tinteger<03><>opaque<03><>real<03><>text<03><>custom<03><0F>mxml_element_s l namem<># num_attrsn<># attrso<>#doublemxml_text_ss whitespacet<># stringu<>#<mxml_custom_sy datazr# destroy{H# Hr<<0F>mxml_attr_sf nameg<># valueh<>#N<02>mxmlEntityGetNameJ<01><00>#<00>$UvalI<><02>!mxmlEntityGetValueh<01><00>$<00>$Unameg<><02>ii<>Wchj<>PglobalkuVvmxmlEntityRemoveCallback~<01>$g%Ucb}<7D><02>i<>Vglobal<01>uR'_mxml_entity_cb<01><01>h%3&Uname<01><><02>diff<01><>Pcurrent<01><>Wfirst<01><><02>|last<01><><02>x<01> name<01><># val<01><>#entities<01>9З 44 <09> 'u_long Llong unsigned intu_intnunsigned intu_short<0F>short unsigned intu_char<10>unsigned charulongLushort<16>uintnunchar<19>blkcnt_tlong long intblksize_t<1D>fsblkcnt_tfsfilcnt_toff_t ino_t!cnt_t"<22>dev_t#<23>long intpid_t$<24>id_t%<25>uid_t'ngid_t(nmode_t)numode_t*nnlink_t+<2B>daddr_t-<2D>caddr_t.<2E>addr_t0Lkey_t1<>ptrdiff_tv<>size_t<05>Lssize_t<05><>wchar_t<05><>wint_tnclock_t <0C>time_t <0A>suseconds_t<0E>useconds_tL<0F>timespec tv_sec<18># tv_nsec<19>#% itimerspec it_interval<1D># it_value<1E>#<0F> tm,! tm_sec"<22># tm_min#<23># tm_hour$<24># tm_mday%<25># tm_mon&<26># tm_year'<27># tm_wday(<28># tm_yday)<29># tm_isdst*<2A># tm_gmtoff+<2B>#$ tm_zone,<2C>#(__gnuc_va_listG<>va_list<07><> fpos_t6Mm
+_IO_marker i _next pm
+# _sbuf q<> # _pos r<>#*
+<0F> _IO_FILE<00> q _flags v<># _IO_read_ptr {<7B># _IO_read_end |<7C># _IO_read_base }<7D># _IO_write_base ~<7E># _IO_write_ptr <># _IO_write_end <09><># _IO_buf_base <09><># _IO_buf_end <09><># _IO_save_base <09><>#$ _IO_backup_base <09><>#( _IO_save_end <09><>#, _markers <09>m
+#0 _chain <09><> #4 _fileno <09><>#8 _flags2 <09><>#< _old_offset <09>M#@ _cur_column <09><>#H _vtable_offset <09><> #J _shortbuf <09><> #K _lock <09><> #L _offset <09>M#P _codecvt <09><> #X _wide_data <09><> #\ _mode <09><>#` _unused2 <09><> #ds
+signed char <0A> <00>_IO_codecvt<04> _IO_wide_data<04>  <00>3_IO_lock_t l_IO_FILE <09>s
+FILE
+ s
+R  quot <09># rem
+<2B>#div_t , <17>   quot <0E># rem <0F>#ldiv_t _ <17>   quot # rem #lldiv_t <15> %__convert_long_double O__convert_long_double_i P%__convert_long_double_d Q1 1nlong double <0F>random_data  fptr <19># rptr <1A># state <1B># rand_type <1C># rand_deg <1D># rand_sep <1E># end_ptr <1F>#<04>.drand48_data " x #.# a $.# c %<25># old_x &.# init '<27># :<00>_compare_function <0A>SYn<01>nnt _ISblank_IScntrl_ISpunct_ISalnum_ISupper_ISlower_ISalpha_ISdigit_ISxdigit_ISspace _ISprint@_ISgraph<00><10>mxml_sax_event_eKMXML_SAX_CDATAMXML_SAX_COMMENTMXML_SAX_DATAMXML_SAX_DIRECTIVEMXML_SAX_ELEMENT_CLOSEMXML_SAX_ELEMENT_OPENmxml_sax_event_tR mxml_type_t]<5D>mxml_custom_destroy_cb_t_<><mxml_error_cb_tb<>mxml_attr_tiNmxml_element_tptmxml_text_tv<>mxml_custom_t|mxml_value_t<03>
+mxml_node_t<03><><0F>mxml_index_s<03> attr<03><># num_nodes<03><># alloc_nodes<03><># cur_node<03><># nodes<03><>#<04>mxml_index_t<03>mxml_custom_load_cb_t<03>(<04>mxml_custom_save_cb_t<03>Kpmxml_entity_cb_t<03><>mxml_load_cb_t<03><04><06><01><07>mxml_save_cb_t<03><><04><06><01><07><07>mxml_sax_cb_t<03><><04> <0C><07><07>r_mxml_global_t'<27>]!mxml-file.c/boot/home/Desktop/mxml-2.6GNU C 2.95.3-haiku-090629@&xY<00><02>mxml_isspacep<01>@&e&Ucho<>RintBmxml_node_s,<02>type<02>B#next<02><>#prev<02><>#parent<02><># child<02><>#last_child<02><>#value<02><>#ref_count<02><>#$user_data<02>(#(<07>mxml_type_eUMXML_IGNORE<00><><FF><FF> MXML_ELEMENT MXML_INTEGER MXML_OPAQUE MXML_REAL MXML_TEXT MXML_CUSTOM
+<04> (mxml_value_u  element<02> integer<02><> opaque<02>c real<02>q text<02>{ custom<02><> <0E>mxmlLoadFd<01><01>h&<00>&Utop<01><>Vfd<01><>Pcb<01><>Qbuf<01><><04><><91>
+<04><10>B<11>
+<04><12>_mxml_fdbuf_s XfdY<>#currentZ<>#end[<5B>#buffer\ #
+<04>unsigned char<00><14>cmxml_element_s lnamemc#num_attrsn<>#attrso4#
+ichardouble<05>mxml_text_sswhitespacet<>#stringuc#<05>mxml_custom_sydataz(#destroy{<7B>#<15>(
+<04>4mxml_attr_sfnamegc#valuehc#
+<0E>mxmlLoadFile<01><01><00>&'Utop<01><>VfpºQcbØR<05>_IO_FILE<00>q_flagsv<>#_IO_read_ptr{c#_IO_read_end|c#_IO_read_base}c# _IO_write_base~c#_IO_write_ptrc#_IO_write_end<03>c#_IO_buf_base<03>c#_IO_buf_end<03>c# _IO_save_base<03>c#$_IO_backup_base<03>c#(_IO_save_end<03>c#,_markers<03>#0_chain<03> #4_fileno<03><>#8_flags2<03><>#<_old_offset<03>#@_cur_column<03>#H_vtable_offset<03>.#J_shortbuf<03>=#K_lock<03>I#L_offset<03>#P_codecvt<03>Y#X_wide_data<03>o#\_mode<03><>#`_unused2<03>u#d
+<04>_IO_marker i_nextp#_sbufq #_posr<>#
+<04>
+<04>off_tshort unsigned intsigned charIi _IO_codecvt
+K_IO_wide_data
+_<13>i3<0E>mxmlLoadString<01><01>'='Utop݂Qs<01><><02> cbߘR
+<04>iLmxmlSaveAllocString<01>c@'<00>'Unode<01><><02>cb<01>a<02> bytes<01><>Pbufferg<03><>@sca<01><11><11>
+Lti<14><1B>mxmlSaveFd7<01><00>'Y(Unode4<01><02>fd5<01>Vcb6aWcol8<01>Pbuf9<01><04><><91>global:<01> P<12> _mxml_global_s<00> error_cb!<21> #num_entity_cbs"<22>#entity_cbs#<23> #wrap$<24>#<23>custom_load_cb%<25> #<23>custom_save_cb&<26> #<23>
+<04><15> <11>
+<04> <13> <00> c<10> <01><11>
+<04> <10> <01><11><11>
+<04> <10> c<11>
+<04> j
+mxmlSaveFileg<01>\(<00>(Unoded<01>Wfpe<01><02> cbfaVcolh<01>Pglobali<01> P mxmlSaveString<01><01><00>(w)Unode<01><01><02>buffer<01>c<02> bufsize<01><01><02>cb<01>aVcol<01><01>Pptr<01> <02>xglobal<01><01> P c<1B> mxmlSAXLoadFd<01><01>x)<00>)Utop<01><01><02>fd<01><01>Pcb<01><01>Wsax_cb<01>= Qsax_data<01>(Rbuf<01><01><04><><91><15> <11><11> (= mxml_sax_event_eK MXML_SAX_CDATA MXML_SAX_COMMENT MXML_SAX_DATA MXML_SAX_DIRECTIVE MXML_SAX_ELEMENT_CLOSE MXML_SAX_ELEMENT_OPEN
+<04> <1B> mxmlSAXLoadFile<01><00>)"*Utop<02>Wfp<02>Vcb<02>Qsax_cb= Rsax_data(P/ mxmlSAXLoadString+<01>$*d*Utop&<02>Vs'<02><02> cb(<02>Qsax_cb)= Rsax_data*(P<1D> mxmlSetCustomHandlersCd*<00>*UloadA<02> VsaveB<02> WglobalD<02> P<1D> mxmlSetErrorCallbackS<01>*<00>*UcbR<02> VglobalT<02> P
+<04>  mxmlSetWrapMarginf<01>*<00>*Ucolumne<02>Vglobalg<02> P<1E>mxml_add_charx<01><00>* ,Ucht<02>Wbufptru<02>Vbufferv<02><02>bufsizew<02><02>newbufferycR
+c
+<04>Nmxml_fd_getc<01><01> ,.1Up<01>(<02>encoding<01><02>Wbuf<01>Nch<01><02>Vtemp<01><02>R1<00>/=0lch<01><03>WM<00>0"1lch<01><03>W
+<04><1E>mxml_fd_putc<01><01>01y1Uch<01><03>Pp<01>(<02> buf<01>NV<1E>mxml_fd_read<01>|1<00>1UbufNWbytes<04>P6mxml_fd_write><01><00>1b2Ubuf=NWbytes?<04>Pptr@<04>V<1E>mxml_file_getcj<01>d2<00>7Uph(<02>encodingi<04>Wchk<04>Vtempl<04>Pfpm<04><1F>l6<00>6lch <05>R<1F>/7<00>7lch(<05>Rmxml_file_putcA<01><00>78Uch?<05>Qp@(R<1E>mxml_get_entityP<01>8<00>9UparentK<05><02>pL(<02> encodingM<05><02>getc_cbN<05><02>chQ<05>VentityR<05><02>@entptrSc<03><><10><01>(<11>
+<04><13>i?Rmxml_load_data<01><01><00>9<00>EUtop<01><05><02>p<01>(<02> cb<01><05><02>getc_cb<01>R<02>sax_cb<01>= <02>sax_data<01>(<02> error<01><07>Enode<01><05>Vfirst<01><05><02>lparent<01><05><02>hch<01><05><02>Pwhitespace<01><05><02>dbuffer<01>c<02>pbufptr<01>c<02>|bufsize<01><05><02>ttype<01>B<02>`encoding<01><05><02>xglobal<01><05> <02>\types<01>i؟
+<04>dd<18>X_mxml_parse_element<01><00>E<00>JUnode <08><02>p (<02> encoding<08><02>getc_cbR<02> error <09>Jch<08>Vquote<08>Wnamec<02>xvaluec<02>lptrc<02>tnamesize<08><02>|valsize<08><02>p<1E>mxml_string_getc <01><00>J$NUp (Wencoding <09><02> ch <09>Qs <09><1F>HM<00>Mlch<01> <09>R<1F><00>MNlch<01> <09>R
+<04>Mmxml_string_putc
+<01>$N>NUch
+<2B>Pp
+(<02> pp
+<2B>R<1E>mxml_write_name-
+<01>@NYOUs)
+<2B>Vp*
+(<02> putc_cb+
+<2B><02>quote.
+i<02>name/
+<2B>W<10><01><11>(
+<04><1E>mxml_write_nodez
+<01>\O@XUnodet
+<2B><02>pu
+(<02> cbv
+a<02>colw
+<2B>Wputc_cbx
+<2B><02>globaly
+<2B> <02>i{
+<2B><03><>}width|
+<2B>Vattr}
+4<03><>}s~
+<2B><03><>~<1F>7PcPptr<01>
+<2B>V<1F>1WXdata` cVnewlinea <0B>P
+<04><13>i<16>amxml_write_string<01> <01>@X<00>XUs<01> <0B>Wp<01> (<02> putc_cb<01> <0B><02>name<01> <0B>V<1E>mxml_write_ws<01> <01><00>XxYUnode<01> <0B>Pp<01> (<02> cb<01> aRws<01> <0B>Pcol<01> <0B>Vputc_cb<01> <0B><02>s<01> <0B>W!u_long <0A>long unsigned int!u_intunsigned int!u_short!u_char<10>!ulong<15>!ushort!uint!unchar<19>!blkcnt_t<1C>long long int!blksize_t<1D>!fsblkcnt_t<1E>!fsfilcnt_t<1F>!off_t <20>!ino_t!<21>!cnt_t"<22>!dev_t#long int!pid_t$!id_t%!uid_t'!gid_t(!mode_t)!umode_t*!nlink_t+<2B>!daddr_t-<2D>!caddr_t.c!addr_t0<>!key_t1!ptrdiff_tv!size_t<06><>!ssize_t<06>!wchar_t<06><>"wint_t!clock_t !time_t !suseconds_t!useconds_t<0F>mtimespectv_sec#tv_nsec#<05>itimerspecit_interval8#it_value8#|tm,!tm_sec"<22>#tm_min#<23>#tm_hour$<24>#tm_mday%<25># tm_mon&<26>#tm_year'<27>#tm_wday(<28>#tm_yday)<29>#tm_isdst*<2A># tm_gmtoff+<2B>#$tm_zone,c#(!__gnuc_va_listGc!va_list<08>|!fpos_t 6<>#_IO_lock_tl!_IO_FILE<03><>!FILE
+ <0A>$_single_threaded i% quot <09>#rem
+<2B>#!div_t <0B>%L quot #rem #!ldiv_t &%<25> quot <13>#rem <14>#!lldiv_t Z <0B>__convert_long_double O __convert_long_double_i P<> __convert_long_double_d Q<><13>long double <05>random_datafptr<19>#rptr<1A>#state<1B>#rand_type<1C># rand_deg<1D>#rand_sep<1E>#end_ptr<1F>#<05>drand48_data"x#<23>#a$<24>#c%# old_x&<26>#init'<27>#<13>!_compare_function<0E>
+/<01>//
+5&'<27> _ISblank _IScntrl _ISpunct _ISalnum(_ISupper(_ISlower(_ISalpha(_ISdigit(_ISxdigit(_ISspace (_ISprint@(_ISgraph<00>$__ctype_b,<2C>
+<04>!mxml_sax_event_tR<> !mxml_type_t]B!mxml_custom_destroy_cb_t_5
+<04>!mxml_error_cb_tb<> !mxml_attr_ti!mxml_element_tp!mxml_text_tv{!mxml_custom_t|<7C>!mxml_value_t<02><>!mxml_node_t<02><>< mxml_index_s<02>attr<02>c#num_nodes<02><>#alloc_nodes<02><>#cur_node<02><># nodes<02>< #
+<04>!mxml_index_t<02><>!mxml_custom_load_cb_t<02>s
+<04> !mxml_custom_save_cb_t<02><>
+<04> !mxml_entity_cb_t<02><> !mxml_load_cb_t<02><>
+<04>!mxml_save_cb_t<02><>
+L!mxml_sax_cb_t<02>!
+<04> !_mxml_global_t'<27>!_mxml_getc_cb_tT<>!_mxml_putc_cb_tU<>!_mxml_fdbuf_t]<5D>Q.mxml-index.c/boot/home/Desktop/mxml-2.6GNU C 2.95.3-haiku-090629<01>Y<00>^P(<02>mxmlIndexDelete8<01>Y<00>YUind7<>V<04>mxml_index_s<02>attr<02>#num_nodes<02>#alloc_nodes<02>#cur_node<02># nodes<02><>#<04> charint<04>mxml_node_s,<02>type<02><>#next<02>N#prev<02>N#parent<02>N# child<02>N#last_child<02>N#value<02>T#ref_count<02>#$user_data<02><>#(<04>Nmxml_type_eU MXML_IGNORE<00><><FF><FF>
+MXML_ELEMENT
+MXML_INTEGER
+MXML_OPAQUE
+MXML_REAL
+MXML_TEXT
+MXML_CUSTOM <0B>mxml_value_u  element<02><> integer<02> opaque<02> real<02>  text<02> custom<02>N  mxml_element_s lnamem#num_attrsn#attrso<>#doubleNmxml_text_sswhitespacet#stringu#<04>mxml_custom_sydataz<>#destroy{<7B>#<0E><0F><04><04>mxml_attr_sfnameg#valueh#<04>mxmlIndexEnumV<01><00>Y<00>YUindU<>R<10>mxmlIndexFindv<01>Zr[Uinds<>Welementt<><02> valueu<><02>diffwPcurrentxVfirsty<02>|lastz<02>x<04> +mxmlIndexNew-<01>t[<00>\Unode*<01><02>element+<01><02> attr,<01><02>ind.<01>Vcurrent/<01>Wtemp0<01>PamxmlIndexReset<01><01><00>\ ]Uind<01><01>P<16>index_compare<01> ]}]Uind<01><01>Wfirst<01><01><02> second<01><01>Vdiff<01>P7index_find<00>]<00>]Uind<02>Pelement<02>Rvalue<02>Wnode<02>VdiffP<17>index_sort@<01>]<00>^Uind=<02><02>left><02> right?<02>pivotA<02><02>|tempB<02>QtemplCWtemprDVu_long <0A>long unsigned intu_int<0E>unsigned intu_shortshort unsigned intu_char9unsigned charulong<15>ushortuint<17>unchar9blkcnt_t<1C>long long intblksize_tfsblkcnt_t<1E>fsfilcnt_t<1F>off_t <20>ino_t!<21>cnt_t"dev_t# long intpid_t$ id_t% uid_t'<27>gid_t(<28>mode_t)<29>umode_t*<2A>nlink_t+daddr_t-caddr_t.addr_t0<>key_t1 ptrdiff_tv size_t<04><>ssize_t<04> wchar_t<04>wint_t<01>clock_t time_t suseconds_t useconds_t<0F>p timespectv_sec #tv_nsec #<04> itimerspecit_interval; #it_value; #
+tm,!tm_sec"#tm_min##tm_hour$#tm_mday%# tm_mon&#tm_year'#tm_wday(#tm_yday)#tm_isdst*# tm_gmtoff+#$tm_zone,#(__gnuc_va_listGva_list<06>
+fpos_t6<><04>
+_IO_marker i_nextp<>
+#_sbufq1 #_posr#<04>
+1 _IO_FILE<00>q_flagsv#_IO_read_ptr{#_IO_read_end|#_IO_read_base}# _IO_write_base~#_IO_write_ptr#_IO_write_end<08>#_IO_buf_base<08>#_IO_buf_end<08># _IO_save_base<08>#$_IO_backup_base<08>#(_IO_save_end<08>#,_markers<08><>
+#0_chain<08>1 #4_fileno<08>#8_flags2<08>#<_old_offset<08><>#@_cur_column<08>#H_vtable_offset<08>7 #J_shortbuf<08>F #K_lock<08>R #L_offset<08><>#P_codecvt<08>b #X_wide_data<08>x #\_mode<08>#`_unused2<08>~ #d<04>
+signed charR  _IO_codecvtT _IO_wide_datah <1A> 3_IO_lock_tl_IO_FILE<08><>
+FILE <0A>
+<1E> 
+ quot
+ #rem
+
+#div_t
+ <0B>  
+quot
+ #rem
+ #ldiv_t
+<10> A
+quot
+<13>#rem
+<14>#lldiv_t
+ <0B>__convert_long_double O __convert_long_double_i P<> __convert_long_double_d Q<><1A><00>long double Wrandom_data fptr W#rptr W#state W#rand_type # rand_deg #rand_sep #end_ptr W#<04>drand48_data "x #<23>#a $<24>#c %# old_x &<26>#init '#<1A>_compare_function <0C><><04><1F><0F><0F><04> !<21> 
+_ISblank
+_IScntrl
+_ISpunct
+_ISalnum"_ISupper"_ISlower"_ISalpha"_ISdigit"_ISxdigit"_ISspace "_ISprint@"_ISgraph<00>'mxml_sax_event_eK
+MXML_SAX_CDATA
+MXML_SAX_COMMENT
+MXML_SAX_DATA
+MXML_SAX_DIRECTIVE
+MXML_SAX_ELEMENT_CLOSE
+MXML_SAX_ELEMENT_OPENmxml_sax_event_tR<>mxml_type_t]<5D>mxml_custom_destroy_cb_t_r<04>mxml_error_cb_tb<><04><0E><0F>mxml_attr_ti<>mxml_element_tp<>mxml_text_tvmxml_custom_t|Nmxml_value_t<02>Tmxml_node_t<02>mxml_index_t<02><>mxml_custom_load_cb_t<02>JPe<0F><0F>mxml_custom_save_cb_t<02><><04><1F><0F>mxml_entity_cb_t<02><><04><1F><0F>mxml_load_cb_t<02><><04><1F>?<0F>mxml_save_cb_t<02>#<01><0F>mxml_sax_cb_t<02>8>T<0F>'<0F><00>mxml-node.c/boot/home/Desktop/mxml-2.6GNU C 2.95.3-haiku-090629_<00>d<00>.<02>mxmlAddD_`Uparent@eWwhereAk<02> childBe<02>nodeCeVemxml_node_s,<02>type<02>r#next<02><>#prev<02><>#parent<02><># child<02><>#last_child<02><>#value<02><>#ref_count<02>k#$user_data<02>X#(<04>int<08>mxml_type_eU MXML_IGNORE<00><><FF><FF>
+MXML_ELEMENT
+MXML_INTEGER
+MXML_OPAQUE
+MXML_REAL
+MXML_TEXT
+MXML_CUSTOM<04> Xmxml_value_u  element<02>Z integer<02>k opaque<02><> real<02><> text<02><> custom<02><> <04>mxml_element_s lnamem<>#num_attrsnk#attrsov#<04>chardouble<04>mxml_text_sswhitespacetk#stringu<>#0mxml_custom_sydatazX#destroy{<#<X0vmxml_attr_sfnameg<>#valueh<>#B<02>mxmlDelete<01>`/aUnode<01>eVi<01>kW mxmlNewCDATA'e0a<00>aUparent%ePdata& Wnode(eV<14>|mxmlNewCustomRe<00>a<00>aUparentOePdataPXPdestroyQ<PnodeSeR<11>mxmlNewElementte<00>abUparentrePnames WnodeueV-mxmlNewInteger<01>ebJbUparent<01>ePinteger<01>kPnode<01>eR<11>mxmlNewOpaque<01>eLb<00>bUparent<01>ePopaque<01> Wnode<01>eV<11>mxmlNewReal<01>e<00>b<00>bUparent<01>ePreal<01><01>[node<01>ePDmxmlNewTexte<00>b)cUparent<01>ePwhitespace<01>kPstring<01> WnodeeV<11>mxmlNewTextf-e,c<00>cUparent)ePwhitespace*kPformat+ Wnode.eVap/<02><04><17>mxmlRemoveY<01>c<00>cUnodeXeQ<mxmlNewXML<01>e<00>c<dUversion<01> <02>element<01><<03><>xI<00><19>}mxmlRelease<01>k<d~dUnode<01>eR<11>mxmlRetain<01>k<00>d<00>dUnode<01>eRmxml_new<01>e<00>d<00>dUparent<01>eWtype<01>rPnode<01>eVu_long long unsigned intu_int0unsigned intu_shortOshort unsigned intu_charsunsigned charulongushortOuint0uncharsblkcnt_t<1C>long long intblksize_tkfsblkcnt_t<1E>fsfilcnt_t<1F>off_t <20>ino_t!<21>cnt_t"kdev_t#C long intpid_t$C id_t%C uid_t'0gid_t(0mode_t)0umode_t*0nlink_t+kdaddr_t-kcaddr_t.<2E>addr_t0key_t1C ptrdiff_tvC size_t<04>ssize_t<04>C wchar_t<04>kwint_t0clock_t C time_t C suseconds_tC useconds_t<04>
+timespectv_secB
+#tv_nsecC #<04>
+itimerspecit_intervalu
+#it_valueu
+#<04> tm,!tm_sec"k#tm_min#k#tm_hour$k#tm_mday%k# tm_mon&k#tm_year'k#tm_wday(k#tm_yday)k#tm_isdst*k# tm_gmtoff+k#$tm_zone,<2C>#(__gnuc_va_listG<>va_list<06><> fpos_t6 / _IO_marker i_nextp/ #_sbufqk#_posrk#<04> k_IO_FILE<00>q_flagsvk#_IO_read_ptr{<7B>#_IO_read_end|<7C>#_IO_read_base}<7D># _IO_write_base~<7E>#_IO_write_ptr<>#_IO_write_end<08><>#_IO_buf_base<08><>#_IO_buf_end<08><># _IO_save_base<08><>#$_IO_backup_base<08><>#(_IO_save_end<08><>#,_markers<08>/ #0_chain<08>k#4_fileno<08>k#8_flags2<08>k#<_old_offset<08> #@_cur_column<08>O#H_vtable_offset<08>q#J_shortbuf<08><>#K_lock<08><>#L_offset<08> #P_codecvt<08><>#X_wide_data<08><>#\_mode<08>k#`_unused2<08><>#d5 signed char<18><00> _IO_codecvt<04>_IO_wide_data<04><18><00>3_IO_lock_tl_IO_FILE<08>5 FILE 5 
+ quot
+ k#rem
+
+k#div_t
+ <0B> G
+quot
+C #rem
+C #ldiv_t
+! {
+quot
+<13>#rem
+<14>#lldiv_t
+U <0B>__convert_long_double O __convert_long_double_i P<> __convert_long_double_d Q<><18>0long double <04>random_data fptr <19>#rptr <1A>#state <1B>#rand_type k# rand_deg k#rand_sep k#end_ptr <1F>#k<04>drand48_data "x #<23>#a $<24>#c %O# old_x &<26>#init 'k#<18>O_compare_function <0C>!0k006"#<23> 
+_ISblank
+_IScntrl
+_ISpunct
+_ISalnum$_ISupper$_ISlower$_ISalpha$_ISdigit$_ISxdigit$_ISspace $_ISprint@$_ISgraph<00>amxml_sax_event_eK
+MXML_SAX_CDATA
+MXML_SAX_COMMENT
+MXML_SAX_DATA
+MXML_SAX_DIRECTIVE
+MXML_SAX_ELEMENT_CLOSE
+MXML_SAX_ELEMENT_OPENmxml_sax_event_tR<>mxml_type_t]rmxml_custom_destroy_cb_t_<>0mxml_error_cb_tb<><04><0E> mxml_attr_tiBmxml_element_tpZmxml_text_tv<>mxml_custom_t|<7C>mxml_value_t<02><>mxml_node_t<02><><04>mxml_index_s<02>attr<02><>#num_nodes<02>k#alloc_nodes<02>k#cur_node<02>k# nodes<02><>#emxml_index_t<02>Smxml_custom_load_cb_t<02><>!ke mxml_custom_save_cb_t<02>4:!J<01>emxml_entity_cb_t<02>bh!xk mxml_load_cb_t<02><><04>!<21>yemxml_save_cb_t<02><><04>!<21> ekmxml_sax_cb_t<02><><04>eaXg<00>mxml-search.c/boot/home/Desktop/mxml-2.6GNU C 2.95.3-haiku-090629esf/6 mxml_node_s,<02>type<02> #next<02><>#prev<02><>#parent<02><># child<02><>#last_child<02><>#value<02><>#ref_count<02><>#$user_data<02><>#(<04>mxml_type_eUMXML_IGNORE<00><><FF><FF>MXML_ELEMENTMXML_INTEGERMXML_OPAQUEMXML_REALMXML_TEXTMXML_CUSTOM]<08>mxml_value_u  element<02><> integer<02><> opaque<02><> real<02><> text<02> custom<02><
+int  <0C>mxmlFindElement6<01>e<00>eU node0<>V top1<><02> name2<><02> attr3<><02> value4<>W descend5<><02>temp7<>P]<04><0F>
+char<02>mxml_element_s lnamem<>#num_attrsn<>#attrso<>#<04>
+double<mxml_text_sswhitespacet<>#stringu<>#tmxml_custom_sydataz<>#destroy{<7B>#<10><11>t<02>mxml_attr_sfnameg<>#valueh<>#<04> mxmlWalkNext<01><01><00>e+fU node<01><>P top<01><>Q descend<01><><02> dmxmlWalkPrev<01><01>,fsfU node<01><>P top<01><>Q descend<01><><02>u_long r
+long unsigned intu_int<0E>
+unsigned intu_short<0F>
+short unsigned intu_char<10>
+unsigned charulongrushort<16>uint<17>unchar<19>blkcnt_t-
+long long intblksize_t<1D>fsblkcnt_t-fsfilcnt_t-off_t -ino_t!-cnt_t"<22>dev_t#<23>
+long intpid_t$<24>id_t%<25>uid_t'<27>gid_t(<28>mode_t)<29>umode_t*<2A>nlink_t+<2B>daddr_t-<2D>caddr_t.<2E>addr_t0rkey_t1<>ptrdiff_tv<>size_t<04>rssize_t<04><>wchar_t<04><>wint_t<01>clock_t <0C>time_t <0A>suseconds_t<0E>useconds_trtimespectv_sec<18>#tv_nsec<19>#Kitimerspecit_interval<1D>#it_value<1E>#tm,!tm_sec"<22>#tm_min#<23>#tm_hour$<24>#tm_mday%<25># tm_mon&<26>#tm_year'<27>#tm_wday(<28>#tm_yday)<29>#tm_isdst*<2A># tm_gmtoff+<2B>#$tm_zone,<2C>#(__gnuc_va_listG<>va_list<06>fpos_t6s<02>_IO_marker i_nextp<>#_sbufq<>
+#_posr<>#P<02>
+_IO_FILE<00>q_flagsv<>#_IO_read_ptr{<7B>#_IO_read_end|<7C>#_IO_read_base}<7D># _IO_write_base~<7E>#_IO_write_ptr<>#_IO_write_end<08><>#_IO_buf_base<08><>#_IO_buf_end<08><># _IO_save_base<08><>#$_IO_backup_base<08><>#(_IO_save_end<08><>#,_markers<08><>#0_chain<08><>
+#4_fileno<08><>#8_flags2<08><>#<_old_offset<08>s#@_cur_column<08><>#H_vtable_offset<08><>
+#J_shortbuf<08><>
+#K_lock<08><>
+#L_offset<08>s#P_codecvt<08> #X_wide_data<08> #\_mode<08><>#`_unused2<08> #d<04>
+signed char<14>
+<00> _IO_codecvt<04>
+_IO_wide_data ( <00>3_IO_lock_tl_IO_FILE<08><>FILE <0A>x 
+ quot
+ <09>#rem
+
+<2B>#div_t
+ R <18> 
+quot
+<0E>#rem
+<0F>#ldiv_t
+<10> <18> 
+quot
+-#rem
+-#lldiv_t
+<15> K __convert_long_double O __convert_long_double_i PK __convert_long_double_d QW W <00>
+long double <02> random_data fptr <19> #rptr <1A> #state <1B> #rand_type <1C># rand_deg <1D>#rand_sep <1E>#end_ptr <1F> #<04>T drand48_data "x #T #a $T #c %<25># old_x &T #init '<27>#` <00>_compare_function <0C>y  <19> <01><11> <11> <04> 1 _ISblank_IScntrl_ISpunct_ISalnum_ISupper_ISlower_ISalpha_ISdigit_ISxdigit_ISspace _ISprint@_ISgraph<00><04>mxml_sax_event_eKMXML_SAX_CDATAMXML_SAX_COMMENTMXML_SAX_DATAMXML_SAX_DIRECTIVEMXML_SAX_ELEMENT_CLOSEMXML_SAX_ELEMENT_OPENmxml_sax_event_tR1mxml_type_t] mxml_custom_destroy_cb_t_tmxml_error_cb_tb-3?<11>mxml_attr_ti<>mxml_element_tp<>mxml_text_tvmxml_custom_t|<mxml_value_t<02><>mxml_node_t<02>])mxml_index_s<02>attr<02><>#num_nodes<02><>#alloc_nodes<02><>#cur_node<02><># nodes<02>)#<04>mxml_index_t<02><>mxml_custom_load_cb_t<02>`f{<01><11><11>mxml_custom_save_cb_t<02><><04><19><01><11>mxml_entity_cb_t<02><><04><19><01><11>mxml_load_cb_t<02><><04><01><11>mxml_save_cb_t<02>$9<01><11><11>mxml_sax_cb_t<02>NTj<11><11><11><00><00> mxml-set.c/boot/home/Desktop/mxml-2.6GNU C 2.95.3-haiku-090629<01>fi:<02>mxmlSetCustom3<01><00>f<00>fUnode0dVdata1jPdestroy2xPintdmxml_node_s,<02>type<02>~#next<02><>#prev<02><>#parent<02><># child<02><>#last_child<02><>#value<02><>#ref_count<02><>#$user_data<02>j#(<04> x
+jl <0B>mxml_type_eU MXML_IGNORE<00><><FF><FF> MXML_ELEMENT MXML_INTEGER MXML_OPAQUE MXML_REAL MXML_TEXT MXML_CUSTOM<04>dmxml_value_u element<02>dinteger<02><>opaque<02><>real<02><>text<02><>custom<02><05>mxml_element_s lnamem<>#num_attrsn<>#attrson#<04>chardoublemxml_text_sswhitespacet<>#stringu<>#:mxml_custom_sydatazj#destroy{x#nmxml_attr_sfnameg<>#valueh<>#:<02>mxmlSetCDATAT<01><00>fRgUnodeRdVdataS<>W<04><10>mxmlSetElements<01>Tg<00>gUnodeqdVnamer<>WImxmlSetInteger<01><01><00>g<00>gUnode<01>dRinteger<01><>P<02>mxmlSetOpaque<01><01><00>g.hUnode<01>dVopaque<01><>W<02>mxmlSetReal<01><01>0hRhUnode<01>dPrealɽ[#mxmlSetText<01><01>Th<00>hUnode<01>dVwhitespace<01><>Pstring<01><>W<11>mxmlSetTextf<01><00>hiUnodedVwhitespace<01>Pformat<01>Wap<01><04>u_long <0A>long unsigned intu_int<0E>unsigned intu_short<0F>short unsigned intu_charunsigned charulong<15>ushort<16>uint<17>uncharblkcnt_tYlong long intblksize_t<1D>fsblkcnt_tYfsfilcnt_tYoff_t Yino_t!Ycnt_t"<22>dev_t#<23>long intpid_t$<24>id_t%<25>uid_t'<27>gid_t(<28>mode_t)<29>umode_t*<2A>nlink_t+<2B>daddr_t-<2D>caddr_t.<2E>addr_t0<>key_t1<>ptrdiff_tv<>size_t<04><>ssize_t<04><>wchar_t<04><>wint_t<01>clock_t <0C>time_t <0A>suseconds_t<0E>useconds_t<0F>:timespectv_sec<18>#tv_nsec<19>#witimerspecit_interval#it_value#I tm,!tm_sec"<22>#tm_min#<23>#tm_hour$<24>#tm_mday%<25># tm_mon&<26>#tm_year'<27>#tm_wday(<28>#tm_yday)<29>#tm_isdst*<2A># tm_gmtoff+<2B>#$tm_zone,<2C>#(__gnuc_va_listG<>va_list<06>I fpos_t6<><05> _IO_marker i_nextp<> #_sbufq<> #_posr<>#| <05> _IO_FILE<00>q_flagsv<>#_IO_read_ptr{<7B>#_IO_read_end|<7C>#_IO_read_base}<7D># _IO_write_base~<7E>#_IO_write_ptr<>#_IO_write_end<08><>#_IO_buf_base<08><>#_IO_buf_end<08><># _IO_save_base<08><>#$_IO_backup_base<08><>#(_IO_save_end<08><>#,_markers<08><> #0_chain<08><> #4_fileno<08><>#8_flags2<08><>#<_old_offset<08><>#@_cur_column<08><>#H_vtable_offset<08> #J_shortbuf<08> #K_lock<08> #L_offset<08><>#P_codecvt<08>, #X_wide_data<08>B #\_mode<08><>#`_unused2<08>H #d<04> signed char <00>_IO_codecvt _IO_wide_data2 T <00>3_IO_lock_tl_IO_FILE<08><> FILE <0A> <1B> 
+ quot
+ <09>#rem
+
+<2B>#div_t
+ ~ <1B> 
+quot
+<0E>#rem
+<0F>#ldiv_t
+<10>  
+quot
+Y#rem
+Y#lldiv_t
+<15> w __convert_long_double O__convert_long_double_i Pw __convert_long_double_d Q<> <17> <00>long double !random_data fptr !#rptr !#state !#rand_type <1C># rand_deg <1D>#rand_sep <1E>#end_ptr !#<04><05>drand48_data "x #<23>#a $<24>#c %<25># old_x &<26>#init '<27>#<17><00>_compare_function <0C><><04><1C><01>
+<2B>
+<2B><04>]  _ISblank _IScntrl _ISpunct _ISalnum_ISupper_ISlower_ISalpha_ISdigit_ISxdigit_ISspace _ISprint@_ISgraph<00> <0B>mxml_sax_event_eK MXML_SAX_CDATA MXML_SAX_COMMENT MXML_SAX_DATA MXML_SAX_DIRECTIVE MXML_SAX_ELEMENT_CLOSE MXML_SAX_ELEMENT_OPENmxml_sax_event_tR]mxml_type_t]~mxml_custom_destroy_cb_t_<lmxml_error_cb_tbY_ k
+<2B>mxml_attr_ti:mxml_element_tpdmxml_text_tv<>mxml_custom_t|mxml_value_t<02><>mxml_node_t<02><>Umxml_index_s<02>attr<02><>#num_nodes<02><>#alloc_nodes<02><>#cur_node<02><># nodes<02>U#dmxml_index_t<02><>mxml_custom_load_cb_t<02><><04><1C><01>
+d
+<2B>mxml_custom_save_cb_t<02><><04><1C><01>
+dmxml_entity_cb_t<02><><04><01>
+<2B>mxml_load_cb_t<02>$4 
+dmxml_save_cb_t<02>JPe<01>
+d
+<2B>mxml_sax_cb_t<02>z<04> <09>
+d
+<2B>
+j s mxml-private.c/boot/home/Desktop/mxml-2.6GNU C 2.95.3-haiku-090629 i<00>j<00>><02>mxml_error) i<00>iUformat'<27>Vap*<2A>s+<2B><03><>xglobal,yW<04><08> char<04>
+<2B><00> <0B> y_mxml_global_s<00> error_cb!<21># num_entity_cbs"<22># entity_cbs#<23># wrap$<24>#<23> custom_load_cb%<25>#<23> custom_save_cb&<26>#<23><04><0E><0F> int
+<2B><00>c<11><01><0F><04><11><01><0F><0F><04><12>mxml_node_s,<03> type<03><># next<03># prev<03># parent<03># child<03># last_child<03># value<03>%# ref_count<03><>#$ user_data<03><>#(<04><11><01><0F><04><04>mxml_type_eUMXML_IGNORE<00><><FF><FF>MXML_ELEMENTMXML_INTEGERMXML_OPAQUEMXML_REALMXML_TEXTMXML_CUSTOM<04><16>mxml_value_u element<03><>integer<03><>opaque<03><>real<03><>text<03><>custom<03><12>mxml_element_s l namem<># num_attrsn<># attrso<># doublemxml_text_ss whitespacet<># stringu<>#Wmxml_custom_sy dataz<># destroy{c#c<0F>W<12>mxml_attr_sf nameg<># valueh<>#i<19>mxml_ignore_cbR<01><00>i<00>iUnodeQ<><02>mxml_integer_cb_<01><00>i<00>iUnode^<5E><02>Fmxml_opaque_cbl<01><00>i<00>iUnodek<><02>zmxml_real_cby<01><00>i<00>iUnodex<><02><19>_mxml_global<01>y<00>iPjUglobal<01>yV_mxml_init<01>Pj<00>jU<1B>_mxml_destructor<01><01>j<00>jUg<01><>Pu_long  long unsigned intu_int' unsigned intu_shortF short unsigned intu_charj unsigned charulongushortFuint'uncharjblkcnt_t<1C> long long intblksize_t<1D>fsblkcnt_t<1E>fsfilcnt_t<1F>off_t <20>ino_t!<21>cnt_t"<22>dev_t#: long intpid_t$:id_t%:uid_t''gid_t('mode_t)'umode_t*'nlink_t+<2B>daddr_t-<2D>caddr_t.<2E>addr_t0key_t1:ptrdiff_tv:size_t<05>ssize_t<05>:wchar_t<05><>wint_t'clock_t :time_t :suseconds_t:useconds_t<12>timespec tv_sec9# tv_nsec:#<12>itimerspec it_intervall# it_valuel#<12> tm,! tm_sec"<22># tm_min#<23># tm_hour$<24># tm_mday%<25># tm_mon&<26># tm_year'<27># tm_wday(<28># tm_yday)<29># tm_isdst*<2A># tm_gmtoff+<2B>#$ tm_zone,<2C>#(__gnuc_va_listG<>va_list<07><> fpos_t6&
+_IO_marker i _next p&
+# _sbuf qb # _pos r<>#<04> b _IO_FILE<00> q _flags v<># _IO_read_ptr {<7B># _IO_read_end |<7C># _IO_read_base }<7D># _IO_write_base ~<7E># _IO_write_ptr <># _IO_write_end <09><># _IO_buf_base <09><># _IO_buf_end <09><># _IO_save_base <09><>#$ _IO_backup_base <09><>#( _IO_save_end <09><>#, _markers <09>&
+#0 _chain <09>b #4 _fileno <09><>#8 _flags2 <09><>#< _old_offset <09>#@ _cur_column <09>F#H _vtable_offset <09>h #J _shortbuf <09>w #K _lock <09><> #L _offset <09>#P _codecvt <09><> #X _wide_data <09><> #\ _mode <09><>#` _unused2 <09><> #d,
+ signed char
+<2B> <00>_IO_codecvt<04> _IO_wide_data<04>
+<2B> <00>3_IO_lock_t l_IO_FILE <09>,
+FILE
+ ,
+ stderr<<3C> <04> !!  quot <09># rem
+<2B>#div_t <0B> !T   quot :# rem :#ldiv_t . !<21>   quot <13># rem <14>#lldiv_t b <16> __convert_long_double O__convert_long_double_i P<> __convert_long_double_d Q
+' long double <12>random_data  fptr <19># rptr <1A># state <1B># rand_type <1C># rand_deg <1D># rand_sep <1E># end_ptr <1F>#<04><12>drand48_data " x #<23># a $<24># c %F# old_x &<26># init '<27>#
+ F_compare_function <0A>"(=<01>==C"#<23>_ISblank_IScntrl_ISpunct_ISalnum$_ISupper$_ISlower$_ISalpha$_ISdigit$_ISxdigit$_ISspace $_ISprint@$_ISgraph<00>nmxml_sax_event_eKMXML_SAX_CDATAMXML_SAX_COMMENTMXML_SAX_DATAMXML_SAX_DIRECTIVEMXML_SAX_ELEMENT_CLOSEMXML_SAX_ELEMENT_OPENmxml_sax_event_tR<>mxml_type_t]<5D>mxml_custom_destroy_cb_t_<>Wmxml_error_cb_tb<>mxml_attr_tiimxml_element_tp<>mxml_text_tv<>mxml_custom_t|mxml_value_t<03>%mxml_node_t<03><><12>mxml_index_s<03> attr<03><># num_nodes<03><># alloc_nodes<03><># cur_node<03><># nodes<03><>#<04>mxml_index_t<03>Nmxml_custom_load_cb_t<03><><04>mxml_custom_save_cb_t<03><04>mxml_entity_cb_t<03><>mxml_load_cb_t<03>NTd<01><0F>mxml_save_cb_t<03>z<04><11><01><0F><0F>mxml_sax_cb_t<03><><04><0E><0F>n<0F>_mxml_global_t'<27>int8_t h uint8_t jint16_t short intuint16_tFint32_t<12>uint32_t'int64_t<15>uint64_tc long long unsigned intint_least8_t<19>uint_least8_t<1A>int_least16_t<1C>uint_least16_tint_least32_t%uint_least32_t 4int_least64_t"Duint_least64_t#Sint_fast8_t&%uint_fast8_t'4int_fast16_t)%uint_fast16_t*4int_fast32_t,%uint_fast32_t-4int_fast64_t/Duint_fast64_t0Sintptr_t3%uintptr_t44intmax_t7<>uintmax_t8cu_int8_t<0F><>u_int16_t<0F>u_int32_t<0F>4u_int64_t<0F>S_pthread_threadpthread_tqN_pthread_attrpthread_attr_t<0F>w_pthread_mutex flags4# count %# sem!%# owner"%# owner_count#%#pthread_mutex_t<10>_pthread_mutexattrpthread_mutexattr_tV&<12>_pthread_cond flags'4# sem(%# mutex)<29># waiter_count*%# event_counter+%#pthread_cond_t\_pthread_condattrpthread_condattr_t<04>pthread_key_t<14>\_pthread_once state/%#pthread_once_t5<12>_pthread_rwlock  flags34# owner4%#%<25>#&<26>@shared8<>local?<3F>!<21>8 sem7%#!_? lock_sem:%# lock_count;%# reader_count<%# writer_count=%# waiters>_#
+k<00>pthread_rwlock_tr_pthread_rwlockattrpthread_rwlockattr_t<17><04>;pthread_mutex_typeCPTHREAD_MUTEX_DEFAULTPTHREAD_MUTEX_NORMALPTHREAD_MUTEX_ERRORCHECKPTHREAD_MUTEX_RECURSIVE<13>pthread_process_sharedJPTHREAD_PROCESS_PRIVATEPTHREAD_PROCESS_SHARED<12>__pthread_cleanup_handler m previousn<># functiono<># argumentp<>#<04>_mxml_key<01> <03><>_mxml_key_once<01>\<03><> J mxml-string.c/boot/home/Desktop/mxml-2.6GNU C 2.95.3-haiku-090629<01>jWk~B<02>_mxml_strdupfW<01><00>j<00>jUformatU<>RapX<>sY<>P<04>char<04> <09><04>
+B_mxml_vstrdupf<01><01><00>jWkU format<01><01><02> ap<01><01><02> bytes<01>BP buffer<01><01>V temp<01>I<03><>~int U<00><0E>u_long clong unsigned intu_int<0E>unsigned intu_short<0F>short unsigned intu_char<10>unsigned charulongcushort<16>uint<17>unchar<19>blkcnt_tlong long intblksize_tBfsblkcnt_tfsfilcnt_toff_t ino_t!cnt_t"Bdev_t#<23>long intpid_t$<24>id_t%<25>uid_t'<27>gid_t(<28>mode_t)<29>umode_t*<2A>nlink_t+Bdaddr_t-Bcaddr_t.<2E>addr_t0ckey_t1<>ptrdiff_tv<>size_t<03>cssize_t<03><>wchar_t<03>Bwint_t<01>clock_t <0C>time_t <0A>suseconds_t<0E>useconds_tc<11>timespectv_sec<18>#tv_nsec<19>#<itimerspecit_interval<1D>#it_value<1E>#tm,!tm_sec"B#tm_min#B#tm_hour$B#tm_mday%B# tm_mon&B#tm_year'B#tm_wday(B#tm_yday)B#tm_isdst*B# tm_gmtoff+B#$tm_zone,<2C>#(__gnuc_va_listG<>va_list<05>fpos_t6d<11>_IO_marker i_nextp<>#_sbufq<>#_posrB#A<11>_IO_FILE<00>q_flagsvB#_IO_read_ptr{<7B>#_IO_read_end|<7C>#_IO_read_base}<7D># _IO_write_base~<7E>#_IO_write_ptr<>#_IO_write_end<07><>#_IO_buf_base<07><>#_IO_buf_end<07><># _IO_save_base<07><>#$_IO_backup_base<07><>#(_IO_save_end<07><>#,_markers<07><>#0_chain<07><>#4_fileno<07>B#8_flags2<07>B#<_old_offset<07>d#@_cur_column<07><>#H_vtable_offset<07><>#J_shortbuf<07><>#K_lock<07><>#L_offset<07>d#P_codecvt<07><>#X_wide_data<07>#\_mode<07>B#`_unused2<07> #d<04>signed char <0A><00>_IO_codecvt<04>_IO_wide_data<04> <00>3_IO_lock_tl_IO_FILE<07><>FILE <0A>i quot B#rem
+B#div_t C<16> quot <0E>#rem <0F>#ldiv_t v<16> quot #rem #lldiv_t <15>< __convert_long_double
+O__convert_long_double_i
+P< __convert_long_double_d
+QH H <00>long double <11> random_data fptr <19> #rptr <1A> #state <1B> #rand_type B# rand_deg B#rand_sep B#end_ptr <1F> #BE
+drand48_data "x #E
+#a $E
+#c %<25># old_x &E
+#init 'B# Q
+<00>_compare_function <0B>j
+p
+<19>
+B<1A>
+<1A>
+<04>
+"  _ISblank_IScntrl_ISpunct_ISalnum_ISupper_ISlower_ISalpha_ISdigit_ISxdigit_ISspace _ISprint@_ISgraph<00>% .? : ; ' @
+: ; I
+4: ; I
+ : ;  : ; I8
+ I&I $ >
+ : ; ( (  : ;  : ; I ' I.? : ; ' I@
+4: ; I.: ;' I@
+: ;I
+4: ;I
+: ; I: ;II!/ < : ;  : ; ' I &! : ; "(% .? : ; ' I@
+: ; I
+4: ; I
+$ > ' II I &I
+ : ; : ; I8
+ ' I!/  : ;  : ; ((  : ;  : ; I .? : ; ' @
+ : ; !/: ; I: ;I< : ; & : ; (% .: ; ' I@
+: ; I
+$ >  : ;  : ; I8
+ : ; ( (
+ I  : ; : ; I  .? : ; ' I@
+4: ; I
+' II : ; I!/' !/ < &I4: ;I
+4: ;I.? : ;' I@
+: ;I
+.? : ;' @
+.: ;' I@
+ 
+: ;!: ; I": ;I#: ; $4: ; I? < % : ; &&' : ; ((% .? : ; ' @
+: ; I
+ : ;  : ; I8
+ I$ >  : ; (
+(  : ; : ; I  ' I.? : ; ' I@
+4: ; I
+&I.? : ;' I@
+: ;I
+4: ;I
+.: ;' I@
+.: ;' @
+: ; I: ;II!/ < : ;  : ; ' I &! : ; "(% .? : ; ' @
+: ; I
+ : ;  : ; I8
+ I$ >  : ; (
+(  : ; : ; I  ' I4: ; I
+.? : ;' I@
+: ;I
+4: ;I
+&I4: ;I.? : ;' @
+I!/.: ;' I@
+: ; I: ;I!/ < : ;  : ; !' I"&# : ; $(%  : ;  : ; I8
+ : ; ((  I : ; : ; I
+$ >  .? : ; ' I@
+ : ; I
+4: ; I
+&I' I: ; I: ;II!/ < : ;  : ; ' I& : ; (% .? : ; ' I@
+: ; I
+$ >  : ;  : ; I8
+ I '
+I  : ; ( (  : ;  : ; I&I.? : ;' I@
+: ;I
+4: ;I: ; I: ;II!/ < : ;  : ; ' I& : ; (% .? : ; ' @
+: ; I
+4: ; I4: ; I
+ I&I $ >
+I !/  : ; : ; I8
+' I!/ ' I : ;  : ; ((  : ;  : ; I .? : ; ' I@
+.: ; ' @
+.: ; ' @
+: ; I: ;I< : ; 4: ; I? < ! : ; "&# : ; $(% I8
+& : ; % .? : ; ' I@
+: ; I
+4: ; I4: ; I
+ I$ > &I
+.? : ;' I@
+ : ;I
+ 4: ;I
+ I!/ : ; I: ;I : ;  : ; I8
+ < : ;  : ;  : ;  : ; I' II& : ; ( (<00><01><>
+mxml-attr.cmxml.h/boot/develop/headers/posix/sys/types.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stddef.h/boot/develop/headers/posix/time.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stdarg.h/boot/develop/headers/posix/stdio.h/boot/develop/headers/posix/libio.h/boot/develop/headers/posix/stdio_pre.h/boot/develop/headers/posix/div_t.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/float.h/boot/develop/headers/posix/stdlib.h/boot/develop/headers/posix/ctype.h<02> U<02> <02> <02> <02> <02> <02> <02> <02> <02> <02> !l! !,!!,!";!@!'E!sK!P!f!j!n!,z!|!$<02>!!<02>!<02>!<02>!<02>!<02>!<02>!<02>!'"#"")"0"P"e"n"x"(<02>"<02>"<02>"<02>"<02>"<02>"<02>"t<02>"<02>"(<02>"<02>" ####"#4#7#:#=#@#D# ^#m#m#<01> <00><01><>
+mxml-entity.cmxml-private.hmxml.h/boot/develop/headers/posix/sys/types.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stddef.h/boot/develop/headers/posix/time.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stdarg.h/boot/develop/headers/posix/stdio.h/boot/develop/headers/posix/libio.h/boot/develop/headers/posix/stdio_pre.h/boot/develop/headers/posix/div_t.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/float.h/boot/develop/headers/posix/stdlib.h/boot/develop/headers/posix/ctype.hp#A<02>#<02>#<02>#<02># <02>#<02>#<02>#<02># t$<02>$<02>$<02>$<02>$<02>$%<02>$<02>$<02>$<02>$<02>$<02>$  %#%.%4%8%N%P%s]%#h%<03><02>%<02>%<02>%<02>%<02>%<02>%<02>%<02>%<02>%&"&o"&#3&3&<01> ><00><01><>
+mxml-file.cmxml.h/boot/develop/headers/posix/libio.hmxml-private.h/boot/develop/headers/posix/sys/types.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stddef.h/boot/develop/headers/posix/time.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stdarg.h/boot/develop/headers/posix/stdio.h/boot/develop/headers/posix/stdio_pre.h/boot/develop/headers/posix/stdio_post.h/boot/develop/headers/posix/div_t.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/float.h/boot/develop/headers/posix/stdlib.h/boot/develop/headers/posix/ctype.h@&<00>E&H&h&@<02>&<02>&<02>&<02>&<02>&<02>&*<02>&'+'@'7q'x''<02>'<02>'<02>'<02>' <02>'<02>'%<02>'<02>'<02>'( (((*(<(C(Y(\(%w(|(<02>(<02>(<02>(<02>(<02>(<02>(*) )))7)@)D)O)W)d)g)w)x)3<02>)<02>)<02>)<02>)<02>)<02>)4*$*5D*d*'*<02>*<02>*<02>*<02>*<02>*<02>*<02>*<02>*!<02>*<02>*<02>*<02>* <02>*++#+.+K+Y+n+x+<02>+<02>+<02>+<02>+<02>+<02>+<02>+<02>+<02>+<02>+<02>+<02>+<02>+<02>+<02>+ , ,$,$,/,C,O,s,y,<02>,<02>,<02>,<02>,<02>,<02>,<02>,<02>,<02>,<02>,--#-/-5-@-N-Y-m-}-<02>-<02>-<02>-<02>-<02>-<02>-<02>-<02>-<02>-.../.?.Q.Y.a.k.p.|.<02>.<02>.<02>.<02>.<02>.<02>.<02>.<02>.<02>./ /(/3/G/W/i/q/}/<02>/<02>/ <02>/<02>/<02>/<02>/<02>/<02>/<02>/<02>/<02>/<02>/<02>/ 0000 0-00030=0=0B0M0]0j0o0r0<02>0<02>0<02>0<02>0<02>0<02>0<02>0<02>0<02>0<02>0<02>0<02>0<02>0<02>0<02>0 1"1"1.101G1O1\1c1n1y1|1<02>1<02>1<02>1<02>1<02>1<02>1<02>1<02>1t<02>1<02>1<02>1 222%2%202I2P2V2b2d2|2|2<02>2<02>2<02>2<02>2<02>23
+343@3F3P3X3<02>3<02>3<02>3<02>3<02>3<02>3<02>3444(4m4x4<02>4<02>4<02>4<02>4<02>4<02>4<02>45L5W5<02>5<02>5<02>5<02>56
+66 C6[6l6<02>6<02>6<02>6<02>677"7/7<02>7<02>7<02>7<02>7<02>7<02>7<02>7<02>7<02>78(+80888E8g8l8<02>8 <02>8<02>8<02>8<02>8<02>8<02>8<02>8<02>8<02>8999>9R9u9<02>9<02>9<02>9.<02>9%<02>9<02>9<02>9<02>9<02>9<02>9<02>9<02>9<02>9<02>9<02>9:::":_:b:<02>:<02>:<02>:<02>:<02>:<02>:<02>: ;;;.;E;k;t;v;y;<02>;<02>;<02>;<02>;<02>;<02>;<02>;<02>;<02>;<02>;<#<)<8<H<J<T<W<`<y<<02><<02><<02><<02><<02><<02><<02><<02><<02><<02><<02><<02><= ==6=V=X=x=<02>=<02>=l>>)">?>A>a>|><02>><02>><02>>#<02>><02>><02>><02>><02>> ? ?"?'?A?C?c?~?<02>?<02>?<02>?#<02>?<02>?<02>?<02>?<02>?@@@)@,@1@;@@@`@{@<02>@<02>@<02>@"<02>@<02>@<02>@<02>@<02>@<02>@AA$AAA$AHAhA<02>A<02>A"<02>A<02>A<02>A<02>A<02>A<02>A<02>A<02>A<02>A<02>AB
+B BB B(BHBhBpB<02>B<02>B<02>B<02>B<02>B<02>B<02>B<02>B<02>B<02>B<02>BC"C'C:C[C`CfC<02>C<02>C<02>C<02>C<02>C<02>C<02>C<02>C<02>C<02>C<02>C<02>C<02>C<02>C
+DDD D&DJDZD`DD<02>D<02>D<02>D<02>D<02>D<02>D<02>D<02>DE*E0E4E@EHE<03>|QESEL\E`ELiEpE^yE<02>E<00><02>E<02>E<02>E<03>}<02>E<02>E<03><02>E<02>E<02>E<02>E/FF F'F;FGFVF`FgFpF<02>F<02>F<02>F<02>F<02>F<02>F<02>F<02>F<02>F<02>F<02>F<02>F<02>F<02>FG7G?GYG^G`GeG<02>G<02>G<02>Gu<02>G<02>G <02>GHH:HCHqHzH<02>H<02>H<02>H<02>H<02>H<02>H<02>H<02>H<02>H
+<02>H<02>H IIIII8IUIoI
+<02>I<02>I<02>I<02>I<02>I<02>I<02>I<02>I<02>I<02>I JJJJJ6JBJNJRJ<03>fJhJ<03>~J<02>J<00><02>J<02>J<02>J<02>J<02>J<02>J<02>J<02>JKK8KHKPKXKbKkKmKrKzK<02>K<02>K<02>K<02>K<02>K<02>K<02>K<02>K<02>K<02>K<02>K<02>KL<LALILSLXLdLpL<02>L<02>L<02>L<02>L<02>LMM%MM7MHMHMSMaMfMwM<02>M<02>M<02>M<02>M<02>M<02>M<02>M<02>M<02>M<02>M<02>M<02>M<02>M<02>M<02>MNNN$N$N*N1N6N8N>N@N XNfN}N<02>N<02>N<02>N<02>N<02>N<02>N<02>N<02>N<02>N<02>NOOO%Oi%O%O%O)'O0OGOHOMOYO\O"wO<02>O<02>O<02>O<02>O7P7PBP]PcPeP<02>P<02>P<02>P<02>P<02>P<02>PGQTQ<02>Q<02>Q<02>Q<02>Q<02>Q<02>Q<02>QRR3RLRqR<02>R<02>R[<02>R<02>R=<02>R<02>R<02>R<02>R<02>R<02>RS2SOSkS<02>S<02>S<02>S<02>S<02>STTTT T0TITITLTMTPTiT<02>T<02>T<02>T<02>T<02>T<02>T<02>T<02>T<02>T<02>T<02>T<02>TUUU7USU[U`U<02>U<02>U<02>U<02>U<02>U<02>U<02>U<02>U<02>U<02>UVVNVSV`VqV<02>V<02>V<02>V<02>V<02>V<02>VW W1W1WGWcWuW<02>WXXXX X)X1X@X@X XX`XuX<02>X<02>X<02>X<02>X<02>X<02>X<02>X<02>X<02>X<02>X<02>X<02>X<02>X"YY"Y9Y@YFYPYTYWYcYeYfYgYlYxYxY<01> ><00><01><>
+mxml-index.cmxml.h/boot/develop/headers/posix/sys/types.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stddef.h/boot/develop/headers/posix/time.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stdarg.h/boot/develop/headers/posix/stdio.h/boot/develop/headers/posix/libio.h/boot/develop/headers/posix/stdio_pre.h/boot/develop/headers/posix/div_t.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/float.h/boot/develop/headers/posix/stdlib.h/boot/develop/headers/posix/ctype.h<02>YK<02>Y<02>Y<02>Y<02>Y<02>Y<02>Y<02>Y<02>Y<02>Y<02>Y<02>Y<02>YZ'Z$/Z#;ZPZ[Z"fZmZqZvZ<02>Z<02>Z<02>Z<02>Z<02>Z<02>Z<02>Z!<02>Z<02>Z<02>Z<02>Z<02>Z<02>Z[[. [=[P[dV[`[5f[r[t[4<02>[<02>[<02>[<02>[<02>[<02>[<02>[<02>[\'*\6\@\jT\V\^\b\q\<02>\<02>\"<02>\<02>\<02>\<02>\<02>\9<02>\<02>\9<02>\<02>\!<02>\<02>\<02>\<02>\] ]"']A]G]q]}]<02>] <02>]<02>]<02>]<02>]<02>]<02>]<02>],^^ ^ ^^^^ ^!^D^F^G^j^n^w^}^<02>^f<02>^7<02>^<02>^<02>^<02>^<02>^<02>^<02>^<01> _<01><>
+mxml-node.cmxml.h/boot/develop/headers/posix/sys/types.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stddef.h/boot/develop/headers/posix/time.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stdarg.h/boot/develop/headers/posix/stdio.h/boot/develop/headers/posix/libio.h/boot/develop/headers/posix/stdio_pre.h/boot/develop/headers/posix/div_t.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/float.h/boot/develop/headers/posix/stdlib.h/boot/develop/headers/posix/ctype.h_W_+_&1_:_=_P_c_i_p_u_x_{_<02>_<02>_<02>_<02>_<02>_<02>_<02>_<02>_<02>_<02>_<02>_<02>_<02>_<02>_<02>_<02>_<02>_<02>_<02>_<02>_<02>_<02>_<02>_<02>_#`  ` (`1`3`H`x``<02>`<02>`<02>`<02>`<02>`<02>`<02>`<02>`<02>`<02>`<02>`<02>`<02>`<02>`aaaa%a0a%Ha!LaPagaza<02>a<02>a'<02>a!<02>a<02>a<02>a<02>a<02>a"<02>a!<02>a<02>a<02>abbb"*b ;bAbJbLb#db!hbpb<02>b<02>b<02>b<02>b"<02>b <02>b<02>b<02>b<02>b%<02>b!<02>b<02>b ccc)c,c&Dc"HcPcgcjcmcpc}c<02>c<02>c <02>c<02>c(<02>c<02>c<02>c<02>c<02>c<02>c<02>c<02>c<02>c"<02>c"d%d<d<d"RdVdedndrd<02>d <02>d<02>d<02>d<02>d!<02>d <02>d<02>d<02>d<02>d<02>d<02>d<02>d<02>d<01> <00><00><01><>
+mxml-search.cmxml.h/boot/develop/headers/posix/sys/types.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stddef.h/boot/develop/headers/posix/time.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stdarg.h/boot/develop/headers/posix/stdio.h/boot/develop/headers/posix/libio.h/boot/develop/headers/posix/stdio_pre.h/boot/develop/headers/posix/div_t.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/float.h/boot/develop/headers/posix/stdlib.h/boot/develop/headers/posix/ctype.heIe;e;eNeUe<02>e<02>e<02>e<02>e<02>e<02>e<02>e<02>e<02>e<02>e<02>e#<02>e<02>e<02>e<02>e<02>ef fff f%f,f$5f=fDfQfWf`fbfffmfofsf<01> ^~<01><>
+mxml-set.cmxml.h/boot/develop/headers/posix/sys/types.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stddef.h/boot/develop/headers/posix/time.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stdarg.h/boot/develop/headers/posix/stdio.h/boot/develop/headers/posix/libio.h/boot/develop/headers/posix/stdio_pre.h/boot/develop/headers/posix/div_t.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/float.h/boot/develop/headers/posix/stdlib.h/boot/develop/headers/posix/ctype.h<02>fF<02>f<02>f<02>f<02>f<02>f<02>f<02>f<02>f#<02>fg g'g3gFgTg!og|g<02>g<02>g<02>g<02>g<02>g!<02>g<02>g<02>g<02>g<02>g!<02>g<02>gh
+hh"h0h!6h?hFhLhTh"oh|h<02>h<02>h<02>h<02>h<02>h<02>h#<02>h<02>h<02>h<02>h<02>h<02>h<02>h<02>h iii<01> <00><00><01><>
+mxml-private.cmxml-private.hmxml.h/boot/develop/headers/posix/sys/types.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stddef.h/boot/develop/headers/posix/time.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stdarg.h/boot/develop/headers/posix/stdio.h/boot/develop/headers/posix/libio.h/boot/develop/headers/posix/stdio_pre.h/boot/develop/headers/posix/div_t.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/float.h/boot/develop/headers/posix/stdlib.h/boot/develop/headers/posix/ctype.h/boot/develop/headers/posix/stdint.h/boot/develop/headers/posix/pthread.h i<;iBiFiIi\idipi<02>i<02>i <02>i!<02>i!<02>i!<02>i,<02>i
+jj+j1j8j;jEjPjPj<02>j<02>j<02>j<01> <00>w<01><>
+mxml-string.c/boot/develop/headers/posix/sys/types.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stddef.h/boot/develop/headers/posix/time.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/stdarg.h/boot/develop/headers/posix/stdio.h/boot/develop/headers/posix/libio.h/boot/develop/headers/posix/stdio_pre.h/boot/develop/headers/posix/div_t.h/boot/develop/tools/gnupro/lib/gcc-lib/i586-pc-haiku/2.95.3-haiku-090629/include/float.h/boot/develop/headers/posix/stdlib.h/boot/develop/headers/posix/ctype.h<02>jj<02>j<02>j<02>j<02>j<02>j<03> kk"k9kHkWkWk<01> .symtab.strtab.shstrtab.hash.dynsym.dynstr.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.dynamic.got.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line<00><00>T! <00><00> 
+)  r1 || : <00><00><00>C||><00><00><00>I<00><00> MO<00>k<00>kU<00>k<00>kd ]D<>Dz g\<5C>\<5C>nd<>d<>ul<>l<><00>~$<24>$<24><00><00><00><><00><>8<00><00><><00><><00><00><><00><00>x<> <00><00><><00><00><>S<><00><00>O<00><00><00>^<00>E><3E><00>T<>p _ ĵ <00><00> |<00>|<00><00><00>k <00>k
+D<> \<5C> d<> l<>$<24><00><><00><><00><>L<00><>Pd<> ^ėj<00><00>D<> <00><00><00><00><><00><00>L<00>ȗ<00>\<5C> <00>`k<00>`<60> <00><00>k<00><00><><00>h<> X<> <00><>d<00><>t<00><><F1>x"<00><00>D<> <00><00><><F1>З<00> <0C> <00><00><><F1>@&%<00> ,"<00><00>9O <00>d2Q<00><00>J| 01I\O<00>*<00>1n8<00>7WG$NX<00>*%f|1xs8|<00>؟<00><00>E<00><00>@N<00><00>X<00><00>@X<00><00>ԋ <00><00><><F1><00>]c<00><00>]<00> ]q<00><<3C> <00><> <00>dX<00>p<> <00><><F1>|<7C> #<00><><F1><00><> .<00><>=<00><>G<00><>VPj0a<00>j&<00><00> r<00><><F1><00> <00>l<><02><><F1>$<24><02><><F1>G<00><00>c\<00><00>d <00>_<00>U<00><00>)B<00><00>(<00><00>k<00><00>g"'/28b6G<U,c]bl<00>i {<00>aO<00>0 C<00>h<00><00>j{<00><00>\$<00><00><00><00><00>x)f<00>dC<00>h%<00><00><00>$N|<00><00>i $\(<00>1*9<00>@<00>#<00>R,YJ_<00>!<00>s.{<00><00>"<00><00>eW<00>d*3<00><00><00>LbS<00><00>&<<00><00>j*<00>J; <00>*$!^)̗@h&`K,fGX<00>fRf`m<dBy`'<00><00> <00><00><00><><00><><F1>p#W<00><00>i<00><00><00>f~<00><00>gZ<00><00>i <00><00>C<00>!f<00>b2e<00>-5TgZD<00>a<R}W@'<00>k$*@})<00> iv<00>'9<00><00>k <00>0h"<00><00>Y)<00>.<00><00>*(<00>t[r<00><00><00>Th` Zr<00>cT"<00>i 2<00>bU><00><><00><>E<10><00><>J<00>YTZ|!nm<00>hdz<00>C<00><00>$w<00><00>'<00><00><00>"<00>ȗ<00>0aV<00>c<00><00>/home/michaelvoliveira/develop/haiku/trunk/src/system/glue/arch/x86/crti.Sp.3__DTOR_LIST__completed.4__do_global_dtors_aux__EH_FRAME_BEGIN__fini_dummyobject.11frame_dummyinit_dummyforce_to_data__CTOR_LIST____do_global_ctors_aux__CTOR_END____DTOR_END____FRAME_END__/home/michaelvoliveira/develop/haiku/trunk/src/system/glue/arch/x86/crtn.Sinit_term_dyn.cmxml-attr.cmxml_set_attr__FRAME_BEGIN__mxml-entity.centities.15mxml-file.cmxml_isspacemxml_fd_getcmxml_load_datamxml_file_getcmxml_string_getcmxml_fd_putcmxml_write_nodemxml_fd_writemxml_file_putcmxml_string_putcmxml_add_charmxml_fd_readmxml_get_entitytypes.69mxml_parse_elementmxml_write_namemxml_write_wsmxml_write_stringmxml-index.cindex_findindex_sortindex_comparemxml-node.cmxml_newmxml-search.cmxml-set.cmxml-private.c_mxml_key_mxml_key_once_mxml_init_mxml_destructormxml-string.c_DYNAMIC_GLOBAL_OFFSET_TABLE_get_image_symbolmxmlRemovemxmlRetainmxmlAddputc_unlockedmxmlSAXLoadFilemxmlSaveStringpthread_getspecificstrerrormxmlSetIntegermemmovesnprintfmxmlNewIntegergetc_unlockedmxmlNewTextf__ctype_bmxml_opaque_cbmxmlNewElement_term_aftergetc_mxml_vstrdupfmxmlIndexResetmallocvsnprintfmxmlSAXLoadFd_init_before_mxml_entity_cbmxmlEntityGetValue_initstrtolmxml_ignore_cbmxmlSaveFilestrrchrcallocmxmlEntityGetNamestrtodwritemxmlElementSetAttrffprintfpthread_once__deregister_frame_infomxmlWalkNextmxmlSetCustomHandlerspthread_key_createmxmlNewOpaquemxmlLoadFile_mxml_strdupfreadstrncmpmxmlSetErrorCallbackrealloc_gSharedObjectHaikuABImxmlLoadFdmxmlWalkPrevmxmlSetCustomstrdupmxmlReleasemxmlDeletemxmlElementDeleteAttr__bss_startmxmlEntityAddCallback_mxml_globalmxmlSetCDATAmxmlSetOpaquemxml_real_cb_term_beforemxmlElementGetAttrmxmlNewRealmxmlFindElement_errnopmxmlSetElementmxmlNewCustomputcmxmlSaveAllocStringmxmlSAXLoadStringstrcmpmxml_errormxmlLoadString_finimxmlSetRealmxmlIndexEnumsprintfmxmlSetWrapMarginmxmlIndexNew_single_threadedstderrmxmlSetTextmxmlIndexFindmxmlNewXMLmxml_integer_cbmxmlNewText_edata_endmxmlIndexDeletemxmlElementSetAttrmxmlSetTextf_init_aftermxmlEntityRemoveCallbackmxmlSaveFd__register_frame_info_gSharedObjectHaikuVersionmxmlNewCDATApthread_setspecificfree
\ No newline at end of file
diff -Naur mxml-2.6/mxml-attr.c mxml-2.6-haiku/mxml-attr.c
--- mxml-2.6/mxml-attr.c 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/mxml-attr.c 2007-09-15 20:04:56.000000000 +0000
@@ -0,0 +1,321 @@
+/*
+ * "$Id: mxml-attr.c 308 2007-09-15 20:04:56Z mike $"
+ *
+ * Attribute support code for Mini-XML, a small XML-like file parsing library.
+ *
+ * Copyright 2003-2007 by Michael Sweet.
+ *
+ * This program is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU Library General Public
+ * License as published by the Free Software Foundation; either
+ * version 2, or (at your option) any later version.
+ *
+ * This program is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+ * GNU General Public License for more details.
+ *
+ * Contents:
+ *
+ * mxmlElementDeleteAttr() - Delete an attribute.
+ * mxmlElementGetAttr() - Get an attribute.
+ * mxmlElementSetAttr() - Set an attribute.
+ * mxmlElementSetAttrf() - Set an attribute with a formatted value.
+ * mxml_set_attr() - Set or add an attribute name/value pair.
+ */
+
+/*
+ * Include necessary headers...
+ */
+
+#include "config.h"
+#include "mxml.h"
+
+
+/*
+ * Local functions...
+ */
+
+static int mxml_set_attr(mxml_node_t *node, const char *name,
+ char *value);
+
+
+/*
+ * 'mxmlElementDeleteAttr()' - Delete an attribute.
+ *
+ * @since Mini-XML 2.4@
+ */
+
+void
+mxmlElementDeleteAttr(mxml_node_t *node,/* I - Element */
+ const char *name)/* I - Attribute name */
+{
+ int i; /* Looping var */
+ mxml_attr_t *attr; /* Cirrent attribute */
+
+
+#ifdef DEBUG
+ fprintf(stderr, "mxmlElementDeleteAttr(node=%p, name=\"%s\")\n",
+ node, name ? name : "(null)");
+#endif /* DEBUG */
+
+ /*
+ * Range check input...
+ */
+
+ if (!node || node->type != MXML_ELEMENT || !name)
+ return;
+
+ /*
+ * Look for the attribute...
+ */
+
+ for (i = node->value.element.num_attrs, attr = node->value.element.attrs;
+ i > 0;
+ i --, attr ++)
+ {
+#ifdef DEBUG
+ printf(" %s=\"%s\"\n", attr->name, attr->value);
+#endif /* DEBUG */
+
+ if (!strcmp(attr->name, name))
+ {
+ /*
+ * Delete this attribute...
+ */
+
+ free(attr->name);
+ free(attr->value);
+
+ i --;
+ if (i > 0)
+ memmove(attr, attr + 1, i * sizeof(mxml_attr_t));
+
+ node->value.element.num_attrs --;
+ return;
+ }
+ }
+}
+
+
+/*
+ * 'mxmlElementGetAttr()' - Get an attribute.
+ *
+ * This function returns NULL if the node is not an element or the
+ * named attribute does not exist.
+ */
+
+const char * /* O - Attribute value or NULL */
+mxmlElementGetAttr(mxml_node_t *node, /* I - Element node */
+ const char *name) /* I - Name of attribute */
+{
+ int i; /* Looping var */
+ mxml_attr_t *attr; /* Cirrent attribute */
+
+
+#ifdef DEBUG
+ fprintf(stderr, "mxmlElementGetAttr(node=%p, name=\"%s\")\n",
+ node, name ? name : "(null)");
+#endif /* DEBUG */
+
+ /*
+ * Range check input...
+ */
+
+ if (!node || node->type != MXML_ELEMENT || !name)
+ return (NULL);
+
+ /*
+ * Look for the attribute...
+ */
+
+ for (i = node->value.element.num_attrs, attr = node->value.element.attrs;
+ i > 0;
+ i --, attr ++)
+ {
+#ifdef DEBUG
+ printf(" %s=\"%s\"\n", attr->name, attr->value);
+#endif /* DEBUG */
+
+ if (!strcmp(attr->name, name))
+ {
+#ifdef DEBUG
+ printf(" Returning \"%s\"!\n", attr->value);
+#endif /* DEBUG */
+ return (attr->value);
+ }
+ }
+
+ /*
+ * Didn't find attribute, so return NULL...
+ */
+
+#ifdef DEBUG
+ puts(" Returning NULL!\n");
+#endif /* DEBUG */
+
+ return (NULL);
+}
+
+
+/*
+ * 'mxmlElementSetAttr()' - Set an attribute.
+ *
+ * If the named attribute already exists, the value of the attribute
+ * is replaced by the new string value. The string value is copied
+ * into the element node. This function does nothing if the node is
+ * not an element.
+ */
+
+void
+mxmlElementSetAttr(mxml_node_t *node, /* I - Element node */
+ const char *name, /* I - Name of attribute */
+ const char *value) /* I - Attribute value */
+{
+ char *valuec; /* Copy of value */
+
+
+#ifdef DEBUG
+ fprintf(stderr, "mxmlElementSetAttr(node=%p, name=\"%s\", value=\"%s\")\n",
+ node, name ? name : "(null)", value ? value : "(null)");
+#endif /* DEBUG */
+
+ /*
+ * Range check input...
+ */
+
+ if (!node || node->type != MXML_ELEMENT || !name)
+ return;
+
+ if (value)
+ valuec = strdup(value);
+ else
+ valuec = NULL;
+
+ if (mxml_set_attr(node, name, valuec))
+ free(valuec);
+}
+
+
+/*
+ * 'mxmlElementSetAttrf()' - Set an attribute with a formatted value.
+ *
+ * If the named attribute already exists, the value of the attribute
+ * is replaced by the new formatted string. The formatted string value is
+ * copied into the element node. This function does nothing if the node
+ * is not an element.
+ *
+ * @since Mini-XML 2.3@
+ */
+
+void
+mxmlElementSetAttrf(mxml_node_t *node, /* I - Element node */
+ const char *name, /* I - Name of attribute */
+ const char *format,/* I - Printf-style attribute value */
+ ...) /* I - Additional arguments as needed */
+{
+ va_list ap; /* Argument pointer */
+ char *value; /* Value */
+
+
+#ifdef DEBUG
+ fprintf(stderr,
+ "mxmlElementSetAttrf(node=%p, name=\"%s\", format=\"%s\", ...)\n",
+ node, name ? name : "(null)", format ? format : "(null)");
+#endif /* DEBUG */
+
+ /*
+ * Range check input...
+ */
+
+ if (!node || node->type != MXML_ELEMENT || !name || !format)
+ return;
+
+ /*
+ * Format the value...
+ */
+
+ va_start(ap, format);
+ value = _mxml_vstrdupf(format, ap);
+ va_end(ap);
+
+ if (!value)
+ mxml_error("Unable to allocate memory for attribute '%s' in element %s!",
+ name, node->value.element.name);
+ else if (mxml_set_attr(node, name, value))
+ free(value);
+}
+
+
+/*
+ * 'mxml_set_attr()' - Set or add an attribute name/value pair.
+ */
+
+static int /* O - 0 on success, -1 on failure */
+mxml_set_attr(mxml_node_t *node, /* I - Element node */
+ const char *name, /* I - Attribute name */
+ char *value) /* I - Attribute value */
+{
+ int i; /* Looping var */
+ mxml_attr_t *attr; /* New attribute */
+
+
+ /*
+ * Look for the attribute...
+ */
+
+ for (i = node->value.element.num_attrs, attr = node->value.element.attrs;
+ i > 0;
+ i --, attr ++)
+ if (!strcmp(attr->name, name))
+ {
+ /*
+ * Free the old value as needed...
+ */
+
+ if (attr->value)
+ free(attr->value);
+
+ attr->value = value;
+
+ return (0);
+ }
+
+ /*
+ * Add a new attribute...
+ */
+
+ if (node->value.element.num_attrs == 0)
+ attr = malloc(sizeof(mxml_attr_t));
+ else
+ attr = realloc(node->value.element.attrs,
+ (node->value.element.num_attrs + 1) * sizeof(mxml_attr_t));
+
+ if (!attr)
+ {
+ mxml_error("Unable to allocate memory for attribute '%s' in element %s!",
+ name, node->value.element.name);
+ return (-1);
+ }
+
+ node->value.element.attrs = attr;
+ attr += node->value.element.num_attrs;
+
+ if ((attr->name = strdup(name)) == NULL)
+ {
+ mxml_error("Unable to allocate memory for attribute '%s' in element %s!",
+ name, node->value.element.name);
+ return (-1);
+ }
+
+ attr->value = value;
+
+ node->value.element.num_attrs ++;
+
+ return (0);
+}
+
+
+/*
+ * End of "$Id: mxml-attr.c 308 2007-09-15 20:04:56Z mike $".
+ */
diff -Naur mxml-2.6/mxml-entity.c mxml-2.6-haiku/mxml-entity.c
--- mxml-2.6/mxml-entity.c 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/mxml-entity.c 2009-03-19 05:38:52.000000000 +0000
@@ -0,0 +1,462 @@
+/*
+ * "$Id: mxml-entity.c 385 2009-03-19 05:38:52Z mike $"
+ *
+ * Character entity support code for Mini-XML, a small XML-like
+ * file parsing library.
+ *
+ * Copyright 2003-2009 by Michael Sweet.
+ *
+ * This program is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU Library General Public
+ * License as published by the Free Software Foundation; either
+ * version 2, or (at your option) any later version.
+ *
+ * This program is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+ * GNU General Public License for more details.
+ *
+ * Contents:
+ *
+ * mxmlEntityAddCallback() - Add a callback to convert entities to
+ * Unicode.
+ * mxmlEntityGetName() - Get the name that corresponds to the
+ * character value.
+ * mxmlEntityGetValue() - Get the character corresponding to a named
+ * entity.
+ * mxmlEntityRemoveCallback() - Remove a callback.
+ * _mxml_entity_cb() - Lookup standard (X)HTML entities.
+ */
+
+/*
+ * Include necessary headers...
+ */
+
+#include "mxml-private.h"
+
+
+/*
+ * 'mxmlEntityAddCallback()' - Add a callback to convert entities to Unicode.
+ */
+
+int /* O - 0 on success, -1 on failure */
+mxmlEntityAddCallback(
+ mxml_entity_cb_t cb) /* I - Callback function to add */
+{
+ _mxml_global_t *global = _mxml_global();
+ /* Global data */
+
+
+ if (global->num_entity_cbs < (int)(sizeof(global->entity_cbs) / sizeof(global->entity_cbs[0])))
+ {
+ global->entity_cbs[global->num_entity_cbs] = cb;
+ global->num_entity_cbs ++;
+
+ return (0);
+ }
+ else
+ {
+ mxml_error("Unable to add entity callback!");
+
+ return (-1);
+ }
+}
+
+
+/*
+ * 'mxmlEntityGetName()' - Get the name that corresponds to the character value.
+ *
+ * If val does not need to be represented by a named entity, NULL is returned.
+ */
+
+const char * /* O - Entity name or NULL */
+mxmlEntityGetName(int val) /* I - Character value */
+{
+ switch (val)
+ {
+ case '&' :
+ return ("amp");
+
+ case '<' :
+ return ("lt");
+
+ case '>' :
+ return ("gt");
+
+ case '\"' :
+ return ("quot");
+
+ default :
+ return (NULL);
+ }
+}
+
+
+/*
+ * 'mxmlEntityGetValue()' - Get the character corresponding to a named entity.
+ *
+ * The entity name can also be a numeric constant. -1 is returned if the
+ * name is not known.
+ */
+
+int /* O - Character value or -1 on error */
+mxmlEntityGetValue(const char *name) /* I - Entity name */
+{
+ int i; /* Looping var */
+ int ch; /* Character value */
+ _mxml_global_t *global = _mxml_global();
+ /* Global data */
+
+
+ for (i = 0; i < global->num_entity_cbs; i ++)
+ if ((ch = (global->entity_cbs[i])(name)) >= 0)
+ return (ch);
+
+ return (-1);
+}
+
+
+/*
+ * 'mxmlEntityRemoveCallback()' - Remove a callback.
+ */
+
+void
+mxmlEntityRemoveCallback(
+ mxml_entity_cb_t cb) /* I - Callback function to remove */
+{
+ int i; /* Looping var */
+ _mxml_global_t *global = _mxml_global();
+ /* Global data */
+
+
+ for (i = 0; i < global->num_entity_cbs; i ++)
+ if (cb == global->entity_cbs[i])
+ {
+ /*
+ * Remove the callback...
+ */
+
+ global->num_entity_cbs --;
+
+ if (i < global->num_entity_cbs)
+ memmove(global->entity_cbs + i, global->entity_cbs + i + 1,
+ (global->num_entity_cbs - i) * sizeof(global->entity_cbs[0]));
+
+ return;
+ }
+}
+
+
+/*
+ * '_mxml_entity_cb()' - Lookup standard (X)HTML entities.
+ */
+
+int /* O - Unicode value or -1 */
+_mxml_entity_cb(const char *name) /* I - Entity name */
+{
+ int diff, /* Difference between names */
+ current, /* Current entity in search */
+ first, /* First entity in search */
+ last; /* Last entity in search */
+ static const struct
+ {
+ const char *name; /* Entity name */
+ int val; /* Character value */
+ } entities[] =
+ {
+ { "AElig", 198 },
+ { "Aacute", 193 },
+ { "Acirc", 194 },
+ { "Agrave", 192 },
+ { "Alpha", 913 },
+ { "Aring", 197 },
+ { "Atilde", 195 },
+ { "Auml", 196 },
+ { "Beta", 914 },
+ { "Ccedil", 199 },
+ { "Chi", 935 },
+ { "Dagger", 8225 },
+ { "Delta", 916 },
+ { "Dstrok", 208 },
+ { "ETH", 208 },
+ { "Eacute", 201 },
+ { "Ecirc", 202 },
+ { "Egrave", 200 },
+ { "Epsilon", 917 },
+ { "Eta", 919 },
+ { "Euml", 203 },
+ { "Gamma", 915 },
+ { "Iacute", 205 },
+ { "Icirc", 206 },
+ { "Igrave", 204 },
+ { "Iota", 921 },
+ { "Iuml", 207 },
+ { "Kappa", 922 },
+ { "Lambda", 923 },
+ { "Mu", 924 },
+ { "Ntilde", 209 },
+ { "Nu", 925 },
+ { "OElig", 338 },
+ { "Oacute", 211 },
+ { "Ocirc", 212 },
+ { "Ograve", 210 },
+ { "Omega", 937 },
+ { "Omicron", 927 },
+ { "Oslash", 216 },
+ { "Otilde", 213 },
+ { "Ouml", 214 },
+ { "Phi", 934 },
+ { "Pi", 928 },
+ { "Prime", 8243 },
+ { "Psi", 936 },
+ { "Rho", 929 },
+ { "Scaron", 352 },
+ { "Sigma", 931 },
+ { "THORN", 222 },
+ { "Tau", 932 },
+ { "Theta", 920 },
+ { "Uacute", 218 },
+ { "Ucirc", 219 },
+ { "Ugrave", 217 },
+ { "Upsilon", 933 },
+ { "Uuml", 220 },
+ { "Xi", 926 },
+ { "Yacute", 221 },
+ { "Yuml", 376 },
+ { "Zeta", 918 },
+ { "aacute", 225 },
+ { "acirc", 226 },
+ { "acute", 180 },
+ { "aelig", 230 },
+ { "agrave", 224 },
+ { "alefsym", 8501 },
+ { "alpha", 945 },
+ { "amp", '&' },
+ { "and", 8743 },
+ { "ang", 8736 },
+ { "apos", '\'' },
+ { "aring", 229 },
+ { "asymp", 8776 },
+ { "atilde", 227 },
+ { "auml", 228 },
+ { "bdquo", 8222 },
+ { "beta", 946 },
+ { "brkbar", 166 },
+ { "brvbar", 166 },
+ { "bull", 8226 },
+ { "cap", 8745 },
+ { "ccedil", 231 },
+ { "cedil", 184 },
+ { "cent", 162 },
+ { "chi", 967 },
+ { "circ", 710 },
+ { "clubs", 9827 },
+ { "cong", 8773 },
+ { "copy", 169 },
+ { "crarr", 8629 },
+ { "cup", 8746 },
+ { "curren", 164 },
+ { "dArr", 8659 },
+ { "dagger", 8224 },
+ { "darr", 8595 },
+ { "deg", 176 },
+ { "delta", 948 },
+ { "diams", 9830 },
+ { "die", 168 },
+ { "divide", 247 },
+ { "eacute", 233 },
+ { "ecirc", 234 },
+ { "egrave", 232 },
+ { "empty", 8709 },
+ { "emsp", 8195 },
+ { "ensp", 8194 },
+ { "epsilon", 949 },
+ { "equiv", 8801 },
+ { "eta", 951 },
+ { "eth", 240 },
+ { "euml", 235 },
+ { "euro", 8364 },
+ { "exist", 8707 },
+ { "fnof", 402 },
+ { "forall", 8704 },
+ { "frac12", 189 },
+ { "frac14", 188 },
+ { "frac34", 190 },
+ { "frasl", 8260 },
+ { "gamma", 947 },
+ { "ge", 8805 },
+ { "gt", '>' },
+ { "hArr", 8660 },
+ { "harr", 8596 },
+ { "hearts", 9829 },
+ { "hellip", 8230 },
+ { "hibar", 175 },
+ { "iacute", 237 },
+ { "icirc", 238 },
+ { "iexcl", 161 },
+ { "igrave", 236 },
+ { "image", 8465 },
+ { "infin", 8734 },
+ { "int", 8747 },
+ { "iota", 953 },
+ { "iquest", 191 },
+ { "isin", 8712 },
+ { "iuml", 239 },
+ { "kappa", 954 },
+ { "lArr", 8656 },
+ { "lambda", 955 },
+ { "lang", 9001 },
+ { "laquo", 171 },
+ { "larr", 8592 },
+ { "lceil", 8968 },
+ { "ldquo", 8220 },
+ { "le", 8804 },
+ { "lfloor", 8970 },
+ { "lowast", 8727 },
+ { "loz", 9674 },
+ { "lrm", 8206 },
+ { "lsaquo", 8249 },
+ { "lsquo", 8216 },
+ { "lt", '<' },
+ { "macr", 175 },
+ { "mdash", 8212 },
+ { "micro", 181 },
+ { "middot", 183 },
+ { "minus", 8722 },
+ { "mu", 956 },
+ { "nabla", 8711 },
+ { "nbsp", 160 },
+ { "ndash", 8211 },
+ { "ne", 8800 },
+ { "ni", 8715 },
+ { "not", 172 },
+ { "notin", 8713 },
+ { "nsub", 8836 },
+ { "ntilde", 241 },
+ { "nu", 957 },
+ { "oacute", 243 },
+ { "ocirc", 244 },
+ { "oelig", 339 },
+ { "ograve", 242 },
+ { "oline", 8254 },
+ { "omega", 969 },
+ { "omicron", 959 },
+ { "oplus", 8853 },
+ { "or", 8744 },
+ { "ordf", 170 },
+ { "ordm", 186 },
+ { "oslash", 248 },
+ { "otilde", 245 },
+ { "otimes", 8855 },
+ { "ouml", 246 },
+ { "para", 182 },
+ { "part", 8706 },
+ { "permil", 8240 },
+ { "perp", 8869 },
+ { "phi", 966 },
+ { "pi", 960 },
+ { "piv", 982 },
+ { "plusmn", 177 },
+ { "pound", 163 },
+ { "prime", 8242 },
+ { "prod", 8719 },
+ { "prop", 8733 },
+ { "psi", 968 },
+ { "quot", '\"' },
+ { "rArr", 8658 },
+ { "radic", 8730 },
+ { "rang", 9002 },
+ { "raquo", 187 },
+ { "rarr", 8594 },
+ { "rceil", 8969 },
+ { "rdquo", 8221 },
+ { "real", 8476 },
+ { "reg", 174 },
+ { "rfloor", 8971 },
+ { "rho", 961 },
+ { "rlm", 8207 },
+ { "rsaquo", 8250 },
+ { "rsquo", 8217 },
+ { "sbquo", 8218 },
+ { "scaron", 353 },
+ { "sdot", 8901 },
+ { "sect", 167 },
+ { "shy", 173 },
+ { "sigma", 963 },
+ { "sigmaf", 962 },
+ { "sim", 8764 },
+ { "spades", 9824 },
+ { "sub", 8834 },
+ { "sube", 8838 },
+ { "sum", 8721 },
+ { "sup", 8835 },
+ { "sup1", 185 },
+ { "sup2", 178 },
+ { "sup3", 179 },
+ { "supe", 8839 },
+ { "szlig", 223 },
+ { "tau", 964 },
+ { "there4", 8756 },
+ { "theta", 952 },
+ { "thetasym", 977 },
+ { "thinsp", 8201 },
+ { "thorn", 254 },
+ { "tilde", 732 },
+ { "times", 215 },
+ { "trade", 8482 },
+ { "uArr", 8657 },
+ { "uacute", 250 },
+ { "uarr", 8593 },
+ { "ucirc", 251 },
+ { "ugrave", 249 },
+ { "uml", 168 },
+ { "upsih", 978 },
+ { "upsilon", 965 },
+ { "uuml", 252 },
+ { "weierp", 8472 },
+ { "xi", 958 },
+ { "yacute", 253 },
+ { "yen", 165 },
+ { "yuml", 255 },
+ { "zeta", 950 },
+ { "zwj", 8205 },
+ { "zwnj", 8204 }
+ };
+
+
+ /*
+ * Do a binary search for the named entity...
+ */
+
+ first = 0;
+ last = (int)(sizeof(entities) / sizeof(entities[0]) - 1);
+
+ while ((last - first) > 1)
+ {
+ current = (first + last) / 2;
+
+ if ((diff = strcmp(name, entities[current].name)) == 0)
+ return (entities[current].val);
+ else if (diff < 0)
+ last = current;
+ else
+ first = current;
+ }
+
+ /*
+ * If we get here, there is a small chance that there is still
+ * a match; check first and last...
+ */
+
+ if (!strcmp(name, entities[first].name))
+ return (entities[first].val);
+ else if (!strcmp(name, entities[last].name))
+ return (entities[last].val);
+ else
+ return (-1);
+}
+
+
+/*
+ * End of "$Id: mxml-entity.c 385 2009-03-19 05:38:52Z mike $".
+ */
diff -Naur mxml-2.6/mxml-file.c mxml-2.6-haiku/mxml-file.c
--- mxml-2.6/mxml-file.c 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/mxml-file.c 2009-05-17 05:20:52.000000000 +0000
@@ -0,0 +1,3027 @@
+/*
+ * "$Id: mxml-file.c 391 2009-05-17 05:20:52Z mike $"
+ *
+ * File loading code for Mini-XML, a small XML-like file parsing library.
+ *
+ * Copyright 2003-2009 by Michael Sweet.
+ *
+ * This program is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU Library General Public
+ * License as published by the Free Software Foundation; either
+ * version 2, or (at your option) any later version.
+ *
+ * This program is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+ * GNU General Public License for more details.
+ *
+ * Contents:
+ *
+ * mxmlLoadFd() - Load a file descriptor into an XML node tree.
+ * mxmlLoadFile() - Load a file into an XML node tree.
+ * mxmlLoadString() - Load a string into an XML node tree.
+ * mxmlSaveAllocString() - Save an XML node tree to an allocated string.
+ * mxmlSaveFd() - Save an XML tree to a file descriptor.
+ * mxmlSaveFile() - Save an XML tree to a file.
+ * mxmlSaveString() - Save an XML node tree to a string.
+ * mxmlSAXLoadFd() - Load a file descriptor into an XML node tree
+ * using a SAX callback.
+ * mxmlSAXLoadFile() - Load a file into an XML node tree
+ * using a SAX callback.
+ * mxmlSAXLoadString() - Load a string into an XML node tree
+ * using a SAX callback.
+ * mxmlSetCustomHandlers() - Set the handling functions for custom data.
+ * mxmlSetErrorCallback() - Set the error message callback.
+ * mxmlSetWrapMargin() - Set the the wrap margin when saving XML data.
+ * mxml_add_char() - Add a character to a buffer, expanding as needed.
+ * mxml_fd_getc() - Read a character from a file descriptor.
+ * mxml_fd_putc() - Write a character to a file descriptor.
+ * mxml_fd_read() - Read a buffer of data from a file descriptor.
+ * mxml_fd_write() - Write a buffer of data to a file descriptor.
+ * mxml_file_getc() - Get a character from a file.
+ * mxml_file_putc() - Write a character to a file.
+ * mxml_get_entity() - Get the character corresponding to an entity...
+ * mxml_load_data() - Load data into an XML node tree.
+ * mxml_parse_element() - Parse an element for any attributes...
+ * mxml_string_getc() - Get a character from a string.
+ * mxml_string_putc() - Write a character to a string.
+ * mxml_write_name() - Write a name string.
+ * mxml_write_node() - Save an XML node to a file.
+ * mxml_write_string() - Write a string, escaping & and < as needed.
+ * mxml_write_ws() - Do whitespace callback...
+ */
+
+/*
+ * Include necessary headers...
+ */
+
+#ifndef WIN32
+# include <unistd.h>
+#endif /* !WIN32 */
+#include "mxml-private.h"
+
+
+/*
+ * Character encoding...
+ */
+
+#define ENCODE_UTF8 0 /* UTF-8 */
+#define ENCODE_UTF16BE 1 /* UTF-16 Big-Endian */
+#define ENCODE_UTF16LE 2 /* UTF-16 Little-Endian */
+
+
+/*
+ * Macro to test for a bad XML character...
+ */
+
+#define mxml_bad_char(ch) ((ch) < ' ' && (ch) != '\n' && (ch) != '\r' && (ch) != '\t')
+
+
+/*
+ * Types and structures...
+ */
+
+typedef int (*_mxml_getc_cb_t)(void *, int *);
+typedef int (*_mxml_putc_cb_t)(int, void *);
+
+typedef struct _mxml_fdbuf_s /**** File descriptor buffer ****/
+{
+ int fd; /* File descriptor */
+ unsigned char *current, /* Current position in buffer */
+ *end, /* End of buffer */
+ buffer[8192]; /* Character buffer */
+} _mxml_fdbuf_t;
+
+
+/*
+ * Local functions...
+ */
+
+static int mxml_add_char(int ch, char **ptr, char **buffer,
+ int *bufsize);
+static int mxml_fd_getc(void *p, int *encoding);
+static int mxml_fd_putc(int ch, void *p);
+static int mxml_fd_read(_mxml_fdbuf_t *buf);
+static int mxml_fd_write(_mxml_fdbuf_t *buf);
+static int mxml_file_getc(void *p, int *encoding);
+static int mxml_file_putc(int ch, void *p);
+static int mxml_get_entity(mxml_node_t *parent, void *p,
+ int *encoding,
+ _mxml_getc_cb_t getc_cb);
+static inline int mxml_isspace(int ch)
+ {
+ return (ch == ' ' || ch == '\t' || ch == '\r' ||
+ ch == '\n');
+ }
+static mxml_node_t *mxml_load_data(mxml_node_t *top, void *p,
+ mxml_load_cb_t cb,
+ _mxml_getc_cb_t getc_cb,
+ mxml_sax_cb_t sax_cb, void *sax_data);
+static int mxml_parse_element(mxml_node_t *node, void *p,
+ int *encoding,
+ _mxml_getc_cb_t getc_cb);
+static int mxml_string_getc(void *p, int *encoding);
+static int mxml_string_putc(int ch, void *p);
+static int mxml_write_name(const char *s, void *p,
+ _mxml_putc_cb_t putc_cb);
+static int mxml_write_node(mxml_node_t *node, void *p,
+ mxml_save_cb_t cb, int col,
+ _mxml_putc_cb_t putc_cb,
+ _mxml_global_t *global);
+static int mxml_write_string(const char *s, void *p,
+ _mxml_putc_cb_t putc_cb);
+static int mxml_write_ws(mxml_node_t *node, void *p,
+ mxml_save_cb_t cb, int ws,
+ int col, _mxml_putc_cb_t putc_cb);
+
+
+/*
+ * 'mxmlLoadFd()' - Load a file descriptor into an XML node tree.
+ *
+ * The nodes in the specified file are added to the specified top node.
+ * If no top node is provided, the XML file MUST be well-formed with a
+ * single parent node like <?xml> for the entire file. The callback
+ * function returns the value type that should be used for child nodes.
+ * If MXML_NO_CALLBACK is specified then all child nodes will be either
+ * MXML_ELEMENT or MXML_TEXT nodes.
+ *
+ * The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK,
+ * MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading
+ * child nodes of the specified type.
+ */
+
+mxml_node_t * /* O - First node or NULL if the file could not be read. */
+mxmlLoadFd(mxml_node_t *top, /* I - Top node */
+ int fd, /* I - File descriptor to read from */
+ mxml_load_cb_t cb) /* I - Callback function or MXML_NO_CALLBACK */
+{
+ _mxml_fdbuf_t buf; /* File descriptor buffer */
+
+
+ /*
+ * Initialize the file descriptor buffer...
+ */
+
+ buf.fd = fd;
+ buf.current = buf.buffer;
+ buf.end = buf.buffer;
+
+ /*
+ * Read the XML data...
+ */
+
+ return (mxml_load_data(top, &buf, cb, mxml_fd_getc, MXML_NO_CALLBACK, NULL));
+}
+
+
+/*
+ * 'mxmlLoadFile()' - Load a file into an XML node tree.
+ *
+ * The nodes in the specified file are added to the specified top node.
+ * If no top node is provided, the XML file MUST be well-formed with a
+ * single parent node like <?xml> for the entire file. The callback
+ * function returns the value type that should be used for child nodes.
+ * If MXML_NO_CALLBACK is specified then all child nodes will be either
+ * MXML_ELEMENT or MXML_TEXT nodes.
+ *
+ * The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK,
+ * MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading
+ * child nodes of the specified type.
+ */
+
+mxml_node_t * /* O - First node or NULL if the file could not be read. */
+mxmlLoadFile(mxml_node_t *top, /* I - Top node */
+ FILE *fp, /* I - File to read from */
+ mxml_load_cb_t cb) /* I - Callback function or MXML_NO_CALLBACK */
+{
+ /*
+ * Read the XML data...
+ */
+
+ return (mxml_load_data(top, fp, cb, mxml_file_getc, MXML_NO_CALLBACK, NULL));
+}
+
+
+/*
+ * 'mxmlLoadString()' - Load a string into an XML node tree.
+ *
+ * The nodes in the specified string are added to the specified top node.
+ * If no top node is provided, the XML string MUST be well-formed with a
+ * single parent node like <?xml> for the entire string. The callback
+ * function returns the value type that should be used for child nodes.
+ * If MXML_NO_CALLBACK is specified then all child nodes will be either
+ * MXML_ELEMENT or MXML_TEXT nodes.
+ *
+ * The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK,
+ * MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading
+ * child nodes of the specified type.
+ */
+
+mxml_node_t * /* O - First node or NULL if the string has errors. */
+mxmlLoadString(mxml_node_t *top, /* I - Top node */
+ const char *s, /* I - String to load */
+ mxml_load_cb_t cb) /* I - Callback function or MXML_NO_CALLBACK */
+{
+ /*
+ * Read the XML data...
+ */
+
+ return (mxml_load_data(top, (void *)&s, cb, mxml_string_getc, MXML_NO_CALLBACK,
+ NULL));
+}
+
+
+/*
+ * 'mxmlSaveAllocString()' - Save an XML node tree to an allocated string.
+ *
+ * This function returns a pointer to a string containing the textual
+ * representation of the XML node tree. The string should be freed
+ * using the free() function when you are done with it. NULL is returned
+ * if the node would produce an empty string or if the string cannot be
+ * allocated.
+ *
+ * The callback argument specifies a function that returns a whitespace
+ * string or NULL before and after each element. If MXML_NO_CALLBACK
+ * is specified, whitespace will only be added before MXML_TEXT nodes
+ * with leading whitespace and before attribute names inside opening
+ * element tags.
+ */
+
+char * /* O - Allocated string or NULL */
+mxmlSaveAllocString(
+ mxml_node_t *node, /* I - Node to write */
+ mxml_save_cb_t cb) /* I - Whitespace callback or MXML_NO_CALLBACK */
+{
+ int bytes; /* Required bytes */
+ char buffer[8192]; /* Temporary buffer */
+ char *s; /* Allocated string */
+
+
+ /*
+ * Write the node to the temporary buffer...
+ */
+
+ bytes = mxmlSaveString(node, buffer, sizeof(buffer), cb);
+
+ if (bytes <= 0)
+ return (NULL);
+
+ if (bytes < (int)(sizeof(buffer) - 1))
+ {
+ /*
+ * Node fit inside the buffer, so just duplicate that string and
+ * return...
+ */
+
+ return (strdup(buffer));
+ }
+
+ /*
+ * Allocate a buffer of the required size and save the node to the
+ * new buffer...
+ */
+
+ if ((s = malloc(bytes + 1)) == NULL)
+ return (NULL);
+
+ mxmlSaveString(node, s, bytes + 1, cb);
+
+ /*
+ * Return the allocated string...
+ */
+
+ return (s);
+}
+
+
+/*
+ * 'mxmlSaveFd()' - Save an XML tree to a file descriptor.
+ *
+ * The callback argument specifies a function that returns a whitespace
+ * string or NULL before and after each element. If MXML_NO_CALLBACK
+ * is specified, whitespace will only be added before MXML_TEXT nodes
+ * with leading whitespace and before attribute names inside opening
+ * element tags.
+ */
+
+int /* O - 0 on success, -1 on error. */
+mxmlSaveFd(mxml_node_t *node, /* I - Node to write */
+ int fd, /* I - File descriptor to write to */
+ mxml_save_cb_t cb) /* I - Whitespace callback or MXML_NO_CALLBACK */
+{
+ int col; /* Final column */
+ _mxml_fdbuf_t buf; /* File descriptor buffer */
+ _mxml_global_t *global = _mxml_global();
+ /* Global data */
+
+
+ /*
+ * Initialize the file descriptor buffer...
+ */
+
+ buf.fd = fd;
+ buf.current = buf.buffer;
+ buf.end = buf.buffer + sizeof(buf.buffer);
+
+ /*
+ * Write the node...
+ */
+
+ if ((col = mxml_write_node(node, &buf, cb, 0, mxml_fd_putc, global)) < 0)
+ return (-1);
+
+ if (col > 0)
+ if (mxml_fd_putc('\n', &buf) < 0)
+ return (-1);
+
+ /*
+ * Flush and return...
+ */
+
+ return (mxml_fd_write(&buf));
+}
+
+
+/*
+ * 'mxmlSaveFile()' - Save an XML tree to a file.
+ *
+ * The callback argument specifies a function that returns a whitespace
+ * string or NULL before and after each element. If MXML_NO_CALLBACK
+ * is specified, whitespace will only be added before MXML_TEXT nodes
+ * with leading whitespace and before attribute names inside opening
+ * element tags.
+ */
+
+int /* O - 0 on success, -1 on error. */
+mxmlSaveFile(mxml_node_t *node, /* I - Node to write */
+ FILE *fp, /* I - File to write to */
+ mxml_save_cb_t cb) /* I - Whitespace callback or MXML_NO_CALLBACK */
+{
+ int col; /* Final column */
+ _mxml_global_t *global = _mxml_global();
+ /* Global data */
+
+
+ /*
+ * Write the node...
+ */
+
+ if ((col = mxml_write_node(node, fp, cb, 0, mxml_file_putc, global)) < 0)
+ return (-1);
+
+ if (col > 0)
+ if (putc('\n', fp) < 0)
+ return (-1);
+
+ /*
+ * Return 0 (success)...
+ */
+
+ return (0);
+}
+
+
+/*
+ * 'mxmlSaveString()' - Save an XML node tree to a string.
+ *
+ * This function returns the total number of bytes that would be
+ * required for the string but only copies (bufsize - 1) characters
+ * into the specified buffer.
+ *
+ * The callback argument specifies a function that returns a whitespace
+ * string or NULL before and after each element. If MXML_NO_CALLBACK
+ * is specified, whitespace will only be added before MXML_TEXT nodes
+ * with leading whitespace and before attribute names inside opening
+ * element tags.
+ */
+
+int /* O - Size of string */
+mxmlSaveString(mxml_node_t *node, /* I - Node to write */
+ char *buffer, /* I - String buffer */
+ int bufsize, /* I - Size of string buffer */
+ mxml_save_cb_t cb) /* I - Whitespace callback or MXML_NO_CALLBACK */
+{
+ int col; /* Final column */
+ char *ptr[2]; /* Pointers for putc_cb */
+ _mxml_global_t *global = _mxml_global();
+ /* Global data */
+
+
+ /*
+ * Write the node...
+ */
+
+ ptr[0] = buffer;
+ ptr[1] = buffer + bufsize;
+
+ if ((col = mxml_write_node(node, ptr, cb, 0, mxml_string_putc, global)) < 0)
+ return (-1);
+
+ if (col > 0)
+ mxml_string_putc('\n', ptr);
+
+ /*
+ * Nul-terminate the buffer...
+ */
+
+ if (ptr[0] >= ptr[1])
+ buffer[bufsize - 1] = '\0';
+ else
+ ptr[0][0] = '\0';
+
+ /*
+ * Return the number of characters...
+ */
+
+ return (ptr[0] - buffer);
+}
+
+
+/*
+ * 'mxmlSAXLoadFd()' - Load a file descriptor into an XML node tree
+ * using a SAX callback.
+ *
+ * The nodes in the specified file are added to the specified top node.
+ * If no top node is provided, the XML file MUST be well-formed with a
+ * single parent node like <?xml> for the entire file. The callback
+ * function returns the value type that should be used for child nodes.
+ * If MXML_NO_CALLBACK is specified then all child nodes will be either
+ * MXML_ELEMENT or MXML_TEXT nodes.
+ *
+ * The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK,
+ * MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading
+ * child nodes of the specified type.
+ *
+ * The SAX callback must call mxmlRetain() for any nodes that need to
+ * be kept for later use. Otherwise, nodes are deleted when the parent
+ * node is closed or after each data, comment, CDATA, or directive node.
+ *
+ * @since Mini-XML 2.3@
+ */
+
+mxml_node_t * /* O - First node or NULL if the file could not be read. */
+mxmlSAXLoadFd(mxml_node_t *top, /* I - Top node */
+ int fd, /* I - File descriptor to read from */
+ mxml_load_cb_t cb, /* I - Callback function or MXML_NO_CALLBACK */
+ mxml_sax_cb_t sax_cb, /* I - SAX callback or MXML_NO_CALLBACK */
+ void *sax_data) /* I - SAX user data */
+{
+ _mxml_fdbuf_t buf; /* File descriptor buffer */
+
+
+ /*
+ * Initialize the file descriptor buffer...
+ */
+
+ buf.fd = fd;
+ buf.current = buf.buffer;
+ buf.end = buf.buffer;
+
+ /*
+ * Read the XML data...
+ */
+
+ return (mxml_load_data(top, &buf, cb, mxml_fd_getc, sax_cb, sax_data));
+}
+
+
+/*
+ * 'mxmlSAXLoadFile()' - Load a file into an XML node tree
+ * using a SAX callback.
+ *
+ * The nodes in the specified file are added to the specified top node.
+ * If no top node is provided, the XML file MUST be well-formed with a
+ * single parent node like <?xml> for the entire file. The callback
+ * function returns the value type that should be used for child nodes.
+ * If MXML_NO_CALLBACK is specified then all child nodes will be either
+ * MXML_ELEMENT or MXML_TEXT nodes.
+ *
+ * The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK,
+ * MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading
+ * child nodes of the specified type.
+ *
+ * The SAX callback must call mxmlRetain() for any nodes that need to
+ * be kept for later use. Otherwise, nodes are deleted when the parent
+ * node is closed or after each data, comment, CDATA, or directive node.
+ *
+ * @since Mini-XML 2.3@
+ */
+
+mxml_node_t * /* O - First node or NULL if the file could not be read. */
+mxmlSAXLoadFile(
+ mxml_node_t *top, /* I - Top node */
+ FILE *fp, /* I - File to read from */
+ mxml_load_cb_t cb, /* I - Callback function or MXML_NO_CALLBACK */
+ mxml_sax_cb_t sax_cb, /* I - SAX callback or MXML_NO_CALLBACK */
+ void *sax_data) /* I - SAX user data */
+{
+ /*
+ * Read the XML data...
+ */
+
+ return (mxml_load_data(top, fp, cb, mxml_file_getc, sax_cb, sax_data));
+}
+
+
+/*
+ * 'mxmlSAXLoadString()' - Load a string into an XML node tree
+ * using a SAX callback.
+ *
+ * The nodes in the specified string are added to the specified top node.
+ * If no top node is provided, the XML string MUST be well-formed with a
+ * single parent node like <?xml> for the entire string. The callback
+ * function returns the value type that should be used for child nodes.
+ * If MXML_NO_CALLBACK is specified then all child nodes will be either
+ * MXML_ELEMENT or MXML_TEXT nodes.
+ *
+ * The constants MXML_INTEGER_CALLBACK, MXML_OPAQUE_CALLBACK,
+ * MXML_REAL_CALLBACK, and MXML_TEXT_CALLBACK are defined for loading
+ * child nodes of the specified type.
+ *
+ * The SAX callback must call mxmlRetain() for any nodes that need to
+ * be kept for later use. Otherwise, nodes are deleted when the parent
+ * node is closed or after each data, comment, CDATA, or directive node.
+ *
+ * @since Mini-XML 2.3@
+ */
+
+mxml_node_t * /* O - First node or NULL if the string has errors. */
+mxmlSAXLoadString(
+ mxml_node_t *top, /* I - Top node */
+ const char *s, /* I - String to load */
+ mxml_load_cb_t cb, /* I - Callback function or MXML_NO_CALLBACK */
+ mxml_sax_cb_t sax_cb, /* I - SAX callback or MXML_NO_CALLBACK */
+ void *sax_data) /* I - SAX user data */
+{
+ /*
+ * Read the XML data...
+ */
+
+ return (mxml_load_data(top, (void *)&s, cb, mxml_string_getc, sax_cb, sax_data));
+}
+
+
+/*
+ * 'mxmlSetCustomHandlers()' - Set the handling functions for custom data.
+ *
+ * The load function accepts a node pointer and a data string and must
+ * return 0 on success and non-zero on error.
+ *
+ * The save function accepts a node pointer and must return a malloc'd
+ * string on success and NULL on error.
+ *
+ */
+
+void
+mxmlSetCustomHandlers(
+ mxml_custom_load_cb_t load, /* I - Load function */
+ mxml_custom_save_cb_t save) /* I - Save function */
+{
+ _mxml_global_t *global = _mxml_global();
+ /* Global data */
+
+
+ global->custom_load_cb = load;
+ global->custom_save_cb = save;
+}
+
+
+/*
+ * 'mxmlSetErrorCallback()' - Set the error message callback.
+ */
+
+void
+mxmlSetErrorCallback(mxml_error_cb_t cb)/* I - Error callback function */
+{
+ _mxml_global_t *global = _mxml_global();
+ /* Global data */
+
+
+ global->error_cb = cb;
+}
+
+
+/*
+ * 'mxmlSetWrapMargin()' - Set the the wrap margin when saving XML data.
+ *
+ * Wrapping is disabled when "column" is 0.
+ *
+ * @since Mini-XML 2.3@
+ */
+
+void
+mxmlSetWrapMargin(int column) /* I - Column for wrapping, 0 to disable wrapping */
+{
+ _mxml_global_t *global = _mxml_global();
+ /* Global data */
+
+
+ global->wrap = column;
+}
+
+
+/*
+ * 'mxml_add_char()' - Add a character to a buffer, expanding as needed.
+ */
+
+static int /* O - 0 on success, -1 on error */
+mxml_add_char(int ch, /* I - Character to add */
+ char **bufptr, /* IO - Current position in buffer */
+ char **buffer, /* IO - Current buffer */
+ int *bufsize) /* IO - Current buffer size */
+{
+ char *newbuffer; /* New buffer value */
+
+
+ if (*bufptr >= (*buffer + *bufsize - 4))
+ {
+ /*
+ * Increase the size of the buffer...
+ */
+
+ if (*bufsize < 1024)
+ (*bufsize) *= 2;
+ else
+ (*bufsize) += 1024;
+
+ if ((newbuffer = realloc(*buffer, *bufsize)) == NULL)
+ {
+ free(*buffer);
+
+ mxml_error("Unable to expand string buffer to %d bytes!", *bufsize);
+
+ return (-1);
+ }
+
+ *bufptr = newbuffer + (*bufptr - *buffer);
+ *buffer = newbuffer;
+ }
+
+ if (ch < 0x80)
+ {
+ /*
+ * Single byte ASCII...
+ */
+
+ *(*bufptr)++ = ch;
+ }
+ else if (ch < 0x800)
+ {
+ /*
+ * Two-byte UTF-8...
+ */
+
+ *(*bufptr)++ = 0xc0 | (ch >> 6);
+ *(*bufptr)++ = 0x80 | (ch & 0x3f);
+ }
+ else if (ch < 0x10000)
+ {
+ /*
+ * Three-byte UTF-8...
+ */
+
+ *(*bufptr)++ = 0xe0 | (ch >> 12);
+ *(*bufptr)++ = 0x80 | ((ch >> 6) & 0x3f);
+ *(*bufptr)++ = 0x80 | (ch & 0x3f);
+ }
+ else
+ {
+ /*
+ * Four-byte UTF-8...
+ */
+
+ *(*bufptr)++ = 0xf0 | (ch >> 18);
+ *(*bufptr)++ = 0x80 | ((ch >> 12) & 0x3f);
+ *(*bufptr)++ = 0x80 | ((ch >> 6) & 0x3f);
+ *(*bufptr)++ = 0x80 | (ch & 0x3f);
+ }
+
+ return (0);
+}
+
+
+/*
+ * 'mxml_fd_getc()' - Read a character from a file descriptor.
+ */
+
+static int /* O - Character or EOF */
+mxml_fd_getc(void *p, /* I - File descriptor buffer */
+ int *encoding) /* IO - Encoding */
+{
+ _mxml_fdbuf_t *buf; /* File descriptor buffer */
+ int ch, /* Current character */
+ temp; /* Temporary character */
+
+
+ /*
+ * Grab the next character in the buffer...
+ */
+
+ buf = (_mxml_fdbuf_t *)p;
+
+ if (buf->current >= buf->end)
+ if (mxml_fd_read(buf) < 0)
+ return (EOF);
+
+ ch = *(buf->current)++;
+
+ switch (*encoding)
+ {
+ case ENCODE_UTF8 :
+ /*
+ * Got a UTF-8 character; convert UTF-8 to Unicode and return...
+ */
+
+ if (!(ch & 0x80))
+ {
+#if DEBUG > 1
+ printf("mxml_fd_getc: %c (0x%04x)\n", ch < ' ' ? '.' : ch, ch);
+#endif /* DEBUG > 1 */
+
+ if (mxml_bad_char(ch))
+ {
+ mxml_error("Bad control character 0x%02x not allowed by XML standard!",
+ ch);
+ return (EOF);
+ }
+
+ return (ch);
+ }
+ else if (ch == 0xfe)
+ {
+ /*
+ * UTF-16 big-endian BOM?
+ */
+
+ if (buf->current >= buf->end)
+ if (mxml_fd_read(buf) < 0)
+ return (EOF);
+
+ ch = *(buf->current)++;
+
+ if (ch != 0xff)
+ return (EOF);
+
+ *encoding = ENCODE_UTF16BE;
+
+ return (mxml_fd_getc(p, encoding));
+ }
+ else if (ch == 0xff)
+ {
+ /*
+ * UTF-16 little-endian BOM?
+ */
+
+ if (buf->current >= buf->end)
+ if (mxml_fd_read(buf) < 0)
+ return (EOF);
+
+ ch = *(buf->current)++;
+
+ if (ch != 0xfe)
+ return (EOF);
+
+ *encoding = ENCODE_UTF16LE;
+
+ return (mxml_fd_getc(p, encoding));
+ }
+ else if ((ch & 0xe0) == 0xc0)
+ {
+ /*
+ * Two-byte value...
+ */
+
+ if (buf->current >= buf->end)
+ if (mxml_fd_read(buf) < 0)
+ return (EOF);
+
+ temp = *(buf->current)++;
+
+ if ((temp & 0xc0) != 0x80)
+ return (EOF);
+
+ ch = ((ch & 0x1f) << 6) | (temp & 0x3f);
+
+ if (ch < 0x80)
+ {
+ mxml_error("Invalid UTF-8 sequence for character 0x%04x!", ch);
+ return (EOF);
+ }
+ }
+ else if ((ch & 0xf0) == 0xe0)
+ {
+ /*
+ * Three-byte value...
+ */
+
+ if (buf->current >= buf->end)
+ if (mxml_fd_read(buf) < 0)
+ return (EOF);
+
+ temp = *(buf->current)++;
+
+ if ((temp & 0xc0) != 0x80)
+ return (EOF);
+
+ ch = ((ch & 0x0f) << 6) | (temp & 0x3f);
+
+ if (buf->current >= buf->end)
+ if (mxml_fd_read(buf) < 0)
+ return (EOF);
+
+ temp = *(buf->current)++;
+
+ if ((temp & 0xc0) != 0x80)
+ return (EOF);
+
+ ch = (ch << 6) | (temp & 0x3f);
+
+ if (ch < 0x800)
+ {
+ mxml_error("Invalid UTF-8 sequence for character 0x%04x!", ch);
+ return (EOF);
+ }
+
+ /*
+ * Ignore (strip) Byte Order Mark (BOM)...
+ */
+
+ if (ch == 0xfeff)
+ return (mxml_fd_getc(p, encoding));
+ }
+ else if ((ch & 0xf8) == 0xf0)
+ {
+ /*
+ * Four-byte value...
+ */
+
+ if (buf->current >= buf->end)
+ if (mxml_fd_read(buf) < 0)
+ return (EOF);
+
+ temp = *(buf->current)++;
+
+ if ((temp & 0xc0) != 0x80)
+ return (EOF);
+
+ ch = ((ch & 0x07) << 6) | (temp & 0x3f);
+
+ if (buf->current >= buf->end)
+ if (mxml_fd_read(buf) < 0)
+ return (EOF);
+
+ temp = *(buf->current)++;
+
+ if ((temp & 0xc0) != 0x80)
+ return (EOF);
+
+ ch = (ch << 6) | (temp & 0x3f);
+
+ if (buf->current >= buf->end)
+ if (mxml_fd_read(buf) < 0)
+ return (EOF);
+
+ temp = *(buf->current)++;
+
+ if ((temp & 0xc0) != 0x80)
+ return (EOF);
+
+ ch = (ch << 6) | (temp & 0x3f);
+
+ if (ch < 0x10000)
+ {
+ mxml_error("Invalid UTF-8 sequence for character 0x%04x!", ch);
+ return (EOF);
+ }
+ }
+ else
+ return (EOF);
+ break;
+
+ case ENCODE_UTF16BE :
+ /*
+ * Read UTF-16 big-endian char...
+ */
+
+ if (buf->current >= buf->end)
+ if (mxml_fd_read(buf) < 0)
+ return (EOF);
+
+ temp = *(buf->current)++;
+
+ ch = (ch << 8) | temp;
+
+ if (mxml_bad_char(ch))
+ {
+ mxml_error("Bad control character 0x%02x not allowed by XML standard!",
+ ch);
+ return (EOF);
+ }
+ else if (ch >= 0xd800 && ch <= 0xdbff)
+ {
+ /*
+ * Multi-word UTF-16 char...
+ */
+
+ int lch;
+
+ if (buf->current >= buf->end)
+ if (mxml_fd_read(buf) < 0)
+ return (EOF);
+
+ lch = *(buf->current)++;
+
+ if (buf->current >= buf->end)
+ if (mxml_fd_read(buf) < 0)
+ return (EOF);
+
+ temp = *(buf->current)++;
+
+ lch = (lch << 8) | temp;
+
+ if (lch < 0xdc00 || lch >= 0xdfff)
+ return (EOF);
+
+ ch = (((ch & 0x3ff) << 10) | (lch & 0x3ff)) + 0x10000;
+ }
+ break;
+
+ case ENCODE_UTF16LE :
+ /*
+ * Read UTF-16 little-endian char...
+ */
+
+ if (buf->current >= buf->end)
+ if (mxml_fd_read(buf) < 0)
+ return (EOF);
+
+ temp = *(buf->current)++;
+
+ ch |= (temp << 8);
+
+ if (mxml_bad_char(ch))
+ {
+ mxml_error("Bad control character 0x%02x not allowed by XML standard!",
+ ch);
+ return (EOF);
+ }
+ else if (ch >= 0xd800 && ch <= 0xdbff)
+ {
+ /*
+ * Multi-word UTF-16 char...
+ */
+
+ int lch;
+
+ if (buf->current >= buf->end)
+ if (mxml_fd_read(buf) < 0)
+ return (EOF);
+
+ lch = *(buf->current)++;
+
+ if (buf->current >= buf->end)
+ if (mxml_fd_read(buf) < 0)
+ return (EOF);
+
+ temp = *(buf->current)++;
+
+ lch |= (temp << 8);
+
+ if (lch < 0xdc00 || lch >= 0xdfff)
+ return (EOF);
+
+ ch = (((ch & 0x3ff) << 10) | (lch & 0x3ff)) + 0x10000;
+ }
+ break;
+ }
+
+#if DEBUG > 1
+ printf("mxml_fd_getc: %c (0x%04x)\n", ch < ' ' ? '.' : ch, ch);
+#endif /* DEBUG > 1 */
+
+ return (ch);
+}
+
+
+/*
+ * 'mxml_fd_putc()' - Write a character to a file descriptor.
+ */
+
+static int /* O - 0 on success, -1 on error */
+mxml_fd_putc(int ch, /* I - Character */
+ void *p) /* I - File descriptor buffer */
+{
+ _mxml_fdbuf_t *buf; /* File descriptor buffer */
+
+
+ /*
+ * Flush the write buffer as needed...
+ */
+
+ buf = (_mxml_fdbuf_t *)p;
+
+ if (buf->current >= buf->end)
+ if (mxml_fd_write(buf) < 0)
+ return (-1);
+
+ *(buf->current)++ = ch;
+
+ /*
+ * Return successfully...
+ */
+
+ return (0);
+}
+
+
+/*
+ * 'mxml_fd_read()' - Read a buffer of data from a file descriptor.
+ */
+
+static int /* O - 0 on success, -1 on error */
+mxml_fd_read(_mxml_fdbuf_t *buf) /* I - File descriptor buffer */
+{
+ int bytes; /* Bytes read... */
+
+
+ /*
+ * Range check input...
+ */
+
+ if (!buf)
+ return (-1);
+
+ /*
+ * Read from the file descriptor...
+ */
+
+ while ((bytes = read(buf->fd, buf->buffer, sizeof(buf->buffer))) < 0)
+#ifdef EINTR
+ if (errno != EAGAIN && errno != EINTR)
+#else
+ if (errno != EAGAIN)
+#endif /* EINTR */
+ return (-1);
+
+ if (bytes == 0)
+ return (-1);
+
+ /*
+ * Update the pointers and return success...
+ */
+
+ buf->current = buf->buffer;
+ buf->end = buf->buffer + bytes;
+
+ return (0);
+}
+
+
+/*
+ * 'mxml_fd_write()' - Write a buffer of data to a file descriptor.
+ */
+
+static int /* O - 0 on success, -1 on error */
+mxml_fd_write(_mxml_fdbuf_t *buf) /* I - File descriptor buffer */
+{
+ int bytes; /* Bytes written */
+ unsigned char *ptr; /* Pointer into buffer */
+
+
+ /*
+ * Range check...
+ */
+
+ if (!buf)
+ return (-1);
+
+ /*
+ * Return 0 if there is nothing to write...
+ */
+
+ if (buf->current == buf->buffer)
+ return (0);
+
+ /*
+ * Loop until we have written everything...
+ */
+
+ for (ptr = buf->buffer; ptr < buf->current; ptr += bytes)
+ if ((bytes = write(buf->fd, ptr, buf->current - ptr)) < 0)
+ return (-1);
+
+ /*
+ * All done, reset pointers and return success...
+ */
+
+ buf->current = buf->buffer;
+
+ return (0);
+}
+
+
+/*
+ * 'mxml_file_getc()' - Get a character from a file.
+ */
+
+static int /* O - Character or EOF */
+mxml_file_getc(void *p, /* I - Pointer to file */
+ int *encoding) /* IO - Encoding */
+{
+ int ch, /* Character from file */
+ temp; /* Temporary character */
+ FILE *fp; /* Pointer to file */
+
+
+ /*
+ * Read a character from the file and see if it is EOF or ASCII...
+ */
+
+ fp = (FILE *)p;
+ ch = getc(fp);
+
+ if (ch == EOF)
+ return (EOF);
+
+ switch (*encoding)
+ {
+ case ENCODE_UTF8 :
+ /*
+ * Got a UTF-8 character; convert UTF-8 to Unicode and return...
+ */
+
+ if (!(ch & 0x80))
+ {
+ if (mxml_bad_char(ch))
+ {
+ mxml_error("Bad control character 0x%02x not allowed by XML standard!",
+ ch);
+ return (EOF);
+ }
+
+#if DEBUG > 1
+ printf("mxml_file_getc: %c (0x%04x)\n", ch < ' ' ? '.' : ch, ch);
+#endif /* DEBUG > 1 */
+
+ return (ch);
+ }
+ else if (ch == 0xfe)
+ {
+ /*
+ * UTF-16 big-endian BOM?
+ */
+
+ ch = getc(fp);
+ if (ch != 0xff)
+ return (EOF);
+
+ *encoding = ENCODE_UTF16BE;
+
+ return (mxml_file_getc(p, encoding));
+ }
+ else if (ch == 0xff)
+ {
+ /*
+ * UTF-16 little-endian BOM?
+ */
+
+ ch = getc(fp);
+ if (ch != 0xfe)
+ return (EOF);
+
+ *encoding = ENCODE_UTF16LE;
+
+ return (mxml_file_getc(p, encoding));
+ }
+ else if ((ch & 0xe0) == 0xc0)
+ {
+ /*
+ * Two-byte value...
+ */
+
+ if ((temp = getc(fp)) == EOF || (temp & 0xc0) != 0x80)
+ return (EOF);
+
+ ch = ((ch & 0x1f) << 6) | (temp & 0x3f);
+
+ if (ch < 0x80)
+ {
+ mxml_error("Invalid UTF-8 sequence for character 0x%04x!", ch);
+ return (EOF);
+ }
+ }
+ else if ((ch & 0xf0) == 0xe0)
+ {
+ /*
+ * Three-byte value...
+ */
+
+ if ((temp = getc(fp)) == EOF || (temp & 0xc0) != 0x80)
+ return (EOF);
+
+ ch = ((ch & 0x0f) << 6) | (temp & 0x3f);
+
+ if ((temp = getc(fp)) == EOF || (temp & 0xc0) != 0x80)
+ return (EOF);
+
+ ch = (ch << 6) | (temp & 0x3f);
+
+ if (ch < 0x800)
+ {
+ mxml_error("Invalid UTF-8 sequence for character 0x%04x!", ch);
+ return (EOF);
+ }
+
+ /*
+ * Ignore (strip) Byte Order Mark (BOM)...
+ */
+
+ if (ch == 0xfeff)
+ return (mxml_file_getc(p, encoding));
+ }
+ else if ((ch & 0xf8) == 0xf0)
+ {
+ /*
+ * Four-byte value...
+ */
+
+ if ((temp = getc(fp)) == EOF || (temp & 0xc0) != 0x80)
+ return (EOF);
+
+ ch = ((ch & 0x07) << 6) | (temp & 0x3f);
+
+ if ((temp = getc(fp)) == EOF || (temp & 0xc0) != 0x80)
+ return (EOF);
+
+ ch = (ch << 6) | (temp & 0x3f);
+
+ if ((temp = getc(fp)) == EOF || (temp & 0xc0) != 0x80)
+ return (EOF);
+
+ ch = (ch << 6) | (temp & 0x3f);
+
+ if (ch < 0x10000)
+ {
+ mxml_error("Invalid UTF-8 sequence for character 0x%04x!", ch);
+ return (EOF);
+ }
+ }
+ else
+ return (EOF);
+ break;
+
+ case ENCODE_UTF16BE :
+ /*
+ * Read UTF-16 big-endian char...
+ */
+
+ ch = (ch << 8) | getc(fp);
+
+ if (mxml_bad_char(ch))
+ {
+ mxml_error("Bad control character 0x%02x not allowed by XML standard!",
+ ch);
+ return (EOF);
+ }
+ else if (ch >= 0xd800 && ch <= 0xdbff)
+ {
+ /*
+ * Multi-word UTF-16 char...
+ */
+
+ int lch = (getc(fp) << 8) | getc(fp);
+
+ if (lch < 0xdc00 || lch >= 0xdfff)
+ return (EOF);
+
+ ch = (((ch & 0x3ff) << 10) | (lch & 0x3ff)) + 0x10000;
+ }
+ break;
+
+ case ENCODE_UTF16LE :
+ /*
+ * Read UTF-16 little-endian char...
+ */
+
+ ch |= (getc(fp) << 8);
+
+ if (mxml_bad_char(ch))
+ {
+ mxml_error("Bad control character 0x%02x not allowed by XML standard!",
+ ch);
+ return (EOF);
+ }
+ else if (ch >= 0xd800 && ch <= 0xdbff)
+ {
+ /*
+ * Multi-word UTF-16 char...
+ */
+
+ int lch = getc(fp) | (getc(fp) << 8);
+
+ if (lch < 0xdc00 || lch >= 0xdfff)
+ return (EOF);
+
+ ch = (((ch & 0x3ff) << 10) | (lch & 0x3ff)) + 0x10000;
+ }
+ break;
+ }
+
+#if DEBUG > 1
+ printf("mxml_file_getc: %c (0x%04x)\n", ch < ' ' ? '.' : ch, ch);
+#endif /* DEBUG > 1 */
+
+ return (ch);
+}
+
+
+/*
+ * 'mxml_file_putc()' - Write a character to a file.
+ */
+
+static int /* O - 0 on success, -1 on failure */
+mxml_file_putc(int ch, /* I - Character to write */
+ void *p) /* I - Pointer to file */
+{
+ return (putc(ch, (FILE *)p) == EOF ? -1 : 0);
+}
+
+
+/*
+ * 'mxml_get_entity()' - Get the character corresponding to an entity...
+ */
+
+static int /* O - Character value or EOF on error */
+mxml_get_entity(mxml_node_t *parent, /* I - Parent node */
+ void *p, /* I - Pointer to source */
+ int *encoding, /* IO - Character encoding */
+ int (*getc_cb)(void *, int *))
+ /* I - Get character function */
+{
+ int ch; /* Current character */
+ char entity[64], /* Entity string */
+ *entptr; /* Pointer into entity */
+
+
+ entptr = entity;
+
+ while ((ch = (*getc_cb)(p, encoding)) != EOF)
+ if (ch > 126 || (!isalnum(ch) && ch != '#'))
+ break;
+ else if (entptr < (entity + sizeof(entity) - 1))
+ *entptr++ = ch;
+ else
+ {
+ mxml_error("Entity name too long under parent <%s>!",
+ parent ? parent->value.element.name : "null");
+ break;
+ }
+
+ *entptr = '\0';
+
+ if (ch != ';')
+ {
+ mxml_error("Character entity \"%s\" not terminated under parent <%s>!",
+ entity, parent ? parent->value.element.name : "null");
+ return (EOF);
+ }
+
+ if (entity[0] == '#')
+ {
+ if (entity[1] == 'x')
+ ch = strtol(entity + 2, NULL, 16);
+ else
+ ch = strtol(entity + 1, NULL, 10);
+ }
+ else if ((ch = mxmlEntityGetValue(entity)) < 0)
+ mxml_error("Entity name \"%s;\" not supported under parent <%s>!",
+ entity, parent ? parent->value.element.name : "null");
+
+ if (mxml_bad_char(ch))
+ {
+ mxml_error("Bad control character 0x%02x under parent <%s> not allowed by XML standard!",
+ ch, parent ? parent->value.element.name : "null");
+ return (EOF);
+ }
+
+ return (ch);
+}
+
+
+/*
+ * 'mxml_load_data()' - Load data into an XML node tree.
+ */
+
+static mxml_node_t * /* O - First node or NULL if the file could not be read. */
+mxml_load_data(
+ mxml_node_t *top, /* I - Top node */
+ void *p, /* I - Pointer to data */
+ mxml_load_cb_t cb, /* I - Callback function or MXML_NO_CALLBACK */
+ _mxml_getc_cb_t getc_cb, /* I - Read function */
+ mxml_sax_cb_t sax_cb, /* I - SAX callback or MXML_NO_CALLBACK */
+ void *sax_data) /* I - SAX user data */
+{
+ mxml_node_t *node, /* Current node */
+ *first, /* First node added */
+ *parent; /* Current parent node */
+ int ch, /* Character from file */
+ whitespace; /* Non-zero if whitespace seen */
+ char *buffer, /* String buffer */
+ *bufptr; /* Pointer into buffer */
+ int bufsize; /* Size of buffer */
+ mxml_type_t type; /* Current node type */
+ int encoding; /* Character encoding */
+ _mxml_global_t *global = _mxml_global();
+ /* Global data */
+ static const char * const types[] = /* Type strings... */
+ {
+ "MXML_ELEMENT", /* XML element with attributes */
+ "MXML_INTEGER", /* Integer value */
+ "MXML_OPAQUE", /* Opaque string */
+ "MXML_REAL", /* Real value */
+ "MXML_TEXT", /* Text fragment */
+ "MXML_CUSTOM" /* Custom data */
+ };
+
+
+ /*
+ * Read elements and other nodes from the file...
+ */
+
+ if ((buffer = malloc(64)) == NULL)
+ {
+ mxml_error("Unable to allocate string buffer!");
+ return (NULL);
+ }
+
+ bufsize = 64;
+ bufptr = buffer;
+ parent = top;
+ first = NULL;
+ whitespace = 0;
+ encoding = ENCODE_UTF8;
+
+ if (cb && parent)
+ type = (*cb)(parent);
+ else
+ type = MXML_TEXT;
+
+ while ((ch = (*getc_cb)(p, &encoding)) != EOF)
+ {
+ if ((ch == '<' ||
+ (mxml_isspace(ch) && type != MXML_OPAQUE && type != MXML_CUSTOM)) &&
+ bufptr > buffer)
+ {
+ /*
+ * Add a new value node...
+ */
+
+ *bufptr = '\0';
+
+ switch (type)
+ {
+ case MXML_INTEGER :
+ node = mxmlNewInteger(parent, strtol(buffer, &bufptr, 0));
+ break;
+
+ case MXML_OPAQUE :
+ node = mxmlNewOpaque(parent, buffer);
+ break;
+
+ case MXML_REAL :
+ node = mxmlNewReal(parent, strtod(buffer, &bufptr));
+ break;
+
+ case MXML_TEXT :
+ node = mxmlNewText(parent, whitespace, buffer);
+ break;
+
+ case MXML_CUSTOM :
+ if (global->custom_load_cb)
+ {
+ /*
+ * Use the callback to fill in the custom data...
+ */
+
+ node = mxmlNewCustom(parent, NULL, NULL);
+
+ if ((*global->custom_load_cb)(node, buffer))
+ {
+ mxml_error("Bad custom value '%s' in parent <%s>!",
+ buffer, parent ? parent->value.element.name : "null");
+ mxmlDelete(node);
+ node = NULL;
+ }
+ break;
+ }
+
+ default : /* Ignore... */
+ node = NULL;
+ break;
+ }
+
+ if (*bufptr)
+ {
+ /*
+ * Bad integer/real number value...
+ */
+
+ mxml_error("Bad %s value '%s' in parent <%s>!",
+ type == MXML_INTEGER ? "integer" : "real", buffer,
+ parent ? parent->value.element.name : "null");
+ break;
+ }
+
+ bufptr = buffer;
+ whitespace = mxml_isspace(ch) && type == MXML_TEXT;
+
+ if (!node && type != MXML_IGNORE)
+ {
+ /*
+ * Print error and return...
+ */
+
+ mxml_error("Unable to add value node of type %s to parent <%s>!",
+ types[type], parent ? parent->value.element.name : "null");
+ goto error;
+ }
+
+ if (sax_cb)
+ {
+ (*sax_cb)(node, MXML_SAX_DATA, sax_data);
+
+ if (!mxmlRelease(node))
+ node = NULL;
+ }
+
+ if (!first && node)
+ first = node;
+ }
+ else if (mxml_isspace(ch) && type == MXML_TEXT)
+ whitespace = 1;
+
+ /*
+ * Add lone whitespace node if we have an element and existing
+ * whitespace...
+ */
+
+ if (ch == '<' && whitespace && type == MXML_TEXT)
+ {
+ node = mxmlNewText(parent, whitespace, "");
+
+ if (sax_cb)
+ {
+ (*sax_cb)(node, MXML_SAX_DATA, sax_data);
+
+ if (!mxmlRelease(node))
+ node = NULL;
+ }
+
+ if (!first && node)
+ first = node;
+
+ whitespace = 0;
+ }
+
+ if (ch == '<')
+ {
+ /*
+ * Start of open/close tag...
+ */
+
+ bufptr = buffer;
+
+ while ((ch = (*getc_cb)(p, &encoding)) != EOF)
+ if (mxml_isspace(ch) || ch == '>' || (ch == '/' && bufptr > buffer))
+ break;
+ else if (ch == '<')
+ {
+ mxml_error("Bare < in element!");
+ goto error;
+ }
+ else if (ch == '&')
+ {
+ if ((ch = mxml_get_entity(parent, p, &encoding, getc_cb)) == EOF)
+ goto error;
+
+ if (mxml_add_char(ch, &bufptr, &buffer, &bufsize))
+ goto error;
+ }
+ else if (mxml_add_char(ch, &bufptr, &buffer, &bufsize))
+ goto error;
+ else if (((bufptr - buffer) == 1 && buffer[0] == '?') ||
+ ((bufptr - buffer) == 3 && !strncmp(buffer, "!--", 3)) ||
+ ((bufptr - buffer) == 8 && !strncmp(buffer, "![CDATA[", 8)))
+ break;
+
+ *bufptr = '\0';
+
+ if (!strcmp(buffer, "!--"))
+ {
+ /*
+ * Gather rest of comment...
+ */
+
+ while ((ch = (*getc_cb)(p, &encoding)) != EOF)
+ {
+ if (ch == '>' && bufptr > (buffer + 4) &&
+ bufptr[-3] != '-' && bufptr[-2] == '-' && bufptr[-1] == '-')
+ break;
+ else if (mxml_add_char(ch, &bufptr, &buffer, &bufsize))
+ goto error;
+ }
+
+ /*
+ * Error out if we didn't get the whole comment...
+ */
+
+ if (ch != '>')
+ {
+ /*
+ * Print error and return...
+ */
+
+ mxml_error("Early EOF in comment node!");
+ goto error;
+ }
+
+
+ /*
+ * Otherwise add this as an element under the current parent...
+ */
+
+ *bufptr = '\0';
+
+ if ((node = mxmlNewElement(parent, buffer)) == NULL)
+ {
+ /*
+ * Just print error for now...
+ */
+
+ mxml_error("Unable to add comment node to parent <%s>!",
+ parent ? parent->value.element.name : "null");
+ break;
+ }
+
+ if (sax_cb)
+ {
+ (*sax_cb)(node, MXML_SAX_COMMENT, sax_data);
+
+ if (!mxmlRelease(node))
+ node = NULL;
+ }
+
+ if (node && !first)
+ first = node;
+ }
+ else if (!strcmp(buffer, "![CDATA["))
+ {
+ /*
+ * Gather CDATA section...
+ */
+
+ while ((ch = (*getc_cb)(p, &encoding)) != EOF)
+ {
+ if (ch == '>' && !strncmp(bufptr - 2, "]]", 2))
+ break;
+ else if (mxml_add_char(ch, &bufptr, &buffer, &bufsize))
+ goto error;
+ }
+
+ /*
+ * Error out if we didn't get the whole comment...
+ */
+
+ if (ch != '>')
+ {
+ /*
+ * Print error and return...
+ */
+
+ mxml_error("Early EOF in CDATA node!");
+ goto error;
+ }
+
+
+ /*
+ * Otherwise add this as an element under the current parent...
+ */
+
+ *bufptr = '\0';
+
+ if ((node = mxmlNewElement(parent, buffer)) == NULL)
+ {
+ /*
+ * Print error and return...
+ */
+
+ mxml_error("Unable to add CDATA node to parent <%s>!",
+ parent ? parent->value.element.name : "null");
+ goto error;
+ }
+
+ if (sax_cb)
+ {
+ (*sax_cb)(node, MXML_SAX_CDATA, sax_data);
+
+ if (!mxmlRelease(node))
+ node = NULL;
+ }
+
+ if (node && !first)
+ first = node;
+ }
+ else if (buffer[0] == '?')
+ {
+ /*
+ * Gather rest of processing instruction...
+ */
+
+ while ((ch = (*getc_cb)(p, &encoding)) != EOF)
+ {
+ if (ch == '>' && bufptr > buffer && bufptr[-1] == '?')
+ break;
+ else if (mxml_add_char(ch, &bufptr, &buffer, &bufsize))
+ goto error;
+ }
+
+ /*
+ * Error out if we didn't get the whole processing instruction...
+ */
+
+ if (ch != '>')
+ {
+ /*
+ * Print error and return...
+ */
+
+ mxml_error("Early EOF in processing instruction node!");
+ goto error;
+ }
+
+ /*
+ * Otherwise add this as an element under the current parent...
+ */
+
+ *bufptr = '\0';
+
+ if ((node = mxmlNewElement(parent, buffer)) == NULL)
+ {
+ /*
+ * Print error and return...
+ */
+
+ mxml_error("Unable to add processing instruction node to parent <%s>!",
+ parent ? parent->value.element.name : "null");
+ goto error;
+ }
+
+ if (sax_cb)
+ {
+ (*sax_cb)(node, MXML_SAX_DIRECTIVE, sax_data);
+
+ if (!mxmlRelease(node))
+ node = NULL;
+ }
+
+ if (node)
+ {
+ if (!first)
+ first = node;
+
+ if (!parent)
+ {
+ parent = node;
+
+ if (cb)
+ type = (*cb)(parent);
+ }
+ }
+ }
+ else if (buffer[0] == '!')
+ {
+ /*
+ * Gather rest of declaration...
+ */
+
+ do
+ {
+ if (ch == '>')
+ break;
+ else
+ {
+ if (ch == '&')
+ if ((ch = mxml_get_entity(parent, p, &encoding, getc_cb)) == EOF)
+ goto error;
+
+ if (mxml_add_char(ch, &bufptr, &buffer, &bufsize))
+ goto error;
+ }
+ }
+ while ((ch = (*getc_cb)(p, &encoding)) != EOF);
+
+ /*
+ * Error out if we didn't get the whole declaration...
+ */
+
+ if (ch != '>')
+ {
+ /*
+ * Print error and return...
+ */
+
+ mxml_error("Early EOF in declaration node!");
+ goto error;
+ }
+
+ /*
+ * Otherwise add this as an element under the current parent...
+ */
+
+ *bufptr = '\0';
+
+ if ((node = mxmlNewElement(parent, buffer)) == NULL)
+ {
+ /*
+ * Print error and return...
+ */
+
+ mxml_error("Unable to add declaration node to parent <%s>!",
+ parent ? parent->value.element.name : "null");
+ goto error;
+ }
+
+ if (sax_cb)
+ {
+ (*sax_cb)(node, MXML_SAX_DIRECTIVE, sax_data);
+
+ if (!mxmlRelease(node))
+ node = NULL;
+ }
+
+ if (node)
+ {
+ if (!first)
+ first = node;
+
+ if (!parent)
+ {
+ parent = node;
+
+ if (cb)
+ type = (*cb)(parent);
+ }
+ }
+ }
+ else if (buffer[0] == '/')
+ {
+ /*
+ * Handle close tag...
+ */
+
+ if (!parent || strcmp(buffer + 1, parent->value.element.name))
+ {
+ /*
+ * Close tag doesn't match tree; print an error for now...
+ */
+
+ mxml_error("Mismatched close tag <%s> under parent <%s>!",
+ buffer, parent ? parent->value.element.name : "(null)");
+ goto error;
+ }
+
+ /*
+ * Keep reading until we see >...
+ */
+
+ while (ch != '>' && ch != EOF)
+ ch = (*getc_cb)(p, &encoding);
+
+ node = parent;
+ parent = parent->parent;
+
+ if (sax_cb)
+ {
+ (*sax_cb)(node, MXML_SAX_ELEMENT_CLOSE, sax_data);
+
+ mxmlRelease(node);
+ }
+
+ /*
+ * Ascend into the parent and set the value type as needed...
+ */
+
+ if (cb && parent)
+ type = (*cb)(parent);
+ }
+ else
+ {
+ /*
+ * Handle open tag...
+ */
+
+ if ((node = mxmlNewElement(parent, buffer)) == NULL)
+ {
+ /*
+ * Just print error for now...
+ */
+
+ mxml_error("Unable to add element node to parent <%s>!",
+ parent ? parent->value.element.name : "null");
+ goto error;
+ }
+
+ if (mxml_isspace(ch))
+ {
+ if ((ch = mxml_parse_element(node, p, &encoding, getc_cb)) == EOF)
+ goto error;
+ }
+ else if (ch == '/')
+ {
+ if ((ch = (*getc_cb)(p, &encoding)) != '>')
+ {
+ mxml_error("Expected > but got '%c' instead for element <%s/>!",
+ ch, buffer);
+ mxmlDelete(node);
+ goto error;
+ }
+
+ ch = '/';
+ }
+
+ if (sax_cb)
+ (*sax_cb)(node, MXML_SAX_ELEMENT_OPEN, sax_data);
+
+ if (!first)
+ first = node;
+
+ if (ch == EOF)
+ break;
+
+ if (ch != '/')
+ {
+ /*
+ * Descend into this node, setting the value type as needed...
+ */
+
+ parent = node;
+
+ if (cb && parent)
+ type = (*cb)(parent);
+ }
+ else if (sax_cb)
+ {
+ (*sax_cb)(node, MXML_SAX_ELEMENT_CLOSE, sax_data);
+
+ if (!mxmlRelease(node) && first == node)
+ first = NULL;
+ }
+ }
+
+ bufptr = buffer;
+ }
+ else if (ch == '&')
+ {
+ /*
+ * Add character entity to current buffer...
+ */
+
+ if ((ch = mxml_get_entity(parent, p, &encoding, getc_cb)) == EOF)
+ goto error;
+
+ if (mxml_add_char(ch, &bufptr, &buffer, &bufsize))
+ goto error;
+ }
+ else if (type == MXML_OPAQUE || type == MXML_CUSTOM || !mxml_isspace(ch))
+ {
+ /*
+ * Add character to current buffer...
+ */
+
+ if (mxml_add_char(ch, &bufptr, &buffer, &bufsize))
+ goto error;
+ }
+ }
+
+ /*
+ * Free the string buffer - we don't need it anymore...
+ */
+
+ free(buffer);
+
+ /*
+ * Find the top element and return it...
+ */
+
+ if (parent)
+ {
+ node = parent;
+
+ while (parent->parent != top && parent->parent)
+ parent = parent->parent;
+
+ if (node != parent)
+ {
+ mxml_error("Missing close tag </%s> under parent <%s>!",
+ node->value.element.name,
+ node->parent ? node->parent->value.element.name : "(null)");
+
+ mxmlDelete(first);
+
+ return (NULL);
+ }
+ }
+
+ if (parent)
+ return (parent);
+ else
+ return (first);
+
+ /*
+ * Common error return...
+ */
+
+error:
+
+ mxmlDelete(first);
+
+ free(buffer);
+
+ return (NULL);
+}
+
+
+/*
+ * 'mxml_parse_element()' - Parse an element for any attributes...
+ */
+
+static int /* O - Terminating character */
+mxml_parse_element(
+ mxml_node_t *node, /* I - Element node */
+ void *p, /* I - Data to read from */
+ int *encoding, /* IO - Encoding */
+ _mxml_getc_cb_t getc_cb) /* I - Data callback */
+{
+ int ch, /* Current character in file */
+ quote; /* Quoting character */
+ char *name, /* Attribute name */
+ *value, /* Attribute value */
+ *ptr; /* Pointer into name/value */
+ int namesize, /* Size of name string */
+ valsize; /* Size of value string */
+
+
+ /*
+ * Initialize the name and value buffers...
+ */
+
+ if ((name = malloc(64)) == NULL)
+ {
+ mxml_error("Unable to allocate memory for name!");
+ return (EOF);
+ }
+
+ namesize = 64;
+
+ if ((value = malloc(64)) == NULL)
+ {
+ free(name);
+ mxml_error("Unable to allocate memory for value!");
+ return (EOF);
+ }
+
+ valsize = 64;
+
+ /*
+ * Loop until we hit a >, /, ?, or EOF...
+ */
+
+ while ((ch = (*getc_cb)(p, encoding)) != EOF)
+ {
+#if DEBUG > 1
+ fprintf(stderr, "parse_element: ch='%c'\n", ch);
+#endif /* DEBUG > 1 */
+
+ /*
+ * Skip leading whitespace...
+ */
+
+ if (mxml_isspace(ch))
+ continue;
+
+ /*
+ * Stop at /, ?, or >...
+ */
+
+ if (ch == '/' || ch == '?')
+ {
+ /*
+ * Grab the > character and print an error if it isn't there...
+ */
+
+ quote = (*getc_cb)(p, encoding);
+
+ if (quote != '>')
+ {
+ mxml_error("Expected '>' after '%c' for element %s, but got '%c'!",
+ ch, node->value.element.name, quote);
+ goto error;
+ }
+
+ break;
+ }
+ else if (ch == '<')
+ {
+ mxml_error("Bare < in element %s!", node->value.element.name);
+ goto error;
+ }
+ else if (ch == '>')
+ break;
+
+ /*
+ * Read the attribute name...
+ */
+
+ name[0] = ch;
+ ptr = name + 1;
+
+ if (ch == '\"' || ch == '\'')
+ {
+ /*
+ * Name is in quotes, so get a quoted string...
+ */
+
+ quote = ch;
+
+ while ((ch = (*getc_cb)(p, encoding)) != EOF)
+ {
+ if (ch == '&')
+ if ((ch = mxml_get_entity(node, p, encoding, getc_cb)) == EOF)
+ goto error;
+
+ if (mxml_add_char(ch, &ptr, &name, &namesize))
+ goto error;
+
+ if (ch == quote)
+ break;
+ }
+ }
+ else
+ {
+ /*
+ * Grab an normal, non-quoted name...
+ */
+
+ while ((ch = (*getc_cb)(p, encoding)) != EOF)
+ if (mxml_isspace(ch) || ch == '=' || ch == '/' || ch == '>' ||
+ ch == '?')
+ break;
+ else
+ {
+ if (ch == '&')
+ if ((ch = mxml_get_entity(node, p, encoding, getc_cb)) == EOF)
+ goto error;
+
+ if (mxml_add_char(ch, &ptr, &name, &namesize))
+ goto error;
+ }
+ }
+
+ *ptr = '\0';
+
+ if (mxmlElementGetAttr(node, name))
+ goto error;
+
+ while (ch != EOF && mxml_isspace(ch))
+ ch = (*getc_cb)(p, encoding);
+
+ if (ch == '=')
+ {
+ /*
+ * Read the attribute value...
+ */
+
+ while ((ch = (*getc_cb)(p, encoding)) != EOF && mxml_isspace(ch));
+
+ if (ch == EOF)
+ {
+ mxml_error("Missing value for attribute '%s' in element %s!",
+ name, node->value.element.name);
+ goto error;
+ }
+
+ if (ch == '\'' || ch == '\"')
+ {
+ /*
+ * Read quoted value...
+ */
+
+ quote = ch;
+ ptr = value;
+
+ while ((ch = (*getc_cb)(p, encoding)) != EOF)
+ if (ch == quote)
+ break;
+ else
+ {
+ if (ch == '&')
+ if ((ch = mxml_get_entity(node, p, encoding, getc_cb)) == EOF)
+ goto error;
+
+ if (mxml_add_char(ch, &ptr, &value, &valsize))
+ goto error;
+ }
+
+ *ptr = '\0';
+ }
+ else
+ {
+ /*
+ * Read unquoted value...
+ */
+
+ value[0] = ch;
+ ptr = value + 1;
+
+ while ((ch = (*getc_cb)(p, encoding)) != EOF)
+ if (mxml_isspace(ch) || ch == '=' || ch == '/' || ch == '>')
+ break;
+ else
+ {
+ if (ch == '&')
+ if ((ch = mxml_get_entity(node, p, encoding, getc_cb)) == EOF)
+ goto error;
+
+ if (mxml_add_char(ch, &ptr, &value, &valsize))
+ goto error;
+ }
+
+ *ptr = '\0';
+ }
+
+ /*
+ * Set the attribute with the given string value...
+ */
+
+ mxmlElementSetAttr(node, name, value);
+ }
+ else
+ {
+ mxml_error("Missing value for attribute '%s' in element %s!",
+ name, node->value.element.name);
+ goto error;
+ }
+
+ /*
+ * Check the end character...
+ */
+
+ if (ch == '/' || ch == '?')
+ {
+ /*
+ * Grab the > character and print an error if it isn't there...
+ */
+
+ quote = (*getc_cb)(p, encoding);
+
+ if (quote != '>')
+ {
+ mxml_error("Expected '>' after '%c' for element %s, but got '%c'!",
+ ch, node->value.element.name, quote);
+ ch = EOF;
+ }
+
+ break;
+ }
+ else if (ch == '>')
+ break;
+ }
+
+ /*
+ * Free the name and value buffers and return...
+ */
+
+ free(name);
+ free(value);
+
+ return (ch);
+
+ /*
+ * Common error return point...
+ */
+
+error:
+
+ free(name);
+ free(value);
+
+ return (EOF);
+}
+
+
+/*
+ * 'mxml_string_getc()' - Get a character from a string.
+ */
+
+static int /* O - Character or EOF */
+mxml_string_getc(void *p, /* I - Pointer to file */
+ int *encoding) /* IO - Encoding */
+{
+ int ch; /* Character */
+ const char **s; /* Pointer to string pointer */
+
+
+ s = (const char **)p;
+
+ if ((ch = (*s)[0] & 255) != 0 || *encoding == ENCODE_UTF16LE)
+ {
+ /*
+ * Got character; convert UTF-8 to integer and return...
+ */
+
+ (*s)++;
+
+ switch (*encoding)
+ {
+ case ENCODE_UTF8 :
+ if (!(ch & 0x80))
+ {
+#if DEBUG > 1
+ printf("mxml_string_getc: %c (0x%04x)\n", ch < ' ' ? '.' : ch, ch);
+#endif /* DEBUG > 1 */
+
+ if (mxml_bad_char(ch))
+ {
+ mxml_error("Bad control character 0x%02x not allowed by XML standard!",
+ ch);
+ return (EOF);
+ }
+
+ return (ch);
+ }
+ else if (ch == 0xfe)
+ {
+ /*
+ * UTF-16 big-endian BOM?
+ */
+
+ if (((*s)[0] & 255) != 0xff)
+ return (EOF);
+
+ *encoding = ENCODE_UTF16BE;
+ (*s)++;
+
+ return (mxml_string_getc(p, encoding));
+ }
+ else if (ch == 0xff)
+ {
+ /*
+ * UTF-16 little-endian BOM?
+ */
+
+ if (((*s)[0] & 255) != 0xfe)
+ return (EOF);
+
+ *encoding = ENCODE_UTF16LE;
+ (*s)++;
+
+ return (mxml_string_getc(p, encoding));
+ }
+ else if ((ch & 0xe0) == 0xc0)
+ {
+ /*
+ * Two-byte value...
+ */
+
+ if (((*s)[0] & 0xc0) != 0x80)
+ return (EOF);
+
+ ch = ((ch & 0x1f) << 6) | ((*s)[0] & 0x3f);
+
+ (*s)++;
+
+ if (ch < 0x80)
+ {
+ mxml_error("Invalid UTF-8 sequence for character 0x%04x!", ch);
+ return (EOF);
+ }
+
+#if DEBUG > 1
+ printf("mxml_string_getc: %c (0x%04x)\n", ch < ' ' ? '.' : ch, ch);
+#endif /* DEBUG > 1 */
+
+ return (ch);
+ }
+ else if ((ch & 0xf0) == 0xe0)
+ {
+ /*
+ * Three-byte value...
+ */
+
+ if (((*s)[0] & 0xc0) != 0x80 ||
+ ((*s)[1] & 0xc0) != 0x80)
+ return (EOF);
+
+ ch = ((((ch & 0x0f) << 6) | ((*s)[0] & 0x3f)) << 6) | ((*s)[1] & 0x3f);
+
+ (*s) += 2;
+
+ if (ch < 0x800)
+ {
+ mxml_error("Invalid UTF-8 sequence for character 0x%04x!", ch);
+ return (EOF);
+ }
+
+ /*
+ * Ignore (strip) Byte Order Mark (BOM)...
+ */
+
+ if (ch == 0xfeff)
+ return (mxml_string_getc(p, encoding));
+
+#if DEBUG > 1
+ printf("mxml_string_getc: %c (0x%04x)\n", ch < ' ' ? '.' : ch, ch);
+#endif /* DEBUG > 1 */
+
+ return (ch);
+ }
+ else if ((ch & 0xf8) == 0xf0)
+ {
+ /*
+ * Four-byte value...
+ */
+
+ if (((*s)[0] & 0xc0) != 0x80 ||
+ ((*s)[1] & 0xc0) != 0x80 ||
+ ((*s)[2] & 0xc0) != 0x80)
+ return (EOF);
+
+ ch = ((((((ch & 0x07) << 6) | ((*s)[0] & 0x3f)) << 6) |
+ ((*s)[1] & 0x3f)) << 6) | ((*s)[2] & 0x3f);
+
+ (*s) += 3;
+
+ if (ch < 0x10000)
+ {
+ mxml_error("Invalid UTF-8 sequence for character 0x%04x!", ch);
+ return (EOF);
+ }
+
+#if DEBUG > 1
+ printf("mxml_string_getc: %c (0x%04x)\n", ch < ' ' ? '.' : ch, ch);
+#endif /* DEBUG > 1 */
+
+ return (ch);
+ }
+ else
+ return (EOF);
+
+ case ENCODE_UTF16BE :
+ /*
+ * Read UTF-16 big-endian char...
+ */
+
+ ch = (ch << 8) | ((*s)[0] & 255);
+ (*s) ++;
+
+ if (mxml_bad_char(ch))
+ {
+ mxml_error("Bad control character 0x%02x not allowed by XML standard!",
+ ch);
+ return (EOF);
+ }
+ else if (ch >= 0xd800 && ch <= 0xdbff)
+ {
+ /*
+ * Multi-word UTF-16 char...
+ */
+
+ int lch; /* Lower word */
+
+
+ if (!(*s)[0])
+ return (EOF);
+
+ lch = (((*s)[0] & 255) << 8) | ((*s)[1] & 255);
+ (*s) += 2;
+
+ if (lch < 0xdc00 || lch >= 0xdfff)
+ return (EOF);
+
+ ch = (((ch & 0x3ff) << 10) | (lch & 0x3ff)) + 0x10000;
+ }
+
+#if DEBUG > 1
+ printf("mxml_string_getc: %c (0x%04x)\n", ch < ' ' ? '.' : ch, ch);
+#endif /* DEBUG > 1 */
+
+ return (ch);
+
+ case ENCODE_UTF16LE :
+ /*
+ * Read UTF-16 little-endian char...
+ */
+
+ ch = ch | (((*s)[0] & 255) << 8);
+
+ if (!ch)
+ {
+ (*s) --;
+ return (EOF);
+ }
+
+ (*s) ++;
+
+ if (mxml_bad_char(ch))
+ {
+ mxml_error("Bad control character 0x%02x not allowed by XML standard!",
+ ch);
+ return (EOF);
+ }
+ else if (ch >= 0xd800 && ch <= 0xdbff)
+ {
+ /*
+ * Multi-word UTF-16 char...
+ */
+
+ int lch; /* Lower word */
+
+
+ if (!(*s)[1])
+ return (EOF);
+
+ lch = (((*s)[1] & 255) << 8) | ((*s)[0] & 255);
+ (*s) += 2;
+
+ if (lch < 0xdc00 || lch >= 0xdfff)
+ return (EOF);
+
+ ch = (((ch & 0x3ff) << 10) | (lch & 0x3ff)) + 0x10000;
+ }
+
+#if DEBUG > 1
+ printf("mxml_string_getc: %c (0x%04x)\n", ch < ' ' ? '.' : ch, ch);
+#endif /* DEBUG > 1 */
+
+ return (ch);
+ }
+ }
+
+ return (EOF);
+}
+
+
+/*
+ * 'mxml_string_putc()' - Write a character to a string.
+ */
+
+static int /* O - 0 on success, -1 on failure */
+mxml_string_putc(int ch, /* I - Character to write */
+ void *p) /* I - Pointer to string pointers */
+{
+ char **pp; /* Pointer to string pointers */
+
+
+ pp = (char **)p;
+
+ if (pp[0] < pp[1])
+ pp[0][0] = ch;
+
+ pp[0] ++;
+
+ return (0);
+}
+
+
+/*
+ * 'mxml_write_name()' - Write a name string.
+ */
+
+static int /* O - 0 on success, -1 on failure */
+mxml_write_name(const char *s, /* I - Name to write */
+ void *p, /* I - Write pointer */
+ int (*putc_cb)(int, void *))
+ /* I - Write callback */
+{
+ char quote; /* Quote character */
+ const char *name; /* Entity name */
+
+
+ if (*s == '\"' || *s == '\'')
+ {
+ /*
+ * Write a quoted name string...
+ */
+
+ if ((*putc_cb)(*s, p) < 0)
+ return (-1);
+
+ quote = *s++;
+
+ while (*s && *s != quote)
+ {
+ if ((name = mxmlEntityGetName(*s)) != NULL)
+ {
+ if ((*putc_cb)('&', p) < 0)
+ return (-1);
+
+ while (*name)
+ {
+ if ((*putc_cb)(*name, p) < 0)
+ return (-1);
+
+ name ++;
+ }
+
+ if ((*putc_cb)(';', p) < 0)
+ return (-1);
+ }
+ else if ((*putc_cb)(*s, p) < 0)
+ return (-1);
+
+ s ++;
+ }
+
+ /*
+ * Write the end quote...
+ */
+
+ if ((*putc_cb)(quote, p) < 0)
+ return (-1);
+ }
+ else
+ {
+ /*
+ * Write a non-quoted name string...
+ */
+
+ while (*s)
+ {
+ if ((*putc_cb)(*s, p) < 0)
+ return (-1);
+
+ s ++;
+ }
+ }
+
+ return (0);
+}
+
+
+/*
+ * 'mxml_write_node()' - Save an XML node to a file.
+ */
+
+static int /* O - Column or -1 on error */
+mxml_write_node(mxml_node_t *node, /* I - Node to write */
+ void *p, /* I - File to write to */
+ mxml_save_cb_t cb, /* I - Whitespace callback */
+ int col, /* I - Current column */
+ _mxml_putc_cb_t putc_cb,/* I - Output callback */
+ _mxml_global_t *global)/* I - Global data */
+{
+ int i, /* Looping var */
+ width; /* Width of attr + value */
+ mxml_attr_t *attr; /* Current attribute */
+ char s[255]; /* Temporary string */
+
+
+ while (node != NULL)
+ {
+ /*
+ * Print the node value...
+ */
+
+ switch (node->type)
+ {
+ case MXML_ELEMENT :
+ col = mxml_write_ws(node, p, cb, MXML_WS_BEFORE_OPEN, col, putc_cb);
+
+ if ((*putc_cb)('<', p) < 0)
+ return (-1);
+ if (node->value.element.name[0] == '?' ||
+ !strncmp(node->value.element.name, "!--", 3) ||
+ !strncmp(node->value.element.name, "![CDATA[", 8))
+ {
+ /*
+ * Comments, CDATA, and processing instructions do not
+ * use character entities.
+ */
+
+ const char *ptr; /* Pointer into name */
+
+
+ for (ptr = node->value.element.name; *ptr; ptr ++)
+ if ((*putc_cb)(*ptr, p) < 0)
+ return (-1);
+ }
+ else if (mxml_write_name(node->value.element.name, p, putc_cb) < 0)
+ return (-1);
+
+ col += strlen(node->value.element.name) + 1;
+
+ for (i = node->value.element.num_attrs, attr = node->value.element.attrs;
+ i > 0;
+ i --, attr ++)
+ {
+ width = strlen(attr->name);
+
+ if (attr->value)
+ width += strlen(attr->value) + 3;
+
+ if (global->wrap > 0 && (col + width) > global->wrap)
+ {
+ if ((*putc_cb)('\n', p) < 0)
+ return (-1);
+
+ col = 0;
+ }
+ else
+ {
+ if ((*putc_cb)(' ', p) < 0)
+ return (-1);
+
+ col ++;
+ }
+
+ if (mxml_write_name(attr->name, p, putc_cb) < 0)
+ return (-1);
+
+ if (attr->value)
+ {
+ if ((*putc_cb)('=', p) < 0)
+ return (-1);
+ if ((*putc_cb)('\"', p) < 0)
+ return (-1);
+ if (mxml_write_string(attr->value, p, putc_cb) < 0)
+ return (-1);
+ if ((*putc_cb)('\"', p) < 0)
+ return (-1);
+ }
+
+ col += width;
+ }
+
+ if (node->child)
+ {
+ /*
+ * Write children...
+ */
+
+ if ((*putc_cb)('>', p) < 0)
+ return (-1);
+ else
+ col ++;
+
+ col = mxml_write_ws(node, p, cb, MXML_WS_AFTER_OPEN, col, putc_cb);
+
+ if ((col = mxml_write_node(node->child, p, cb, col, putc_cb,
+ global)) < 0)
+ return (-1);
+
+ /*
+ * The ? and ! elements are special-cases and have no end tags...
+ */
+
+ if (node->value.element.name[0] != '!' &&
+ node->value.element.name[0] != '?')
+ {
+ col = mxml_write_ws(node, p, cb, MXML_WS_BEFORE_CLOSE, col, putc_cb);
+
+ if ((*putc_cb)('<', p) < 0)
+ return (-1);
+ if ((*putc_cb)('/', p) < 0)
+ return (-1);
+ if (mxml_write_string(node->value.element.name, p, putc_cb) < 0)
+ return (-1);
+ if ((*putc_cb)('>', p) < 0)
+ return (-1);
+
+ col += strlen(node->value.element.name) + 3;
+
+ col = mxml_write_ws(node, p, cb, MXML_WS_AFTER_CLOSE, col, putc_cb);
+ }
+ }
+ else if (node->value.element.name[0] == '!' ||
+ node->value.element.name[0] == '?')
+ {
+ /*
+ * The ? and ! elements are special-cases...
+ */
+
+ if ((*putc_cb)('>', p) < 0)
+ return (-1);
+ else
+ col ++;
+
+ col = mxml_write_ws(node, p, cb, MXML_WS_AFTER_OPEN, col, putc_cb);
+ }
+ else
+ {
+ if ((*putc_cb)(' ', p) < 0)
+ return (-1);
+ if ((*putc_cb)('/', p) < 0)
+ return (-1);
+ if ((*putc_cb)('>', p) < 0)
+ return (-1);
+
+ col += 3;
+
+ col = mxml_write_ws(node, p, cb, MXML_WS_AFTER_OPEN, col, putc_cb);
+ }
+ break;
+
+ case MXML_INTEGER :
+ if (node->prev)
+ {
+ if (global->wrap > 0 && col > global->wrap)
+ {
+ if ((*putc_cb)('\n', p) < 0)
+ return (-1);
+
+ col = 0;
+ }
+ else if ((*putc_cb)(' ', p) < 0)
+ return (-1);
+ else
+ col ++;
+ }
+
+ sprintf(s, "%d", node->value.integer);
+ if (mxml_write_string(s, p, putc_cb) < 0)
+ return (-1);
+
+ col += strlen(s);
+ break;
+
+ case MXML_OPAQUE :
+ if (mxml_write_string(node->value.opaque, p, putc_cb) < 0)
+ return (-1);
+
+ col += strlen(node->value.opaque);
+ break;
+
+ case MXML_REAL :
+ if (node->prev)
+ {
+ if (global->wrap > 0 && col > global->wrap)
+ {
+ if ((*putc_cb)('\n', p) < 0)
+ return (-1);
+
+ col = 0;
+ }
+ else if ((*putc_cb)(' ', p) < 0)
+ return (-1);
+ else
+ col ++;
+ }
+
+ sprintf(s, "%f", node->value.real);
+ if (mxml_write_string(s, p, putc_cb) < 0)
+ return (-1);
+
+ col += strlen(s);
+ break;
+
+ case MXML_TEXT :
+ if (node->value.text.whitespace && col > 0)
+ {
+ if (global->wrap > 0 && col > global->wrap)
+ {
+ if ((*putc_cb)('\n', p) < 0)
+ return (-1);
+
+ col = 0;
+ }
+ else if ((*putc_cb)(' ', p) < 0)
+ return (-1);
+ else
+ col ++;
+ }
+
+ if (mxml_write_string(node->value.text.string, p, putc_cb) < 0)
+ return (-1);
+
+ col += strlen(node->value.text.string);
+ break;
+
+ case MXML_CUSTOM :
+ if (global->custom_save_cb)
+ {
+ char *data; /* Custom data string */
+ const char *newline; /* Last newline in string */
+
+
+ if ((data = (*global->custom_save_cb)(node)) == NULL)
+ return (-1);
+
+ if (mxml_write_string(data, p, putc_cb) < 0)
+ return (-1);
+
+ if ((newline = strrchr(data, '\n')) == NULL)
+ col += strlen(data);
+ else
+ col = strlen(newline);
+
+ free(data);
+ break;
+ }
+
+ default : /* Should never happen */
+ return (-1);
+ }
+
+ /*
+ * Next node...
+ */
+
+ node = node->next;
+ }
+
+ return (col);
+}
+
+
+/*
+ * 'mxml_write_string()' - Write a string, escaping & and < as needed.
+ */
+
+static int /* O - 0 on success, -1 on failure */
+mxml_write_string(
+ const char *s, /* I - String to write */
+ void *p, /* I - Write pointer */
+ _mxml_putc_cb_t putc_cb) /* I - Write callback */
+{
+ const char *name; /* Entity name, if any */
+
+
+ while (*s)
+ {
+ if ((name = mxmlEntityGetName(*s)) != NULL)
+ {
+ if ((*putc_cb)('&', p) < 0)
+ return (-1);
+
+ while (*name)
+ {
+ if ((*putc_cb)(*name, p) < 0)
+ return (-1);
+ name ++;
+ }
+
+ if ((*putc_cb)(';', p) < 0)
+ return (-1);
+ }
+ else if ((*putc_cb)(*s, p) < 0)
+ return (-1);
+
+ s ++;
+ }
+
+ return (0);
+}
+
+
+/*
+ * 'mxml_write_ws()' - Do whitespace callback...
+ */
+
+static int /* O - New column */
+mxml_write_ws(mxml_node_t *node, /* I - Current node */
+ void *p, /* I - Write pointer */
+ mxml_save_cb_t cb, /* I - Callback function */
+ int ws, /* I - Where value */
+ int col, /* I - Current column */
+ _mxml_putc_cb_t putc_cb) /* I - Write callback */
+{
+ const char *s; /* Whitespace string */
+
+
+ if (cb && (s = (*cb)(node, ws)) != NULL)
+ {
+ while (*s)
+ {
+ if ((*putc_cb)(*s, p) < 0)
+ return (-1);
+ else if (*s == '\n')
+ col = 0;
+ else if (*s == '\t')
+ {
+ col += MXML_TAB;
+ col = col - (col % MXML_TAB);
+ }
+ else
+ col ++;
+
+ s ++;
+ }
+ }
+
+ return (col);
+}
+
+
+/*
+ * End of "$Id: mxml-file.c 391 2009-05-17 05:20:52Z mike $".
+ */
diff -Naur mxml-2.6/mxml-index.c mxml-2.6-haiku/mxml-index.c
--- mxml-2.6/mxml-index.c 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/mxml-index.c 2005-01-29 07:21:44.000000000 +0000
@@ -0,0 +1,649 @@
+/*
+ * "$Id: mxml-index.c 184 2005-01-29 07:21:44Z mike $"
+ *
+ * Index support code for Mini-XML, a small XML-like file parsing library.
+ *
+ * Copyright 2003-2005 by Michael Sweet.
+ *
+ * This program is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU Library General Public
+ * License as published by the Free Software Foundation; either
+ * version 2, or (at your option) any later version.
+ *
+ * This program is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+ * GNU General Public License for more details.
+ *
+ * Contents:
+ *
+ * mxmlIndexDelete() - Delete an index.
+ * mxmlIndexEnum() - Return the next node in the index.
+ * mxmlIndexFind() - Find the next matching node.
+ * mxmlIndexNew() - Create a new index.
+ * mxmlIndexReset() - Reset the enumeration/find pointer in the index and
+ * return the first node in the index.
+ * index_compare() - Compare two nodes.
+ * index_find() - Compare a node with index values.
+ * index_sort() - Sort the nodes in the index...
+ */
+
+/*
+ * Include necessary headers...
+ */
+
+#include "config.h"
+#include "mxml.h"
+
+
+/*
+ * Sort functions...
+ */
+
+static int index_compare(mxml_index_t *ind, mxml_node_t *first,
+ mxml_node_t *second);
+static int index_find(mxml_index_t *ind, const char *element,
+ const char *value, mxml_node_t *node);
+static void index_sort(mxml_index_t *ind, int left, int right);
+
+
+/*
+ * 'mxmlIndexDelete()' - Delete an index.
+ */
+
+void
+mxmlIndexDelete(mxml_index_t *ind) /* I - Index to delete */
+{
+ /*
+ * Range check input..
+ */
+
+ if (!ind)
+ return;
+
+ /*
+ * Free memory...
+ */
+
+ if (ind->attr)
+ free(ind->attr);
+
+ if (ind->alloc_nodes)
+ free(ind->nodes);
+
+ free(ind);
+}
+
+
+/*
+ * 'mxmlIndexEnum()' - Return the next node in the index.
+ *
+ * Nodes are returned in the sorted order of the index.
+ */
+
+mxml_node_t * /* O - Next node or NULL if there is none */
+mxmlIndexEnum(mxml_index_t *ind) /* I - Index to enumerate */
+{
+ /*
+ * Range check input...
+ */
+
+ if (!ind)
+ return (NULL);
+
+ /*
+ * Return the next node...
+ */
+
+ if (ind->cur_node < ind->num_nodes)
+ return (ind->nodes[ind->cur_node ++]);
+ else
+ return (NULL);
+}
+
+
+/*
+ * 'mxmlIndexFind()' - Find the next matching node.
+ *
+ * You should call mxmlIndexReset() prior to using this function for
+ * the first time with a particular set of "element" and "value"
+ * strings. Passing NULL for both "element" and "value" is equivalent
+ * to calling mxmlIndexEnum().
+ */
+
+mxml_node_t * /* O - Node or NULL if none found */
+mxmlIndexFind(mxml_index_t *ind, /* I - Index to search */
+ const char *element, /* I - Element name to find, if any */
+ const char *value) /* I - Attribute value, if any */
+{
+ int diff, /* Difference between names */
+ current, /* Current entity in search */
+ first, /* First entity in search */
+ last; /* Last entity in search */
+
+
+#ifdef DEBUG
+ printf("mxmlIndexFind(ind=%p, element=\"%s\", value=\"%s\")\n",
+ ind, element ? element : "(null)", value ? value : "(null)");
+#endif /* DEBUG */
+
+ /*
+ * Range check input...
+ */
+
+ if (!ind || (!ind->attr && value))
+ {
+#ifdef DEBUG
+ puts(" returning NULL...");
+ printf(" ind->attr=\"%s\"\n", ind->attr ? ind->attr : "(null)");
+#endif /* DEBUG */
+
+ return (NULL);
+ }
+
+ /*
+ * If both element and value are NULL, just enumerate the nodes in the
+ * index...
+ */
+
+ if (!element && !value)
+ return (mxmlIndexEnum(ind));
+
+ /*
+ * If there are no nodes in the index, return NULL...
+ */
+
+ if (!ind->num_nodes)
+ {
+#ifdef DEBUG
+ puts(" returning NULL...");
+ puts(" no nodes!");
+#endif /* DEBUG */
+
+ return (NULL);
+ }
+
+ /*
+ * If cur_node == 0, then find the first matching node...
+ */
+
+ if (ind->cur_node == 0)
+ {
+ /*
+ * Find the first node using a modified binary search algorithm...
+ */
+
+ first = 0;
+ last = ind->num_nodes - 1;
+
+#ifdef DEBUG
+ printf(" find first time, num_nodes=%d...\n", ind->num_nodes);
+#endif /* DEBUG */
+
+ while ((last - first) > 1)
+ {
+ current = (first + last) / 2;
+
+#ifdef DEBUG
+ printf(" first=%d, last=%d, current=%d\n", first, last, current);
+#endif /* DEBUG */
+
+ if ((diff = index_find(ind, element, value, ind->nodes[current])) == 0)
+ {
+ /*
+ * Found a match, move back to find the first...
+ */
+
+#ifdef DEBUG
+ puts(" match!");
+#endif /* DEBUG */
+
+ while (current > 0 &&
+ !index_find(ind, element, value, ind->nodes[current - 1]))
+ current --;
+
+#ifdef DEBUG
+ printf(" returning first match=%d\n", current);
+#endif /* DEBUG */
+
+ /*
+ * Return the first match and save the index to the next...
+ */
+
+ ind->cur_node = current + 1;
+
+ return (ind->nodes[current]);
+ }
+ else if (diff < 0)
+ last = current;
+ else
+ first = current;
+
+#ifdef DEBUG
+ printf(" diff=%d\n", diff);
+#endif /* DEBUG */
+ }
+
+ /*
+ * If we get this far, then we found exactly 0 or 1 matches...
+ */
+
+ for (current = first; current <= last; current ++)
+ if (!index_find(ind, element, value, ind->nodes[current]))
+ {
+ /*
+ * Found exactly one (or possibly two) match...
+ */
+
+#ifdef DEBUG
+ printf(" returning only match %d...\n", current);
+#endif /* DEBUG */
+
+ ind->cur_node = current + 1;
+
+ return (ind->nodes[current]);
+ }
+
+ /*
+ * No matches...
+ */
+
+ ind->cur_node = ind->num_nodes;
+
+#ifdef DEBUG
+ puts(" returning NULL...");
+#endif /* DEBUG */
+
+ return (NULL);
+ }
+ else if (ind->cur_node < ind->num_nodes &&
+ !index_find(ind, element, value, ind->nodes[ind->cur_node]))
+ {
+ /*
+ * Return the next matching node...
+ */
+
+#ifdef DEBUG
+ printf(" returning next match %d...\n", ind->cur_node);
+#endif /* DEBUG */
+
+ return (ind->nodes[ind->cur_node ++]);
+ }
+
+ /*
+ * If we get this far, then we have no matches...
+ */
+
+ ind->cur_node = ind->num_nodes;
+
+#ifdef DEBUG
+ puts(" returning NULL...");
+#endif /* DEBUG */
+
+ return (NULL);
+}
+
+
+/*
+ * 'mxmlIndexNew()' - Create a new index.
+ *
+ * The index will contain all nodes that contain the named element and/or
+ * attribute. If both "element" and "attr" are NULL, then the index will
+ * contain a sorted list of the elements in the node tree. Nodes are
+ * sorted by element name and optionally by attribute value if the "attr"
+ * argument is not NULL.
+ */
+
+mxml_index_t * /* O - New index */
+mxmlIndexNew(mxml_node_t *node, /* I - XML node tree */
+ const char *element, /* I - Element to index or NULL for all */
+ const char *attr) /* I - Attribute to index or NULL for none */
+{
+ mxml_index_t *ind; /* New index */
+ mxml_node_t *current, /* Current node in index */
+ **temp; /* Temporary node pointer array */
+
+
+ /*
+ * Range check input...
+ */
+
+#ifdef DEBUG
+ printf("mxmlIndexNew(node=%p, element=\"%s\", attr=\"%s\")\n",
+ node, element ? element : "(null)", attr ? attr : "(null)");
+#endif /* DEBUG */
+
+ if (!node)
+ return (NULL);
+
+ /*
+ * Create a new index...
+ */
+
+ if ((ind = calloc(1, sizeof(mxml_index_t))) == NULL)
+ {
+ mxml_error("Unable to allocate %d bytes for index - %s",
+ sizeof(mxml_index_t), strerror(errno));
+ return (NULL);
+ }
+
+ if (attr)
+ ind->attr = strdup(attr);
+
+ if (!element && !attr)
+ current = node;
+ else
+ current = mxmlFindElement(node, node, element, attr, NULL, MXML_DESCEND);
+
+ while (current)
+ {
+ if (ind->num_nodes >= ind->alloc_nodes)
+ {
+ if (!ind->alloc_nodes)
+ temp = malloc(64 * sizeof(mxml_node_t *));
+ else
+ temp = realloc(ind->nodes, (ind->alloc_nodes + 64) * sizeof(mxml_node_t *));
+
+ if (!temp)
+ {
+ /*
+ * Unable to allocate memory for the index, so abort...
+ */
+
+ mxml_error("Unable to allocate %d bytes for index: %s",
+ (ind->alloc_nodes + 64) * sizeof(mxml_node_t *),
+ strerror(errno));
+
+ mxmlIndexDelete(ind);
+ return (NULL);
+ }
+
+ ind->nodes = temp;
+ ind->alloc_nodes += 64;
+ }
+
+ ind->nodes[ind->num_nodes ++] = current;
+
+ current = mxmlFindElement(current, node, element, attr, NULL, MXML_DESCEND);
+ }
+
+ /*
+ * Sort nodes based upon the search criteria...
+ */
+
+#ifdef DEBUG
+ {
+ int i; /* Looping var */
+
+
+ printf("%d node(s) in index.\n\n", ind->num_nodes);
+
+ if (attr)
+ {
+ printf("Node Address Element %s\n", attr);
+ puts("-------- -------- -------------- ------------------------------");
+
+ for (i = 0; i < ind->num_nodes; i ++)
+ printf("%8d %-8p %-14.14s %s\n", i, ind->nodes[i],
+ ind->nodes[i]->value.element.name,
+ mxmlElementGetAttr(ind->nodes[i], attr));
+ }
+ else
+ {
+ puts("Node Address Element");
+ puts("-------- -------- --------------");
+
+ for (i = 0; i < ind->num_nodes; i ++)
+ printf("%8d %-8p %s\n", i, ind->nodes[i],
+ ind->nodes[i]->value.element.name);
+ }
+
+ putchar('\n');
+ }
+#endif /* DEBUG */
+
+ if (ind->num_nodes > 1)
+ index_sort(ind, 0, ind->num_nodes - 1);
+
+#ifdef DEBUG
+ {
+ int i; /* Looping var */
+
+
+ puts("After sorting:\n");
+
+ if (attr)
+ {
+ printf("Node Address Element %s\n", attr);
+ puts("-------- -------- -------------- ------------------------------");
+
+ for (i = 0; i < ind->num_nodes; i ++)
+ printf("%8d %-8p %-14.14s %s\n", i, ind->nodes[i],
+ ind->nodes[i]->value.element.name,
+ mxmlElementGetAttr(ind->nodes[i], attr));
+ }
+ else
+ {
+ puts("Node Address Element");
+ puts("-------- -------- --------------");
+
+ for (i = 0; i < ind->num_nodes; i ++)
+ printf("%8d %-8p %s\n", i, ind->nodes[i],
+ ind->nodes[i]->value.element.name);
+ }
+
+ putchar('\n');
+ }
+#endif /* DEBUG */
+
+ /*
+ * Return the new index...
+ */
+
+ return (ind);
+}
+
+
+/*
+ * 'mxmlIndexReset()' - Reset the enumeration/find pointer in the index and
+ * return the first node in the index.
+ *
+ * This function should be called prior to using mxmlIndexEnum() or
+ * mxmlIndexFind() for the first time.
+ */
+
+mxml_node_t * /* O - First node or NULL if there is none */
+mxmlIndexReset(mxml_index_t *ind) /* I - Index to reset */
+{
+#ifdef DEBUG
+ printf("mxmlIndexReset(ind=%p)\n", ind);
+#endif /* DEBUG */
+
+ /*
+ * Range check input...
+ */
+
+ if (!ind)
+ return (NULL);
+
+ /*
+ * Set the index to the first element...
+ */
+
+ ind->cur_node = 0;
+
+ /*
+ * Return the first node...
+ */
+
+ if (ind->num_nodes)
+ return (ind->nodes[0]);
+ else
+ return (NULL);
+}
+
+
+/*
+ * 'index_compare()' - Compare two nodes.
+ */
+
+static int /* O - Result of comparison */
+index_compare(mxml_index_t *ind, /* I - Index */
+ mxml_node_t *first, /* I - First node */
+ mxml_node_t *second) /* I - Second node */
+{
+ int diff; /* Difference */
+
+
+ /*
+ * Check the element name...
+ */
+
+ if ((diff = strcmp(first->value.element.name,
+ second->value.element.name)) != 0)
+ return (diff);
+
+ /*
+ * Check the attribute value...
+ */
+
+ if (ind->attr)
+ {
+ if ((diff = strcmp(mxmlElementGetAttr(first, ind->attr),
+ mxmlElementGetAttr(second, ind->attr))) != 0)
+ return (diff);
+ }
+
+ /*
+ * No difference, return 0...
+ */
+
+ return (0);
+}
+
+
+/*
+ * 'index_find()' - Compare a node with index values.
+ */
+
+static int /* O - Result of comparison */
+index_find(mxml_index_t *ind, /* I - Index */
+ const char *element, /* I - Element name or NULL */
+ const char *value, /* I - Attribute value or NULL */
+ mxml_node_t *node) /* I - Node */
+{
+ int diff; /* Difference */
+
+
+ /*
+ * Check the element name...
+ */
+
+ if (element)
+ {
+ if ((diff = strcmp(element, node->value.element.name)) != 0)
+ return (diff);
+ }
+
+ /*
+ * Check the attribute value...
+ */
+
+ if (value)
+ {
+ if ((diff = strcmp(value, mxmlElementGetAttr(node, ind->attr))) != 0)
+ return (diff);
+ }
+
+ /*
+ * No difference, return 0...
+ */
+
+ return (0);
+}
+
+
+/*
+ * 'index_sort()' - Sort the nodes in the index...
+ *
+ * This function implements the classic quicksort algorithm...
+ */
+
+static void
+index_sort(mxml_index_t *ind, /* I - Index to sort */
+ int left, /* I - Left node in partition */
+ int right) /* I - Right node in partition */
+{
+ mxml_node_t *pivot, /* Pivot node */
+ *temp; /* Swap node */
+ int templ, /* Temporary left node */
+ tempr; /* Temporary right node */
+
+
+ /*
+ * Loop until we have sorted all the way to the right...
+ */
+
+ do
+ {
+ /*
+ * Sort the pivot in the current partition...
+ */
+
+ pivot = ind->nodes[left];
+
+ for (templ = left, tempr = right; templ < tempr;)
+ {
+ /*
+ * Move left while left node <= pivot node...
+ */
+
+ while ((templ < right) &&
+ index_compare(ind, ind->nodes[templ], pivot) <= 0)
+ templ ++;
+
+ /*
+ * Move right while right node > pivot node...
+ */
+
+ while ((tempr > left) &&
+ index_compare(ind, ind->nodes[tempr], pivot) > 0)
+ tempr --;
+
+ /*
+ * Swap nodes if needed...
+ */
+
+ if (templ < tempr)
+ {
+ temp = ind->nodes[templ];
+ ind->nodes[templ] = ind->nodes[tempr];
+ ind->nodes[tempr] = temp;
+ }
+ }
+
+ /*
+ * When we get here, the right (tempr) node is the new position for the
+ * pivot node...
+ */
+
+ if (index_compare(ind, pivot, ind->nodes[tempr]) > 0)
+ {
+ ind->nodes[left] = ind->nodes[tempr];
+ ind->nodes[tempr] = pivot;
+ }
+
+ /*
+ * Recursively sort the left partition as needed...
+ */
+
+ if (left < (tempr - 1))
+ index_sort(ind, left, tempr - 1);
+ }
+ while (right > (left = tempr + 1));
+}
+
+
+/*
+ * End of "$Id: mxml-index.c 184 2005-01-29 07:21:44Z mike $".
+ */
diff -Naur mxml-2.6/mxml-node.c mxml-2.6-haiku/mxml-node.c
--- mxml-2.6/mxml-node.c 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/mxml-node.c 2008-10-26 18:28:05.000000000 +0000
@@ -0,0 +1,780 @@
+/*
+ * "$Id: mxml-node.c 363 2008-10-26 18:28:05Z mike $"
+ *
+ * Node support code for Mini-XML, a small XML-like file parsing library.
+ *
+ * Copyright 2003-2007 by Michael Sweet.
+ *
+ * This program is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU Library General Public
+ * License as published by the Free Software Foundation; either
+ * version 2, or (at your option) any later version.
+ *
+ * This program is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+ * GNU General Public License for more details.
+ *
+ * Contents:
+ *
+ * mxmlAdd() - Add a node to a tree.
+ * mxmlDelete() - Delete a node and all of its children.
+ * mxmlNewCDATA() - Create a new CDATA node.
+ * mxmlNewCustom() - Create a new custom data node.
+ * mxmlNewElement() - Create a new element node.
+ * mxmlNewInteger() - Create a new integer node.
+ * mxmlNewOpaque() - Create a new opaque string.
+ * mxmlNewReal() - Create a new real number node.
+ * mxmlNewText() - Create a new text fragment node.
+ * mxmlNewTextf() - Create a new formatted text fragment node.
+ * mxmlNewXML() - Create a new XML document tree.
+ * mxmlRelease() - Release a node.
+ * mxmlRemove() - Remove a node from its parent.
+ * mxmlRetain() - Retain a node.
+ * mxml_new() - Create a new node.
+ */
+
+/*
+ * Include necessary headers...
+ */
+
+#include "config.h"
+#include "mxml.h"
+
+
+/*
+ * Local functions...
+ */
+
+static mxml_node_t *mxml_new(mxml_node_t *parent, mxml_type_t type);
+
+
+/*
+ * 'mxmlAdd()' - Add a node to a tree.
+ *
+ * Adds the specified node to the parent. If the child argument is not
+ * NULL, puts the new node before or after the specified child depending
+ * on the value of the where argument. If the child argument is NULL,
+ * puts the new node at the beginning of the child list (MXML_ADD_BEFORE)
+ * or at the end of the child list (MXML_ADD_AFTER). The constant
+ * MXML_ADD_TO_PARENT can be used to specify a NULL child pointer.
+ */
+
+void
+mxmlAdd(mxml_node_t *parent, /* I - Parent node */
+ int where, /* I - Where to add, MXML_ADD_BEFORE or MXML_ADD_AFTER */
+ mxml_node_t *child, /* I - Child node for where or MXML_ADD_TO_PARENT */
+ mxml_node_t *node) /* I - Node to add */
+{
+#ifdef DEBUG
+ fprintf(stderr, "mxmlAdd(parent=%p, where=%d, child=%p, node=%p)\n", parent,
+ where, child, node);
+#endif /* DEBUG */
+
+ /*
+ * Range check input...
+ */
+
+ if (!parent || !node)
+ return;
+
+#if DEBUG > 1
+ fprintf(stderr, " BEFORE: node->parent=%p\n", node->parent);
+ if (parent)
+ {
+ fprintf(stderr, " BEFORE: parent->child=%p\n", parent->child);
+ fprintf(stderr, " BEFORE: parent->last_child=%p\n", parent->last_child);
+ fprintf(stderr, " BEFORE: parent->prev=%p\n", parent->prev);
+ fprintf(stderr, " BEFORE: parent->next=%p\n", parent->next);
+ }
+#endif /* DEBUG > 1 */
+
+ /*
+ * Remove the node from any existing parent...
+ */
+
+ if (node->parent)
+ mxmlRemove(node);
+
+ /*
+ * Reset pointers...
+ */
+
+ node->parent = parent;
+
+ switch (where)
+ {
+ case MXML_ADD_BEFORE :
+ if (!child || child == parent->child || child->parent != parent)
+ {
+ /*
+ * Insert as first node under parent...
+ */
+
+ node->next = parent->child;
+
+ if (parent->child)
+ parent->child->prev = node;
+ else
+ parent->last_child = node;
+
+ parent->child = node;
+ }
+ else
+ {
+ /*
+ * Insert node before this child...
+ */
+
+ node->next = child;
+ node->prev = child->prev;
+
+ if (child->prev)
+ child->prev->next = node;
+ else
+ parent->child = node;
+
+ child->prev = node;
+ }
+ break;
+
+ case MXML_ADD_AFTER :
+ if (!child || child == parent->last_child || child->parent != parent)
+ {
+ /*
+ * Insert as last node under parent...
+ */
+
+ node->parent = parent;
+ node->prev = parent->last_child;
+
+ if (parent->last_child)
+ parent->last_child->next = node;
+ else
+ parent->child = node;
+
+ parent->last_child = node;
+ }
+ else
+ {
+ /*
+ * Insert node after this child...
+ */
+
+ node->prev = child;
+ node->next = child->next;
+
+ if (child->next)
+ child->next->prev = node;
+ else
+ parent->last_child = node;
+
+ child->next = node;
+ }
+ break;
+ }
+
+#if DEBUG > 1
+ fprintf(stderr, " AFTER: node->parent=%p\n", node->parent);
+ if (parent)
+ {
+ fprintf(stderr, " AFTER: parent->child=%p\n", parent->child);
+ fprintf(stderr, " AFTER: parent->last_child=%p\n", parent->last_child);
+ fprintf(stderr, " AFTER: parent->prev=%p\n", parent->prev);
+ fprintf(stderr, " AFTER: parent->next=%p\n", parent->next);
+ }
+#endif /* DEBUG > 1 */
+}
+
+
+/*
+ * 'mxmlDelete()' - Delete a node and all of its children.
+ *
+ * If the specified node has a parent, this function first removes the
+ * node from its parent using the mxmlRemove() function.
+ */
+
+void
+mxmlDelete(mxml_node_t *node) /* I - Node to delete */
+{
+ int i; /* Looping var */
+
+
+#ifdef DEBUG
+ fprintf(stderr, "mxmlDelete(node=%p)\n", node);
+#endif /* DEBUG */
+
+ /*
+ * Range check input...
+ */
+
+ if (!node)
+ return;
+
+ /*
+ * Remove the node from its parent, if any...
+ */
+
+ mxmlRemove(node);
+
+ /*
+ * Delete children...
+ */
+
+ while (node->child)
+ mxmlDelete(node->child);
+
+ /*
+ * Now delete any node data...
+ */
+
+ switch (node->type)
+ {
+ case MXML_ELEMENT :
+ if (node->value.element.name)
+ free(node->value.element.name);
+
+ if (node->value.element.num_attrs)
+ {
+ for (i = 0; i < node->value.element.num_attrs; i ++)
+ {
+ if (node->value.element.attrs[i].name)
+ free(node->value.element.attrs[i].name);
+ if (node->value.element.attrs[i].value)
+ free(node->value.element.attrs[i].value);
+ }
+
+ free(node->value.element.attrs);
+ }
+ break;
+ case MXML_INTEGER :
+ /* Nothing to do */
+ break;
+ case MXML_OPAQUE :
+ if (node->value.opaque)
+ free(node->value.opaque);
+ break;
+ case MXML_REAL :
+ /* Nothing to do */
+ break;
+ case MXML_TEXT :
+ if (node->value.text.string)
+ free(node->value.text.string);
+ break;
+ case MXML_CUSTOM :
+ if (node->value.custom.data &&
+ node->value.custom.destroy)
+ (*(node->value.custom.destroy))(node->value.custom.data);
+ break;
+ default :
+ break;
+ }
+
+ /*
+ * Free this node...
+ */
+
+ free(node);
+}
+
+
+/*
+ * 'mxmlNewCDATA()' - Create a new CDATA node.
+ *
+ * The new CDATA node is added to the end of the specified parent's child
+ * list. The constant MXML_NO_PARENT can be used to specify that the new
+ * CDATA node has no parent. The data string must be nul-terminated and
+ * is copied into the new node. CDATA nodes use the MXML_ELEMENT type.
+ *
+ * @since Mini-XML 2.3@
+ */
+
+mxml_node_t * /* O - New node */
+mxmlNewCDATA(mxml_node_t *parent, /* I - Parent node or MXML_NO_PARENT */
+ const char *data) /* I - Data string */
+{
+ mxml_node_t *node; /* New node */
+
+
+#ifdef DEBUG
+ fprintf(stderr, "mxmlNewCDATA(parent=%p, data=\"%s\")\n",
+ parent, data ? data : "(null)");
+#endif /* DEBUG */
+
+ /*
+ * Range check input...
+ */
+
+ if (!data)
+ return (NULL);
+
+ /*
+ * Create the node and set the name value...
+ */
+
+ if ((node = mxml_new(parent, MXML_ELEMENT)) != NULL)
+ node->value.element.name = _mxml_strdupf("![CDATA[%s]]", data);
+
+ return (node);
+}
+
+
+/*
+ * 'mxmlNewCustom()' - Create a new custom data node.
+ *
+ * The new custom node is added to the end of the specified parent's child
+ * list. The constant MXML_NO_PARENT can be used to specify that the new
+ * element node has no parent. NULL can be passed when the data in the
+ * node is not dynamically allocated or is separately managed.
+ *
+ * @since Mini-XML 2.1@
+ */
+
+mxml_node_t * /* O - New node */
+mxmlNewCustom(
+ mxml_node_t *parent, /* I - Parent node or MXML_NO_PARENT */
+ void *data, /* I - Pointer to data */
+ mxml_custom_destroy_cb_t destroy) /* I - Function to destroy data */
+{
+ mxml_node_t *node; /* New node */
+
+
+#ifdef DEBUG
+ fprintf(stderr, "mxmlNewCustom(parent=%p, data=%p, destroy=%p)\n", parent,
+ data, destroy);
+#endif /* DEBUG */
+
+ /*
+ * Create the node and set the value...
+ */
+
+ if ((node = mxml_new(parent, MXML_CUSTOM)) != NULL)
+ {
+ node->value.custom.data = data;
+ node->value.custom.destroy = destroy;
+ }
+
+ return (node);
+}
+
+
+/*
+ * 'mxmlNewElement()' - Create a new element node.
+ *
+ * The new element node is added to the end of the specified parent's child
+ * list. The constant MXML_NO_PARENT can be used to specify that the new
+ * element node has no parent.
+ */
+
+mxml_node_t * /* O - New node */
+mxmlNewElement(mxml_node_t *parent, /* I - Parent node or MXML_NO_PARENT */
+ const char *name) /* I - Name of element */
+{
+ mxml_node_t *node; /* New node */
+
+
+#ifdef DEBUG
+ fprintf(stderr, "mxmlNewElement(parent=%p, name=\"%s\")\n", parent,
+ name ? name : "(null)");
+#endif /* DEBUG */
+
+ /*
+ * Range check input...
+ */
+
+ if (!name)
+ return (NULL);
+
+ /*
+ * Create the node and set the element name...
+ */
+
+ if ((node = mxml_new(parent, MXML_ELEMENT)) != NULL)
+ node->value.element.name = strdup(name);
+
+ return (node);
+}
+
+
+/*
+ * 'mxmlNewInteger()' - Create a new integer node.
+ *
+ * The new integer node is added to the end of the specified parent's child
+ * list. The constant MXML_NO_PARENT can be used to specify that the new
+ * integer node has no parent.
+ */
+
+mxml_node_t * /* O - New node */
+mxmlNewInteger(mxml_node_t *parent, /* I - Parent node or MXML_NO_PARENT */
+ int integer) /* I - Integer value */
+{
+ mxml_node_t *node; /* New node */
+
+
+#ifdef DEBUG
+ fprintf(stderr, "mxmlNewInteger(parent=%p, integer=%d)\n", parent, integer);
+#endif /* DEBUG */
+
+ /*
+ * Create the node and set the element name...
+ */
+
+ if ((node = mxml_new(parent, MXML_INTEGER)) != NULL)
+ node->value.integer = integer;
+
+ return (node);
+}
+
+
+/*
+ * 'mxmlNewOpaque()' - Create a new opaque string.
+ *
+ * The new opaque node is added to the end of the specified parent's child
+ * list. The constant MXML_NO_PARENT can be used to specify that the new
+ * opaque node has no parent. The opaque string must be nul-terminated and
+ * is copied into the new node.
+ */
+
+mxml_node_t * /* O - New node */
+mxmlNewOpaque(mxml_node_t *parent, /* I - Parent node or MXML_NO_PARENT */
+ const char *opaque) /* I - Opaque string */
+{
+ mxml_node_t *node; /* New node */
+
+
+#ifdef DEBUG
+ fprintf(stderr, "mxmlNewOpaque(parent=%p, opaque=\"%s\")\n", parent,
+ opaque ? opaque : "(null)");
+#endif /* DEBUG */
+
+ /*
+ * Range check input...
+ */
+
+ if (!opaque)
+ return (NULL);
+
+ /*
+ * Create the node and set the element name...
+ */
+
+ if ((node = mxml_new(parent, MXML_OPAQUE)) != NULL)
+ node->value.opaque = strdup(opaque);
+
+ return (node);
+}
+
+
+/*
+ * 'mxmlNewReal()' - Create a new real number node.
+ *
+ * The new real number node is added to the end of the specified parent's
+ * child list. The constant MXML_NO_PARENT can be used to specify that
+ * the new real number node has no parent.
+ */
+
+mxml_node_t * /* O - New node */
+mxmlNewReal(mxml_node_t *parent, /* I - Parent node or MXML_NO_PARENT */
+ double real) /* I - Real number value */
+{
+ mxml_node_t *node; /* New node */
+
+
+#ifdef DEBUG
+ fprintf(stderr, "mxmlNewReal(parent=%p, real=%g)\n", parent, real);
+#endif /* DEBUG */
+
+ /*
+ * Create the node and set the element name...
+ */
+
+ if ((node = mxml_new(parent, MXML_REAL)) != NULL)
+ node->value.real = real;
+
+ return (node);
+}
+
+
+/*
+ * 'mxmlNewText()' - Create a new text fragment node.
+ *
+ * The new text node is added to the end of the specified parent's child
+ * list. The constant MXML_NO_PARENT can be used to specify that the new
+ * text node has no parent. The whitespace parameter is used to specify
+ * whether leading whitespace is present before the node. The text
+ * string must be nul-terminated and is copied into the new node.
+ */
+
+mxml_node_t * /* O - New node */
+mxmlNewText(mxml_node_t *parent, /* I - Parent node or MXML_NO_PARENT */
+ int whitespace, /* I - 1 = leading whitespace, 0 = no whitespace */
+ const char *string) /* I - String */
+{
+ mxml_node_t *node; /* New node */
+
+
+#ifdef DEBUG
+ fprintf(stderr, "mxmlNewText(parent=%p, whitespace=%d, string=\"%s\")\n",
+ parent, whitespace, string ? string : "(null)");
+#endif /* DEBUG */
+
+ /*
+ * Range check input...
+ */
+
+ if (!string)
+ return (NULL);
+
+ /*
+ * Create the node and set the text value...
+ */
+
+ if ((node = mxml_new(parent, MXML_TEXT)) != NULL)
+ {
+ node->value.text.whitespace = whitespace;
+ node->value.text.string = strdup(string);
+ }
+
+ return (node);
+}
+
+
+/*
+ * 'mxmlNewTextf()' - Create a new formatted text fragment node.
+ *
+ * The new text node is added to the end of the specified parent's child
+ * list. The constant MXML_NO_PARENT can be used to specify that the new
+ * text node has no parent. The whitespace parameter is used to specify
+ * whether leading whitespace is present before the node. The format
+ * string must be nul-terminated and is formatted into the new node.
+ */
+
+mxml_node_t * /* O - New node */
+mxmlNewTextf(mxml_node_t *parent, /* I - Parent node or MXML_NO_PARENT */
+ int whitespace, /* I - 1 = leading whitespace, 0 = no whitespace */
+ const char *format, /* I - Printf-style frmat string */
+ ...) /* I - Additional args as needed */
+{
+ mxml_node_t *node; /* New node */
+ va_list ap; /* Pointer to arguments */
+
+
+#ifdef DEBUG
+ fprintf(stderr, "mxmlNewTextf(parent=%p, whitespace=%d, format=\"%s\", ...)\n",
+ parent, whitespace, format ? format : "(null)");
+#endif /* DEBUG */
+
+ /*
+ * Range check input...
+ */
+
+ if (!format)
+ return (NULL);
+
+ /*
+ * Create the node and set the text value...
+ */
+
+ if ((node = mxml_new(parent, MXML_TEXT)) != NULL)
+ {
+ va_start(ap, format);
+
+ node->value.text.whitespace = whitespace;
+ node->value.text.string = _mxml_vstrdupf(format, ap);
+
+ va_end(ap);
+ }
+
+ return (node);
+}
+
+
+/*
+ * 'mxmlRemove()' - Remove a node from its parent.
+ *
+ * Does not free memory used by the node - use mxmlDelete() for that.
+ * This function does nothing if the node has no parent.
+ */
+
+void
+mxmlRemove(mxml_node_t *node) /* I - Node to remove */
+{
+#ifdef DEBUG
+ fprintf(stderr, "mxmlRemove(node=%p)\n", node);
+#endif /* DEBUG */
+
+ /*
+ * Range check input...
+ */
+
+ if (!node || !node->parent)
+ return;
+
+ /*
+ * Remove from parent...
+ */
+
+#if DEBUG > 1
+ fprintf(stderr, " BEFORE: node->parent=%p\n", node->parent);
+ if (node->parent)
+ {
+ fprintf(stderr, " BEFORE: node->parent->child=%p\n", node->parent->child);
+ fprintf(stderr, " BEFORE: node->parent->last_child=%p\n", node->parent->last_child);
+ }
+ fprintf(stderr, " BEFORE: node->child=%p\n", node->child);
+ fprintf(stderr, " BEFORE: node->last_child=%p\n", node->last_child);
+ fprintf(stderr, " BEFORE: node->prev=%p\n", node->prev);
+ fprintf(stderr, " BEFORE: node->next=%p\n", node->next);
+#endif /* DEBUG > 1 */
+
+ if (node->prev)
+ node->prev->next = node->next;
+ else
+ node->parent->child = node->next;
+
+ if (node->next)
+ node->next->prev = node->prev;
+ else
+ node->parent->last_child = node->prev;
+
+ node->parent = NULL;
+ node->prev = NULL;
+ node->next = NULL;
+
+#if DEBUG > 1
+ fprintf(stderr, " AFTER: node->parent=%p\n", node->parent);
+ if (node->parent)
+ {
+ fprintf(stderr, " AFTER: node->parent->child=%p\n", node->parent->child);
+ fprintf(stderr, " AFTER: node->parent->last_child=%p\n", node->parent->last_child);
+ }
+ fprintf(stderr, " AFTER: node->child=%p\n", node->child);
+ fprintf(stderr, " AFTER: node->last_child=%p\n", node->last_child);
+ fprintf(stderr, " AFTER: node->prev=%p\n", node->prev);
+ fprintf(stderr, " AFTER: node->next=%p\n", node->next);
+#endif /* DEBUG > 1 */
+}
+
+
+/*
+ * 'mxmlNewXML()' - Create a new XML document tree.
+ *
+ * The "version" argument specifies the version number to put in the
+ * ?xml element node. If NULL, version 1.0 is assumed.
+ *
+ * @since Mini-XML 2.3@
+ */
+
+mxml_node_t * /* O - New ?xml node */
+mxmlNewXML(const char *version) /* I - Version number to use */
+{
+ char element[1024]; /* Element text */
+
+
+ snprintf(element, sizeof(element), "?xml version=\"%s\" encoding=\"utf-8\"?",
+ version ? version : "1.0");
+
+ return (mxmlNewElement(NULL, element));
+}
+
+
+/*
+ * 'mxmlRelease()' - Release a node.
+ *
+ * When the reference count reaches zero, the node (and any children)
+ * is deleted via mxmlDelete().
+ *
+ * @since Mini-XML 2.3@
+ */
+
+int /* O - New reference count */
+mxmlRelease(mxml_node_t *node) /* I - Node */
+{
+ if (node)
+ {
+ if ((-- node->ref_count) <= 0)
+ {
+ mxmlDelete(node);
+ return (0);
+ }
+ else
+ return (node->ref_count);
+ }
+ else
+ return (-1);
+}
+
+
+/*
+ * 'mxmlRetain()' - Retain a node.
+ *
+ * @since Mini-XML 2.3@
+ */
+
+int /* O - New reference count */
+mxmlRetain(mxml_node_t *node) /* I - Node */
+{
+ if (node)
+ return (++ node->ref_count);
+ else
+ return (-1);
+}
+
+
+/*
+ * 'mxml_new()' - Create a new node.
+ */
+
+static mxml_node_t * /* O - New node */
+mxml_new(mxml_node_t *parent, /* I - Parent node */
+ mxml_type_t type) /* I - Node type */
+{
+ mxml_node_t *node; /* New node */
+
+
+#if DEBUG > 1
+ fprintf(stderr, "mxml_new(parent=%p, type=%d)\n", parent, type);
+#endif /* DEBUG > 1 */
+
+ /*
+ * Allocate memory for the node...
+ */
+
+ if ((node = calloc(1, sizeof(mxml_node_t))) == NULL)
+ {
+#if DEBUG > 1
+ fputs(" returning NULL\n", stderr);
+#endif /* DEBUG > 1 */
+
+ return (NULL);
+ }
+
+#if DEBUG > 1
+ fprintf(stderr, " returning %p\n", node);
+#endif /* DEBUG > 1 */
+
+ /*
+ * Set the node type...
+ */
+
+ node->type = type;
+ node->ref_count = 1;
+
+ /*
+ * Add to the parent if present...
+ */
+
+ if (parent)
+ mxmlAdd(parent, MXML_ADD_AFTER, MXML_ADD_TO_PARENT, node);
+
+ /*
+ * Return the new node...
+ */
+
+ return (node);
+}
+
+
+/*
+ * End of "$Id: mxml-node.c 363 2008-10-26 18:28:05Z mike $".
+ */
diff -Naur mxml-2.6/mxml-private.c mxml-2.6-haiku/mxml-private.c
--- mxml-2.6/mxml-private.c 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/mxml-private.c 2007-11-22 18:01:52.000000000 +0000
@@ -0,0 +1,285 @@
+/*
+ * "$Id: mxml-private.c 315 2007-11-22 18:01:52Z mike $"
+ *
+ * Private functions for Mini-XML, a small XML-like file parsing library.
+ *
+ * Copyright 2003-2007 by Michael Sweet.
+ *
+ * This program is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU Library General Public
+ * License as published by the Free Software Foundation; either
+ * version 2, or (at your option) any later version.
+ *
+ * This program is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+ * GNU General Public License for more details.
+ *
+ * Contents:
+ *
+ * mxml_error() - Display an error message.
+ * mxml_integer_cb() - Default callback for integer values.
+ * mxml_opaque_cb() - Default callback for opaque values.
+ * mxml_real_cb() - Default callback for real number values.
+ * _mxml_global() - Get global data.
+ */
+
+/*
+ * Include necessary headers...
+ */
+
+#include "mxml-private.h"
+
+
+/*
+ * 'mxml_error()' - Display an error message.
+ */
+
+void
+mxml_error(const char *format, /* I - Printf-style format string */
+ ...) /* I - Additional arguments as needed */
+{
+ va_list ap; /* Pointer to arguments */
+ char s[1024]; /* Message string */
+ _mxml_global_t *global = _mxml_global();
+ /* Global data */
+
+
+ /*
+ * Range check input...
+ */
+
+ if (!format)
+ return;
+
+ /*
+ * Format the error message string...
+ */
+
+ va_start(ap, format);
+
+ vsnprintf(s, sizeof(s), format, ap);
+
+ va_end(ap);
+
+ /*
+ * And then display the error message...
+ */
+
+ if (global->error_cb)
+ (*global->error_cb)(s);
+ else
+ fprintf(stderr, "mxml: %s\n", s);
+}
+
+
+/*
+ * 'mxml_ignore_cb()' - Default callback for ignored values.
+ */
+
+mxml_type_t /* O - Node type */
+mxml_ignore_cb(mxml_node_t *node) /* I - Current node */
+{
+ (void)node;
+
+ return (MXML_IGNORE);
+}
+
+
+/*
+ * 'mxml_integer_cb()' - Default callback for integer values.
+ */
+
+mxml_type_t /* O - Node type */
+mxml_integer_cb(mxml_node_t *node) /* I - Current node */
+{
+ (void)node;
+
+ return (MXML_INTEGER);
+}
+
+
+/*
+ * 'mxml_opaque_cb()' - Default callback for opaque values.
+ */
+
+mxml_type_t /* O - Node type */
+mxml_opaque_cb(mxml_node_t *node) /* I - Current node */
+{
+ (void)node;
+
+ return (MXML_OPAQUE);
+}
+
+
+/*
+ * 'mxml_real_cb()' - Default callback for real number values.
+ */
+
+mxml_type_t /* O - Node type */
+mxml_real_cb(mxml_node_t *node) /* I - Current node */
+{
+ (void)node;
+
+ return (MXML_REAL);
+}
+
+
+#ifdef HAVE_PTHREAD_H /**** POSIX threading ****/
+# include <pthread.h>
+
+static pthread_key_t _mxml_key = -1; /* Thread local storage key */
+static pthread_once_t _mxml_key_once = PTHREAD_ONCE_INIT;
+ /* One-time initialization object */
+static void _mxml_init(void);
+static void _mxml_destructor(void *g);
+
+
+/*
+ * '_mxml_global()' - Get global data.
+ */
+
+_mxml_global_t * /* O - Global data */
+_mxml_global(void)
+{
+ _mxml_global_t *global; /* Global data */
+
+
+ pthread_once(&_mxml_key_once, _mxml_init);
+
+ if ((global = (_mxml_global_t *)pthread_getspecific(_mxml_key)) == NULL)
+ {
+ global = (_mxml_global_t *)calloc(1, sizeof(_mxml_global_t));
+ pthread_setspecific(_mxml_key, global);
+
+ global->num_entity_cbs = 1;
+ global->entity_cbs[0] = _mxml_entity_cb;
+ global->wrap = 72;
+ }
+
+ return (global);
+}
+
+
+/*
+ * '_mxml_init()' - Initialize global data...
+ */
+
+static void
+_mxml_init(void)
+{
+ pthread_key_create(&_mxml_key, _mxml_destructor);
+}
+
+
+/*
+ * '_mxml_destructor()' - Free memory used for globals...
+ */
+
+static void
+_mxml_destructor(void *g) /* I - Global data */
+{
+ free(g);
+}
+
+
+#elif defined(WIN32) /**** WIN32 threading ****/
+# include <windows.h>
+
+static DWORD _mxml_tls_index; /* Index for global storage */
+
+
+/*
+ * 'DllMain()' - Main entry for library.
+ */
+
+BOOL WINAPI /* O - Success/failure */
+DllMain(HINSTANCE hinst, /* I - DLL module handle */
+ DWORD reason, /* I - Reason */
+ LPVOID reserved) /* I - Unused */
+{
+ _mxml_global_t *global; /* Global data */
+
+
+ (void)hinst;
+ (void)reserved;
+
+ switch (reason)
+ {
+ case DLL_PROCESS_ATTACH : /* Called on library initialization */
+ if ((_mxml_tls_index = TlsAlloc()) == TLS_OUT_OF_INDEXES)
+ return (FALSE);
+ break;
+
+ case DLL_THREAD_DETACH : /* Called when a thread terminates */
+ if ((global = (_mxml_global_t *)TlsGetValue(_mxml_tls_index)) != NULL)
+ free(global);
+ break;
+
+ case DLL_PROCESS_DETACH : /* Called when library is unloaded */
+ if ((global = (_mxml_global_t *)TlsGetValue(_mxml_tls_index)) != NULL)
+ free(global);
+
+ TlsFree(_mxml_tls_index);
+ break;
+
+ default:
+ break;
+ }
+
+ return (TRUE);
+}
+
+
+/*
+ * '_mxml_global()' - Get global data.
+ */
+
+_mxml_global_t * /* O - Global data */
+_mxml_global(void)
+{
+ _mxml_global_t *global; /* Global data */
+
+
+ if ((global = (_mxml_global_t *)TlsGetValue(_mxml_tls_index)) == NULL)
+ {
+ global = (_mxml_global_t *)calloc(1, sizeof(_mxml_global_t));
+
+ global->num_entity_cbs = 1;
+ global->entity_cbs[0] = _mxml_entity_cb;
+ global->wrap = 72;
+
+ TlsSetValue(_mxml_tls_index, (LPVOID)global);
+ }
+
+ return (global);
+}
+
+
+#else /**** No threading ****/
+/*
+ * '_mxml_global()' - Get global data.
+ */
+
+_mxml_global_t * /* O - Global data */
+_mxml_global(void)
+{
+ static _mxml_global_t global = /* Global data */
+ {
+ NULL, /* error_cb */
+ 1, /* num_entity_cbs */
+ { _mxml_entity_cb }, /* entity_cbs */
+ 72, /* wrap */
+ NULL, /* custom_load_cb */
+ NULL /* custom_save_cb */
+ };
+
+
+ return (&global);
+}
+#endif /* HAVE_PTHREAD_H */
+
+
+/*
+ * End of "$Id: mxml-private.c 315 2007-11-22 18:01:52Z mike $".
+ */
diff -Naur mxml-2.6/mxml-private.h mxml-2.6-haiku/mxml-private.h
--- mxml-2.6/mxml-private.h 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/mxml-private.h 2007-09-21 04:46:02.000000000 +0000
@@ -0,0 +1,52 @@
+/*
+ * "$Id: mxml-private.h 309 2007-09-21 04:46:02Z mike $"
+ *
+ * Private definitions for Mini-XML, a small XML-like file parsing library.
+ *
+ * Copyright 2007 by Michael Sweet.
+ *
+ * This program is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU Library General Public
+ * License as published by the Free Software Foundation; either
+ * version 2, or (at your option) any later version.
+ *
+ * This program is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+ * GNU General Public License for more details.
+ */
+
+/*
+ * Include necessary headers...
+ */
+
+#include "config.h"
+#include "mxml.h"
+
+
+/*
+ * Global, per-thread data...
+ */
+
+typedef struct _mxml_global_s
+{
+ void (*error_cb)(const char *);
+ int num_entity_cbs;
+ int (*entity_cbs[100])(const char *name);
+ int wrap;
+ mxml_custom_load_cb_t custom_load_cb;
+ mxml_custom_save_cb_t custom_save_cb;
+} _mxml_global_t;
+
+
+/*
+ * Functions...
+ */
+
+extern _mxml_global_t *_mxml_global(void);
+extern int _mxml_entity_cb(const char *name);
+
+
+/*
+ * End of "$Id: mxml-private.h 309 2007-09-21 04:46:02Z mike $".
+ */
diff -Naur mxml-2.6/mxml-search.c mxml-2.6-haiku/mxml-search.c
--- mxml-2.6/mxml-search.c 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/mxml-search.c 2007-09-09 07:16:52.000000000 +0000
@@ -0,0 +1,201 @@
+/*
+ * "$Id: mxml-search.c 297 2007-09-09 07:16:52Z mike $"
+ *
+ * Search/navigation functions for Mini-XML, a small XML-like file
+ * parsing library.
+ *
+ * Copyright 2003-2007 by Michael Sweet.
+ *
+ * This program is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU Library General Public
+ * License as published by the Free Software Foundation; either
+ * version 2, or (at your option) any later version.
+ *
+ * This program is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+ * GNU General Public License for more details.
+ *
+ * Contents:
+ *
+ * mxmlFindElement() - Find the named element.
+ * mxmlWalkNext() - Walk to the next logical node in the tree.
+ * mxmlWalkPrev() - Walk to the previous logical node in the tree.
+ */
+
+/*
+ * Include necessary headers...
+ */
+
+#include "config.h"
+#include "mxml.h"
+
+
+/*
+ * 'mxmlFindElement()' - Find the named element.
+ *
+ * The search is constrained by the name, attribute name, and value; any
+ * NULL names or values are treated as wildcards, so different kinds of
+ * searches can be implemented by looking for all elements of a given name
+ * or all elements with a specific attribute. The descend argument determines
+ * whether the search descends into child nodes; normally you will use
+ * MXML_DESCEND_FIRST for the initial search and MXML_NO_DESCEND to find
+ * additional direct descendents of the node. The top node argument
+ * constrains the search to a particular node's children.
+ */
+
+mxml_node_t * /* O - Element node or NULL */
+mxmlFindElement(mxml_node_t *node, /* I - Current node */
+ mxml_node_t *top, /* I - Top node */
+ const char *name, /* I - Element name or NULL for any */
+ const char *attr, /* I - Attribute name, or NULL for none */
+ const char *value, /* I - Attribute value, or NULL for any */
+ int descend) /* I - Descend into tree - MXML_DESCEND, MXML_NO_DESCEND, or MXML_DESCEND_FIRST */
+{
+ const char *temp; /* Current attribute value */
+
+
+ /*
+ * Range check input...
+ */
+
+ if (!node || !top || (!attr && value))
+ return (NULL);
+
+ /*
+ * Start with the next node...
+ */
+
+ node = mxmlWalkNext(node, top, descend);
+
+ /*
+ * Loop until we find a matching element...
+ */
+
+ while (node != NULL)
+ {
+ /*
+ * See if this node matches...
+ */
+
+ if (node->type == MXML_ELEMENT &&
+ node->value.element.name &&
+ (!name || !strcmp(node->value.element.name, name)))
+ {
+ /*
+ * See if we need to check for an attribute...
+ */
+
+ if (!attr)
+ return (node); /* No attribute search, return it... */
+
+ /*
+ * Check for the attribute...
+ */
+
+ if ((temp = mxmlElementGetAttr(node, attr)) != NULL)
+ {
+ /*
+ * OK, we have the attribute, does it match?
+ */
+
+ if (!value || !strcmp(value, temp))
+ return (node); /* Yes, return it... */
+ }
+ }
+
+ /*
+ * No match, move on to the next node...
+ */
+
+ if (descend == MXML_DESCEND)
+ node = mxmlWalkNext(node, top, MXML_DESCEND);
+ else
+ node = node->next;
+ }
+
+ return (NULL);
+}
+
+
+/*
+ * 'mxmlWalkNext()' - Walk to the next logical node in the tree.
+ *
+ * The descend argument controls whether the first child is considered
+ * to be the next node. The top node argument constrains the walk to
+ * the node's children.
+ */
+
+mxml_node_t * /* O - Next node or NULL */
+mxmlWalkNext(mxml_node_t *node, /* I - Current node */
+ mxml_node_t *top, /* I - Top node */
+ int descend) /* I - Descend into tree - MXML_DESCEND, MXML_NO_DESCEND, or MXML_DESCEND_FIRST */
+{
+ if (!node)
+ return (NULL);
+ else if (node->child && descend)
+ return (node->child);
+ else if (node == top)
+ return (NULL);
+ else if (node->next)
+ return (node->next);
+ else if (node->parent && node->parent != top)
+ {
+ node = node->parent;
+
+ while (!node->next)
+ if (node->parent == top || !node->parent)
+ return (NULL);
+ else
+ node = node->parent;
+
+ return (node->next);
+ }
+ else
+ return (NULL);
+}
+
+
+/*
+ * 'mxmlWalkPrev()' - Walk to the previous logical node in the tree.
+ *
+ * The descend argument controls whether the previous node's last child
+ * is considered to be the previous node. The top node argument constrains
+ * the walk to the node's children.
+ */
+
+mxml_node_t * /* O - Previous node or NULL */
+mxmlWalkPrev(mxml_node_t *node, /* I - Current node */
+ mxml_node_t *top, /* I - Top node */
+ int descend) /* I - Descend into tree - MXML_DESCEND, MXML_NO_DESCEND, or MXML_DESCEND_FIRST */
+{
+ if (!node || node == top)
+ return (NULL);
+ else if (node->prev)
+ {
+ if (node->prev->last_child && descend)
+ {
+ /*
+ * Find the last child under the previous node...
+ */
+
+ node = node->prev->last_child;
+
+ while (node->last_child)
+ node = node->last_child;
+
+ return (node);
+ }
+ else
+ return (node->prev);
+ }
+ else if (node->parent != top)
+ return (node->parent);
+ else
+ return (NULL);
+}
+
+
+/*
+ * End of "$Id: mxml-search.c 297 2007-09-09 07:16:52Z mike $".
+ */
diff -Naur mxml-2.6/mxml-set.c mxml-2.6-haiku/mxml-set.c
--- mxml-2.6/mxml-set.c 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/mxml-set.c 2007-04-23 21:48:03.000000000 +0000
@@ -0,0 +1,294 @@
+/*
+ * "$Id: mxml-set.c 270 2007-04-23 21:48:03Z mike $"
+ *
+ * Node set functions for Mini-XML, a small XML-like file parsing library.
+ *
+ * Copyright 2003-2007 by Michael Sweet.
+ *
+ * This program is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU Library General Public
+ * License as published by the Free Software Foundation; either
+ * version 2, or (at your option) any later version.
+ *
+ * This program is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+ * GNU General Public License for more details.
+ *
+ * Contents:
+ *
+ * mxmlSetCustom() - Set the data and destructor of a custom data node.
+ * mxmlSetCDATA() - Set the element name of a CDATA node.
+ * mxmlSetElement() - Set the name of an element node.
+ * mxmlSetInteger() - Set the value of an integer node.
+ * mxmlSetOpaque() - Set the value of an opaque node.
+ * mxmlSetReal() - Set the value of a real number node.
+ * mxmlSetText() - Set the value of a text node.
+ * mxmlSetTextf() - Set the value of a text node to a formatted string.
+ */
+
+/*
+ * Include necessary headers...
+ */
+
+#include "config.h"
+#include "mxml.h"
+
+
+/*
+ * 'mxmlSetCustom()' - Set the data and destructor of a custom data node.
+ *
+ * The node is not changed if it is not a custom node.
+ *
+ * @since Mini-XML 2.1@
+ */
+
+int /* O - 0 on success, -1 on failure */
+mxmlSetCustom(
+ mxml_node_t *node, /* I - Node to set */
+ void *data, /* I - New data pointer */
+ mxml_custom_destroy_cb_t destroy) /* I - New destructor function */
+{
+ /*
+ * Range check input...
+ */
+
+ if (!node || node->type != MXML_CUSTOM)
+ return (-1);
+
+ /*
+ * Free any old element value and set the new value...
+ */
+
+ if (node->value.custom.data && node->value.custom.destroy)
+ (*(node->value.custom.destroy))(node->value.custom.data);
+
+ node->value.custom.data = data;
+ node->value.custom.destroy = destroy;
+
+ return (0);
+}
+
+
+/*
+ * 'mxmlSetCDATA()' - Set the element name of a CDATA node.
+ *
+ * The node is not changed if it is not a CDATA element node.
+ *
+ * @since Mini-XML 2.3@
+ */
+
+int /* O - 0 on success, -1 on failure */
+mxmlSetCDATA(mxml_node_t *node, /* I - Node to set */
+ const char *data) /* I - New data string */
+{
+ /*
+ * Range check input...
+ */
+
+ if (!node || node->type != MXML_ELEMENT || !data ||
+ strncmp(node->value.element.name, "![CDATA[", 8))
+ return (-1);
+
+ /*
+ * Free any old element value and set the new value...
+ */
+
+ if (node->value.element.name)
+ free(node->value.element.name);
+
+ node->value.element.name = _mxml_strdupf("![CDATA[%s]]", data);
+
+ return (0);
+}
+
+
+/*
+ * 'mxmlSetElement()' - Set the name of an element node.
+ *
+ * The node is not changed if it is not an element node.
+ */
+
+int /* O - 0 on success, -1 on failure */
+mxmlSetElement(mxml_node_t *node, /* I - Node to set */
+ const char *name) /* I - New name string */
+{
+ /*
+ * Range check input...
+ */
+
+ if (!node || node->type != MXML_ELEMENT || !name)
+ return (-1);
+
+ /*
+ * Free any old element value and set the new value...
+ */
+
+ if (node->value.element.name)
+ free(node->value.element.name);
+
+ node->value.element.name = strdup(name);
+
+ return (0);
+}
+
+
+/*
+ * 'mxmlSetInteger()' - Set the value of an integer node.
+ *
+ * The node is not changed if it is not an integer node.
+ */
+
+int /* O - 0 on success, -1 on failure */
+mxmlSetInteger(mxml_node_t *node, /* I - Node to set */
+ int integer) /* I - Integer value */
+{
+ /*
+ * Range check input...
+ */
+
+ if (!node || node->type != MXML_INTEGER)
+ return (-1);
+
+ /*
+ * Set the new value and return...
+ */
+
+ node->value.integer = integer;
+
+ return (0);
+}
+
+
+/*
+ * 'mxmlSetOpaque()' - Set the value of an opaque node.
+ *
+ * The node is not changed if it is not an opaque node.
+ */
+
+int /* O - 0 on success, -1 on failure */
+mxmlSetOpaque(mxml_node_t *node, /* I - Node to set */
+ const char *opaque) /* I - Opaque string */
+{
+ /*
+ * Range check input...
+ */
+
+ if (!node || node->type != MXML_OPAQUE || !opaque)
+ return (-1);
+
+ /*
+ * Free any old opaque value and set the new value...
+ */
+
+ if (node->value.opaque)
+ free(node->value.opaque);
+
+ node->value.opaque = strdup(opaque);
+
+ return (0);
+}
+
+
+/*
+ * 'mxmlSetReal()' - Set the value of a real number node.
+ *
+ * The node is not changed if it is not a real number node.
+ */
+
+int /* O - 0 on success, -1 on failure */
+mxmlSetReal(mxml_node_t *node, /* I - Node to set */
+ double real) /* I - Real number value */
+{
+ /*
+ * Range check input...
+ */
+
+ if (!node || node->type != MXML_REAL)
+ return (-1);
+
+ /*
+ * Set the new value and return...
+ */
+
+ node->value.real = real;
+
+ return (0);
+}
+
+
+/*
+ * 'mxmlSetText()' - Set the value of a text node.
+ *
+ * The node is not changed if it is not a text node.
+ */
+
+int /* O - 0 on success, -1 on failure */
+mxmlSetText(mxml_node_t *node, /* I - Node to set */
+ int whitespace, /* I - 1 = leading whitespace, 0 = no whitespace */
+ const char *string) /* I - String */
+{
+ /*
+ * Range check input...
+ */
+
+ if (!node || node->type != MXML_TEXT || !string)
+ return (-1);
+
+ /*
+ * Free any old string value and set the new value...
+ */
+
+ if (node->value.text.string)
+ free(node->value.text.string);
+
+ node->value.text.whitespace = whitespace;
+ node->value.text.string = strdup(string);
+
+ return (0);
+}
+
+
+/*
+ * 'mxmlSetTextf()' - Set the value of a text node to a formatted string.
+ *
+ * The node is not changed if it is not a text node.
+ */
+
+int /* O - 0 on success, -1 on failure */
+mxmlSetTextf(mxml_node_t *node, /* I - Node to set */
+ int whitespace, /* I - 1 = leading whitespace, 0 = no whitespace */
+ const char *format, /* I - Printf-style format string */
+ ...) /* I - Additional arguments as needed */
+{
+ va_list ap; /* Pointer to arguments */
+
+
+ /*
+ * Range check input...
+ */
+
+ if (!node || node->type != MXML_TEXT || !format)
+ return (-1);
+
+ /*
+ * Free any old string value and set the new value...
+ */
+
+ if (node->value.text.string)
+ free(node->value.text.string);
+
+ va_start(ap, format);
+
+ node->value.text.whitespace = whitespace;
+ node->value.text.string = _mxml_strdupf(format, ap);
+
+ va_end(ap);
+
+ return (0);
+}
+
+
+/*
+ * End of "$Id: mxml-set.c 270 2007-04-23 21:48:03Z mike $".
+ */
diff -Naur mxml-2.6/mxml-string.c mxml-2.6-haiku/mxml-string.c
--- mxml-2.6/mxml-string.c 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/mxml-string.c 2009-04-18 17:05:52.000000000 +0000
@@ -0,0 +1,462 @@
+/*
+ * "$Id: mxml-string.c 387 2009-04-18 17:05:52Z mike $"
+ *
+ * String functions for Mini-XML, a small XML-like file parsing library.
+ *
+ * Copyright 2003-2009 by Michael Sweet.
+ *
+ * This program is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU Library General Public
+ * License as published by the Free Software Foundation; either
+ * version 2, or (at your option) any later version.
+ *
+ * This program is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+ * GNU General Public License for more details.
+ *
+ * Contents:
+ *
+ * _mxml_snprintf() - Format a string.
+ * _mxml_strdup() - Duplicate a string.
+ * _mxml_strdupf() - Format and duplicate a string.
+ * _mxml_vsnprintf() - Format a string into a fixed size buffer.
+ * _mxml_vstrdupf() - Format and duplicate a string.
+ */
+
+/*
+ * Include necessary headers...
+ */
+
+#include "config.h"
+
+
+#ifndef HAVE_SNPRINTF
+/*
+ * '_mxml_snprintf()' - Format a string.
+ */
+
+int /* O - Number of bytes formatted */
+_mxml_snprintf(char *buffer, /* I - Output buffer */
+ size_t bufsize, /* I - Size of output buffer */
+ const char *format, /* I - Printf-style format string */
+ ...) /* I - Additional arguments as needed */
+{
+ va_list ap; /* Argument list */
+ int bytes; /* Number of bytes formatted */
+
+
+ va_start(ap, format);
+ bytes = vsnprintf(buffer, bufsize, format, ap);
+ va_end(ap);
+
+ return (bytes);
+}
+#endif /* !HAVE_SNPRINTF */
+
+
+/*
+ * '_mxml_strdup()' - Duplicate a string.
+ */
+
+#ifndef HAVE_STRDUP
+char * /* O - New string pointer */
+_mxml_strdup(const char *s) /* I - String to duplicate */
+{
+ char *t; /* New string pointer */
+
+
+ if (s == NULL)
+ return (NULL);
+
+ if ((t = malloc(strlen(s) + 1)) == NULL)
+ return (NULL);
+
+ return (strcpy(t, s));
+}
+#endif /* !HAVE_STRDUP */
+
+
+/*
+ * '_mxml_strdupf()' - Format and duplicate a string.
+ */
+
+char * /* O - New string pointer */
+_mxml_strdupf(const char *format, /* I - Printf-style format string */
+ ...) /* I - Additional arguments as needed */
+{
+ va_list ap; /* Pointer to additional arguments */
+ char *s; /* Pointer to formatted string */
+
+
+ /*
+ * Get a pointer to the additional arguments, format the string,
+ * and return it...
+ */
+
+ va_start(ap, format);
+ s = _mxml_vstrdupf(format, ap);
+ va_end(ap);
+
+ return (s);
+}
+
+
+#ifndef HAVE_VSNPRINTF
+/*
+ * '_mxml_vsnprintf()' - Format a string into a fixed size buffer.
+ */
+
+int /* O - Number of bytes formatted */
+_mxml_vsnprintf(char *buffer, /* O - Output buffer */
+ size_t bufsize, /* O - Size of output buffer */
+ const char *format, /* I - Printf-style format string */
+ va_list ap) /* I - Pointer to additional arguments */
+{
+ char *bufptr, /* Pointer to position in buffer */
+ *bufend, /* Pointer to end of buffer */
+ sign, /* Sign of format width */
+ size, /* Size character (h, l, L) */
+ type; /* Format type character */
+ int width, /* Width of field */
+ prec; /* Number of characters of precision */
+ char tformat[100], /* Temporary format string for sprintf() */
+ *tptr, /* Pointer into temporary format */
+ temp[1024]; /* Buffer for formatted numbers */
+ char *s; /* Pointer to string */
+ int slen; /* Length of string */
+ int bytes; /* Total number of bytes needed */
+
+
+ /*
+ * Loop through the format string, formatting as needed...
+ */
+
+ bufptr = buffer;
+ bufend = buffer + bufsize - 1;
+ bytes = 0;
+
+ while (*format)
+ {
+ if (*format == '%')
+ {
+ tptr = tformat;
+ *tptr++ = *format++;
+
+ if (*format == '%')
+ {
+ if (bufptr && bufptr < bufend) *bufptr++ = *format;
+ bytes ++;
+ format ++;
+ continue;
+ }
+ else if (strchr(" -+#\'", *format))
+ {
+ *tptr++ = *format;
+ sign = *format++;
+ }
+ else
+ sign = 0;
+
+ if (*format == '*')
+ {
+ /*
+ * Get width from argument...
+ */
+
+ format ++;
+ width = va_arg(ap, int);
+
+ snprintf(tptr, sizeof(tformat) - (tptr - tformat), "%d", width);
+ tptr += strlen(tptr);
+ }
+ else
+ {
+ width = 0;
+
+ while (isdigit(*format & 255))
+ {
+ if (tptr < (tformat + sizeof(tformat) - 1))
+ *tptr++ = *format;
+
+ width = width * 10 + *format++ - '0';
+ }
+ }
+
+ if (*format == '.')
+ {
+ if (tptr < (tformat + sizeof(tformat) - 1))
+ *tptr++ = *format;
+
+ format ++;
+
+ if (*format == '*')
+ {
+ /*
+ * Get precision from argument...
+ */
+
+ format ++;
+ prec = va_arg(ap, int);
+
+ snprintf(tptr, sizeof(tformat) - (tptr - tformat), "%d", prec);
+ tptr += strlen(tptr);
+ }
+ else
+ {
+ prec = 0;
+
+ while (isdigit(*format & 255))
+ {
+ if (tptr < (tformat + sizeof(tformat) - 1))
+ *tptr++ = *format;
+
+ prec = prec * 10 + *format++ - '0';
+ }
+ }
+ }
+ else
+ prec = -1;
+
+ if (*format == 'l' && format[1] == 'l')
+ {
+ size = 'L';
+
+ if (tptr < (tformat + sizeof(tformat) - 2))
+ {
+ *tptr++ = 'l';
+ *tptr++ = 'l';
+ }
+
+ format += 2;
+ }
+ else if (*format == 'h' || *format == 'l' || *format == 'L')
+ {
+ if (tptr < (tformat + sizeof(tformat) - 1))
+ *tptr++ = *format;
+
+ size = *format++;
+ }
+
+ if (!*format)
+ break;
+
+ if (tptr < (tformat + sizeof(tformat) - 1))
+ *tptr++ = *format;
+
+ type = *format++;
+ *tptr = '\0';
+
+ switch (type)
+ {
+ case 'E' : /* Floating point formats */
+ case 'G' :
+ case 'e' :
+ case 'f' :
+ case 'g' :
+ if ((width + 2) > sizeof(temp))
+ break;
+
+ sprintf(temp, tformat, va_arg(ap, double));
+
+ bytes += strlen(temp);
+
+ if (bufptr)
+ {
+ if ((bufptr + strlen(temp)) > bufend)
+ {
+ strncpy(bufptr, temp, (size_t)(bufend - bufptr));
+ bufptr = bufend;
+ }
+ else
+ {
+ strcpy(bufptr, temp);
+ bufptr += strlen(temp);
+ }
+ }
+ break;
+
+ case 'B' : /* Integer formats */
+ case 'X' :
+ case 'b' :
+ case 'd' :
+ case 'i' :
+ case 'o' :
+ case 'u' :
+ case 'x' :
+ if ((width + 2) > sizeof(temp))
+ break;
+
+#ifdef HAVE_LONG_LONG
+ if (size == 'L')
+ sprintf(temp, tformat, va_arg(ap, long long));
+ else
+#endif /* HAVE_LONG_LONG */
+ sprintf(temp, tformat, va_arg(ap, int));
+
+ bytes += strlen(temp);
+
+ if (bufptr)
+ {
+ if ((bufptr + strlen(temp)) > bufend)
+ {
+ strncpy(bufptr, temp, (size_t)(bufend - bufptr));
+ bufptr = bufend;
+ }
+ else
+ {
+ strcpy(bufptr, temp);
+ bufptr += strlen(temp);
+ }
+ }
+ break;
+
+ case 'p' : /* Pointer value */
+ if ((width + 2) > sizeof(temp))
+ break;
+
+ sprintf(temp, tformat, va_arg(ap, void *));
+
+ bytes += strlen(temp);
+
+ if (bufptr)
+ {
+ if ((bufptr + strlen(temp)) > bufend)
+ {
+ strncpy(bufptr, temp, (size_t)(bufend - bufptr));
+ bufptr = bufend;
+ }
+ else
+ {
+ strcpy(bufptr, temp);
+ bufptr += strlen(temp);
+ }
+ }
+ break;
+
+ case 'c' : /* Character or character array */
+ bytes += width;
+
+ if (bufptr)
+ {
+ if (width <= 1)
+ *bufptr++ = va_arg(ap, int);
+ else
+ {
+ if ((bufptr + width) > bufend)
+ width = bufend - bufptr;
+
+ memcpy(bufptr, va_arg(ap, char *), (size_t)width);
+ bufptr += width;
+ }
+ }
+ break;
+
+ case 's' : /* String */
+ if ((s = va_arg(ap, char *)) == NULL)
+ s = "(null)";
+
+ slen = strlen(s);
+ if (slen > width && prec != width)
+ width = slen;
+
+ bytes += width;
+
+ if (bufptr)
+ {
+ if ((bufptr + width) > bufend)
+ width = bufend - bufptr;
+
+ if (slen > width)
+ slen = width;
+
+ if (sign == '-')
+ {
+ strncpy(bufptr, s, (size_t)slen);
+ memset(bufptr + slen, ' ', (size_t)(width - slen));
+ }
+ else
+ {
+ memset(bufptr, ' ', (size_t)(width - slen));
+ strncpy(bufptr + width - slen, s, (size_t)slen);
+ }
+
+ bufptr += width;
+ }
+ break;
+
+ case 'n' : /* Output number of chars so far */
+ *(va_arg(ap, int *)) = bytes;
+ break;
+ }
+ }
+ else
+ {
+ bytes ++;
+
+ if (bufptr && bufptr < bufend)
+ *bufptr++ = *format;
+
+ format ++;
+ }
+ }
+
+ /*
+ * Nul-terminate the string and return the number of characters needed.
+ */
+
+ *bufptr = '\0';
+
+ return (bytes);
+}
+#endif /* !HAVE_VSNPRINTF */
+
+
+/*
+ * '_mxml_vstrdupf()' - Format and duplicate a string.
+ */
+
+char * /* O - New string pointer */
+_mxml_vstrdupf(const char *format, /* I - Printf-style format string */
+ va_list ap) /* I - Pointer to additional arguments */
+{
+ int bytes; /* Number of bytes required */
+ char *buffer, /* String buffer */
+ temp[256]; /* Small buffer for first vsnprintf */
+
+
+ /*
+ * First format with a tiny buffer; this will tell us how many bytes are
+ * needed...
+ */
+
+ bytes = vsnprintf(temp, sizeof(temp), format, ap);
+
+ if (bytes < sizeof(temp))
+ {
+ /*
+ * Hey, the formatted string fits in the tiny buffer, so just dup that...
+ */
+
+ return (strdup(temp));
+ }
+
+ /*
+ * Allocate memory for the whole thing and reformat to the new, larger
+ * buffer...
+ */
+
+ if ((buffer = calloc(1, bytes + 1)) != NULL)
+ vsnprintf(buffer, bytes + 1, format, ap);
+
+ /*
+ * Return the new string...
+ */
+
+ return (buffer);
+}
+
+
+/*
+ * End of "$Id: mxml-string.c 387 2009-04-18 17:05:52Z mike $".
+ */
diff -Naur mxml-2.6/mxml.h mxml-2.6-haiku/mxml.h
--- mxml-2.6/mxml.h 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/mxml.h 2009-03-19 05:38:52.000000000 +0000
@@ -0,0 +1,308 @@
+/*
+ * "$Id: mxml.h 385 2009-03-19 05:38:52Z mike $"
+ *
+ * Header file for Mini-XML, a small XML-like file parsing library.
+ *
+ * Copyright 2003-2009 by Michael Sweet.
+ *
+ * This program is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU Library General Public
+ * License as published by the Free Software Foundation; either
+ * version 2, or (at your option) any later version.
+ *
+ * This program is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+ * GNU General Public License for more details.
+ */
+
+/*
+ * Prevent multiple inclusion...
+ */
+
+#ifndef _mxml_h_
+# define _mxml_h_
+
+/*
+ * Include necessary headers...
+ */
+
+# include <stdio.h>
+# include <stdlib.h>
+# include <string.h>
+# include <ctype.h>
+# include <errno.h>
+
+
+/*
+ * Constants...
+ */
+
+# define MXML_TAB 8 /* Tabs every N columns */
+
+# define MXML_NO_CALLBACK 0 /* Don't use a type callback */
+# define MXML_INTEGER_CALLBACK mxml_integer_cb
+ /* Treat all data as integers */
+# define MXML_OPAQUE_CALLBACK mxml_opaque_cb
+ /* Treat all data as opaque */
+# define MXML_REAL_CALLBACK mxml_real_cb
+ /* Treat all data as real numbers */
+# define MXML_TEXT_CALLBACK 0 /* Treat all data as text */
+# define MXML_IGNORE_CALLBACK mxml_ignore_cb
+ /* Ignore all non-element content */
+
+# define MXML_NO_PARENT 0 /* No parent for the node */
+
+# define MXML_DESCEND 1 /* Descend when finding/walking */
+# define MXML_NO_DESCEND 0 /* Don't descend when finding/walking */
+# define MXML_DESCEND_FIRST -1 /* Descend for first find */
+
+# define MXML_WS_BEFORE_OPEN 0 /* Callback for before open tag */
+# define MXML_WS_AFTER_OPEN 1 /* Callback for after open tag */
+# define MXML_WS_BEFORE_CLOSE 2 /* Callback for before close tag */
+# define MXML_WS_AFTER_CLOSE 3 /* Callback for after close tag */
+
+# define MXML_ADD_BEFORE 0 /* Add node before specified node */
+# define MXML_ADD_AFTER 1 /* Add node after specified node */
+# define MXML_ADD_TO_PARENT NULL /* Add node relative to parent */
+
+
+/*
+ * Data types...
+ */
+
+typedef enum mxml_sax_event_e /**** SAX event type. ****/
+{
+ MXML_SAX_CDATA, /* CDATA node */
+ MXML_SAX_COMMENT, /* Comment node */
+ MXML_SAX_DATA, /* Data node */
+ MXML_SAX_DIRECTIVE, /* Processing directive node */
+ MXML_SAX_ELEMENT_CLOSE, /* Element closed */
+ MXML_SAX_ELEMENT_OPEN /* Element opened */
+} mxml_sax_event_t;
+
+typedef enum mxml_type_e /**** The XML node type. ****/
+{
+ MXML_IGNORE = -1, /* Ignore/throw away node @since Mini-XML 2.3@ */
+ MXML_ELEMENT, /* XML element with attributes */
+ MXML_INTEGER, /* Integer value */
+ MXML_OPAQUE, /* Opaque string */
+ MXML_REAL, /* Real value */
+ MXML_TEXT, /* Text fragment */
+ MXML_CUSTOM /* Custom data @since Mini-XML 2.1@ */
+} mxml_type_t;
+
+typedef void (*mxml_custom_destroy_cb_t)(void *);
+ /**** Custom data destructor ****/
+
+typedef void (*mxml_error_cb_t)(const char *);
+ /**** Error callback function ****/
+
+typedef struct mxml_attr_s /**** An XML element attribute value. ****/
+{
+ char *name; /* Attribute name */
+ char *value; /* Attribute value */
+} mxml_attr_t;
+
+typedef struct mxml_element_s /**** An XML element value. ****/
+{
+ char *name; /* Name of element */
+ int num_attrs; /* Number of attributes */
+ mxml_attr_t *attrs; /* Attributes */
+} mxml_element_t;
+
+typedef struct mxml_text_s /**** An XML text value. ****/
+{
+ int whitespace; /* Leading whitespace? */
+ char *string; /* Fragment string */
+} mxml_text_t;
+
+typedef struct mxml_custom_s /**** An XML custom value. @since Mini-XML 2.1@ ****/
+{
+ void *data; /* Pointer to (allocated) custom data */
+ mxml_custom_destroy_cb_t destroy; /* Pointer to destructor function */
+} mxml_custom_t;
+
+typedef union mxml_value_u /**** An XML node value. ****/
+{
+ mxml_element_t element; /* Element */
+ int integer; /* Integer number */
+ char *opaque; /* Opaque string */
+ double real; /* Real number */
+ mxml_text_t text; /* Text fragment */
+ mxml_custom_t custom; /* Custom data @since Mini-XML 2.1@ */
+} mxml_value_t;
+
+typedef struct mxml_node_s /**** An XML node. ****/
+{
+ mxml_type_t type; /* Node type */
+ struct mxml_node_s *next; /* Next node under same parent */
+ struct mxml_node_s *prev; /* Previous node under same parent */
+ struct mxml_node_s *parent; /* Parent node */
+ struct mxml_node_s *child; /* First child node */
+ struct mxml_node_s *last_child; /* Last child node */
+ mxml_value_t value; /* Node value */
+ int ref_count; /* Use count */
+ void *user_data; /* User data */
+} mxml_node_t;
+
+typedef struct mxml_index_s /**** An XML node index. ****/
+{
+ char *attr; /* Attribute used for indexing or NULL */
+ int num_nodes; /* Number of nodes in index */
+ int alloc_nodes; /* Allocated nodes in index */
+ int cur_node; /* Current node */
+ mxml_node_t **nodes; /* Node array */
+} mxml_index_t;
+
+typedef int (*mxml_custom_load_cb_t)(mxml_node_t *, const char *);
+ /**** Custom data load callback function ****/
+
+typedef char *(*mxml_custom_save_cb_t)(mxml_node_t *);
+ /**** Custom data save callback function ****/
+
+typedef int (*mxml_entity_cb_t)(const char *);
+ /**** Entity callback function */
+
+typedef mxml_type_t (*mxml_load_cb_t)(mxml_node_t *);
+ /**** Load callback function ****/
+
+typedef const char *(*mxml_save_cb_t)(mxml_node_t *, int);
+ /**** Save callback function ****/
+
+typedef void (*mxml_sax_cb_t)(mxml_node_t *, mxml_sax_event_t, void *);
+ /**** SAX callback function ****/
+
+
+/*
+ * C++ support...
+ */
+
+# ifdef __cplusplus
+extern "C" {
+# endif /* __cplusplus */
+
+/*
+ * Prototypes...
+ */
+
+extern void mxmlAdd(mxml_node_t *parent, int where,
+ mxml_node_t *child, mxml_node_t *node);
+extern void mxmlDelete(mxml_node_t *node);
+extern void mxmlElementDeleteAttr(mxml_node_t *node,
+ const char *name);
+extern const char *mxmlElementGetAttr(mxml_node_t *node, const char *name);
+extern void mxmlElementSetAttr(mxml_node_t *node, const char *name,
+ const char *value);
+extern void mxmlElementSetAttrf(mxml_node_t *node, const char *name,
+ const char *format, ...)
+# ifdef __GNUC__
+__attribute__ ((__format__ (__printf__, 3, 4)))
+# endif /* __GNUC__ */
+;
+extern int mxmlEntityAddCallback(mxml_entity_cb_t cb);
+extern const char *mxmlEntityGetName(int val);
+extern int mxmlEntityGetValue(const char *name);
+extern void mxmlEntityRemoveCallback(mxml_entity_cb_t cb);
+extern mxml_node_t *mxmlFindElement(mxml_node_t *node, mxml_node_t *top,
+ const char *name, const char *attr,
+ const char *value, int descend);
+extern void mxmlIndexDelete(mxml_index_t *ind);
+extern mxml_node_t *mxmlIndexEnum(mxml_index_t *ind);
+extern mxml_node_t *mxmlIndexFind(mxml_index_t *ind,
+ const char *element,
+ const char *value);
+extern mxml_index_t *mxmlIndexNew(mxml_node_t *node, const char *element,
+ const char *attr);
+extern mxml_node_t *mxmlIndexReset(mxml_index_t *ind);
+extern mxml_node_t *mxmlLoadFd(mxml_node_t *top, int fd,
+ mxml_type_t (*cb)(mxml_node_t *));
+extern mxml_node_t *mxmlLoadFile(mxml_node_t *top, FILE *fp,
+ mxml_type_t (*cb)(mxml_node_t *));
+extern mxml_node_t *mxmlLoadString(mxml_node_t *top, const char *s,
+ mxml_type_t (*cb)(mxml_node_t *));
+extern mxml_node_t *mxmlNewCDATA(mxml_node_t *parent, const char *string);
+extern mxml_node_t *mxmlNewCustom(mxml_node_t *parent, void *data,
+ mxml_custom_destroy_cb_t destroy);
+extern mxml_node_t *mxmlNewElement(mxml_node_t *parent, const char *name);
+extern mxml_node_t *mxmlNewInteger(mxml_node_t *parent, int integer);
+extern mxml_node_t *mxmlNewOpaque(mxml_node_t *parent, const char *opaque);
+extern mxml_node_t *mxmlNewReal(mxml_node_t *parent, double real);
+extern mxml_node_t *mxmlNewText(mxml_node_t *parent, int whitespace,
+ const char *string);
+extern mxml_node_t *mxmlNewTextf(mxml_node_t *parent, int whitespace,
+ const char *format, ...)
+# ifdef __GNUC__
+__attribute__ ((__format__ (__printf__, 3, 4)))
+# endif /* __GNUC__ */
+;
+extern mxml_node_t *mxmlNewXML(const char *version);
+extern int mxmlRelease(mxml_node_t *node);
+extern void mxmlRemove(mxml_node_t *node);
+extern int mxmlRetain(mxml_node_t *node);
+extern char *mxmlSaveAllocString(mxml_node_t *node,
+ mxml_save_cb_t cb);
+extern int mxmlSaveFd(mxml_node_t *node, int fd,
+ mxml_save_cb_t cb);
+extern int mxmlSaveFile(mxml_node_t *node, FILE *fp,
+ mxml_save_cb_t cb);
+extern int mxmlSaveString(mxml_node_t *node, char *buffer,
+ int bufsize, mxml_save_cb_t cb);
+extern mxml_node_t *mxmlSAXLoadFd(mxml_node_t *top, int fd,
+ mxml_type_t (*cb)(mxml_node_t *),
+ mxml_sax_cb_t sax, void *sax_data);
+extern mxml_node_t *mxmlSAXLoadFile(mxml_node_t *top, FILE *fp,
+ mxml_type_t (*cb)(mxml_node_t *),
+ mxml_sax_cb_t sax, void *sax_data);
+extern mxml_node_t *mxmlSAXLoadString(mxml_node_t *top, const char *s,
+ mxml_type_t (*cb)(mxml_node_t *),
+ mxml_sax_cb_t sax, void *sax_data);
+extern int mxmlSetCDATA(mxml_node_t *node, const char *data);
+extern int mxmlSetCustom(mxml_node_t *node, void *data,
+ mxml_custom_destroy_cb_t destroy);
+extern void mxmlSetCustomHandlers(mxml_custom_load_cb_t load,
+ mxml_custom_save_cb_t save);
+extern int mxmlSetElement(mxml_node_t *node, const char *name);
+extern void mxmlSetErrorCallback(mxml_error_cb_t cb);
+extern int mxmlSetInteger(mxml_node_t *node, int integer);
+extern int mxmlSetOpaque(mxml_node_t *node, const char *opaque);
+extern int mxmlSetReal(mxml_node_t *node, double real);
+extern int mxmlSetText(mxml_node_t *node, int whitespace,
+ const char *string);
+extern int mxmlSetTextf(mxml_node_t *node, int whitespace,
+ const char *format, ...)
+# ifdef __GNUC__
+__attribute__ ((__format__ (__printf__, 3, 4)))
+# endif /* __GNUC__ */
+;
+extern void mxmlSetWrapMargin(int column);
+extern mxml_node_t *mxmlWalkNext(mxml_node_t *node, mxml_node_t *top,
+ int descend);
+extern mxml_node_t *mxmlWalkPrev(mxml_node_t *node, mxml_node_t *top,
+ int descend);
+
+
+/*
+ * Semi-private functions...
+ */
+
+extern void mxml_error(const char *format, ...);
+extern mxml_type_t mxml_ignore_cb(mxml_node_t *node);
+extern mxml_type_t mxml_integer_cb(mxml_node_t *node);
+extern mxml_type_t mxml_opaque_cb(mxml_node_t *node);
+extern mxml_type_t mxml_real_cb(mxml_node_t *node);
+
+
+/*
+ * C++ support...
+ */
+
+# ifdef __cplusplus
+}
+# endif /* __cplusplus */
+#endif /* !_mxml_h_ */
+
+
+/*
+ * End of "$Id: mxml.h 385 2009-03-19 05:38:52Z mike $".
+ */
diff -Naur mxml-2.6/mxml.list mxml-2.6-haiku/mxml.list
--- mxml-2.6/mxml.list 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/mxml.list 2009-10-26 02:28:22.000000000 +0000
@@ -0,0 +1,107 @@
+#
+# "$Id: mxml.list.in 399 2009-05-17 17:20:51Z mike $"
+#
+# EPM software list file for Mini-XML, a small XML library.
+#
+# Copyright 2003-2009 by Michael Sweet.
+#
+# This program is free software; you can redistribute it and/or
+# modify it under the terms of the GNU Library General Public
+# License as published by the Free Software Foundation; either
+# version 2, or (at your option) any later version.
+#
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+# GNU General Public License for more details.
+#
+
+# Directories...
+$prefix=/boot/common
+$exec_prefix=/boot/common
+$bindir=${exec_prefix}/bin
+$datarootdir=${prefix}/share
+$docdir=${datarootdir}/doc/mxml
+$includedir=${prefix}/include
+$libdir=${exec_prefix}/lib
+$mandir=${datarootdir}/man
+$srcdir=.
+
+$PICFLAG=0
+
+# Product information
+%product mxml
+%copyright 2003-2009 by Michael Sweet
+%vendor Michael Sweet
+%license ${srcdir}/COPYING
+%readme ${srcdir}/README
+%version 2.6
+
+%description <<EOF
+Mini-XML is a small XML parsing library that you can use to read
+XML and XML-like data files in your application without
+requiring large non-standard libraries. Mini-XML provides the
+following functionality:
+
+ - Reading of UTF-8 and UTF-16 and writing of UTF-8 encoded
+ XML files and strings.
+ - Data is stored in a linked-list tree structure, preserving
+ the XML data hierarchy.
+ - Supports arbitrary element names, attributes, and
+ attribute values with no preset limits, just available
+ memory.
+ - Supports integer, real, opaque ("cdata"), and text data
+ types in "leaf" nodes.
+ - Functions for creating and managing trees of data.
+ - "Find" and "walk" functions for easily locating and
+ navigating trees of data.
+
+Mini-XML doesn't do validation or other types of processing on
+the data based upon schema files or other sources of definition
+information, nor does it support character entities other than
+those required by the XML specification.
+EOF
+
+# Executables
+f 0555 root sys ${bindir}/mxmldoc mxmldoc
+
+# Header files
+f 0444 root sys ${includedir}/mxml.h mxml.h
+
+# Libraries
+%if $PICFLAG
+%system hpux
+f 0555 root sys ${libdir}/libmxml.sl.1 libmxml.sl.1
+l 0555 root sys ${libdir}/libmxml.sl libmxml.sl.1
+
+%system darwin
+f 0555 root sys ${libdir}/libmxml.1.dylib libmxml.1.dylib
+l 0555 root sys ${libdir}/libmxml.dylib libmxml.1.dylib
+
+%system freebsd irix linux netbsd openbsd solaris tru64
+f 0555 root sys ${libdir}/libmxml.so.1.4 libmxml.so.1.4
+l 0555 root sys ${libdir}/libmxml.so.1 libmxml.so.1.4
+l 0555 root sys ${libdir}/libmxml.so libmxml.so.1.4
+
+%system all
+%endif
+
+f 0444 root sys ${libdir}/libmxml.a libmxml.a
+
+# pkg-config info
+f 0444 root sys $(libdir)/pkgconfig/mxml.pc mxml.pc
+
+# Documentation
+f 0444 root sys ${docdir}/README $srcdir/README
+f 0444 root sys ${docdir}/COPYING $srcdir/COPYING
+f 0444 root sys ${docdir}/CHANGES $srcdir/CHANGES
+f 0444 root sys ${docdir}/mxml.html $srcdir/doc/mxml.html
+f 0444 root sys ${docdir}/mxml.pdf $srcdir/doc/mxml.pdf
+
+# Man pages
+f 0444 root sys ${mandir}/man1/mxmldoc.1 $srcdir/mxmldoc.man
+f 0444 root sys ${mandir}/man3/mxml.3 $srcdir/mxml.man
+
+#
+# End of "$Id: mxml.list.in 399 2009-05-17 17:20:51Z mike $".
+#
diff -Naur mxml-2.6/mxml.list.in mxml-2.6-haiku/mxml.list.in
--- mxml-2.6/mxml.list.in 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/mxml.list.in 2009-05-17 17:20:51.000000000 +0000
@@ -0,0 +1,107 @@
+#
+# "$Id: mxml.list.in 399 2009-05-17 17:20:51Z mike $"
+#
+# EPM software list file for Mini-XML, a small XML library.
+#
+# Copyright 2003-2009 by Michael Sweet.
+#
+# This program is free software; you can redistribute it and/or
+# modify it under the terms of the GNU Library General Public
+# License as published by the Free Software Foundation; either
+# version 2, or (at your option) any later version.
+#
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+# GNU General Public License for more details.
+#
+
+# Directories...
+$prefix=@prefix@
+$exec_prefix=@exec_prefix@
+$bindir=@bindir@
+$datarootdir=@datarootdir@
+$docdir=@docdir@
+$includedir=@includedir@
+$libdir=@libdir@
+$mandir=@mandir@
+$srcdir=@srcdir@
+
+$PICFLAG=@PICFLAG@
+
+# Product information
+%product mxml
+%copyright 2003-2009 by Michael Sweet
+%vendor Michael Sweet
+%license ${srcdir}/COPYING
+%readme ${srcdir}/README
+%version @VERSION@
+
+%description <<EOF
+Mini-XML is a small XML parsing library that you can use to read
+XML and XML-like data files in your application without
+requiring large non-standard libraries. Mini-XML provides the
+following functionality:
+
+ - Reading of UTF-8 and UTF-16 and writing of UTF-8 encoded
+ XML files and strings.
+ - Data is stored in a linked-list tree structure, preserving
+ the XML data hierarchy.
+ - Supports arbitrary element names, attributes, and
+ attribute values with no preset limits, just available
+ memory.
+ - Supports integer, real, opaque ("cdata"), and text data
+ types in "leaf" nodes.
+ - Functions for creating and managing trees of data.
+ - "Find" and "walk" functions for easily locating and
+ navigating trees of data.
+
+Mini-XML doesn't do validation or other types of processing on
+the data based upon schema files or other sources of definition
+information, nor does it support character entities other than
+those required by the XML specification.
+EOF
+
+# Executables
+f 0555 root sys ${bindir}/mxmldoc mxmldoc
+
+# Header files
+f 0444 root sys ${includedir}/mxml.h mxml.h
+
+# Libraries
+%if $PICFLAG
+%system hpux
+f 0555 root sys ${libdir}/libmxml.sl.1 libmxml.sl.1
+l 0555 root sys ${libdir}/libmxml.sl libmxml.sl.1
+
+%system darwin
+f 0555 root sys ${libdir}/libmxml.1.dylib libmxml.1.dylib
+l 0555 root sys ${libdir}/libmxml.dylib libmxml.1.dylib
+
+%system freebsd irix linux netbsd openbsd solaris tru64
+f 0555 root sys ${libdir}/libmxml.so.1.4 libmxml.so.1.4
+l 0555 root sys ${libdir}/libmxml.so.1 libmxml.so.1.4
+l 0555 root sys ${libdir}/libmxml.so libmxml.so.1.4
+
+%system all
+%endif
+
+f 0444 root sys ${libdir}/libmxml.a libmxml.a
+
+# pkg-config info
+f 0444 root sys $(libdir)/pkgconfig/mxml.pc mxml.pc
+
+# Documentation
+f 0444 root sys ${docdir}/README $srcdir/README
+f 0444 root sys ${docdir}/COPYING $srcdir/COPYING
+f 0444 root sys ${docdir}/CHANGES $srcdir/CHANGES
+f 0444 root sys ${docdir}/mxml.html $srcdir/doc/mxml.html
+f 0444 root sys ${docdir}/mxml.pdf $srcdir/doc/mxml.pdf
+
+# Man pages
+f 0444 root sys ${mandir}/man1/mxmldoc.1 $srcdir/mxmldoc.man
+f 0444 root sys ${mandir}/man3/mxml.3 $srcdir/mxml.man
+
+#
+# End of "$Id: mxml.list.in 399 2009-05-17 17:20:51Z mike $".
+#
diff -Naur mxml-2.6/mxml.pc mxml-2.6-haiku/mxml.pc
--- mxml-2.6/mxml.pc 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/mxml.pc 2009-10-26 02:28:22.000000000 +0000
@@ -0,0 +1,10 @@
+prefix=/boot/common
+exec_prefix=/boot/common
+libdir=${exec_prefix}/lib
+includedir=${prefix}/include
+
+Name: Mini-XML
+Description: Lightweight XML support library
+Version: 2.6
+Libs: -L${exec_prefix}/lib -lmxml -pthread
+Cflags: -I${prefix}/include -D_THREAD_SAFE -D_REENTRANT
diff -Naur mxml-2.6/mxml.pc.in mxml-2.6-haiku/mxml.pc.in
--- mxml-2.6/mxml.pc.in 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/mxml.pc.in 2008-03-21 04:31:07.000000000 +0000
@@ -0,0 +1,10 @@
+prefix=@prefix@
+exec_prefix=@exec_prefix@
+libdir=@libdir@
+includedir=@includedir@
+
+Name: Mini-XML
+Description: Lightweight XML support library
+Version: @VERSION@
+Libs: @PC_LIBS@ @PTHREAD_LIBS@
+Cflags: @PC_CFLAGS@ @PTHREAD_FLAGS@
diff -Naur mxml-2.6/mxml.spec mxml-2.6-haiku/mxml.spec
--- mxml-2.6/mxml.spec 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/mxml.spec 2009-05-17 17:20:51.000000000 +0000
@@ -0,0 +1,95 @@
+#
+# "$Id: mxml.spec 399 2009-05-17 17:20:51Z mike $"
+#
+# RPM "spec" file for Mini-XML, a small XML library.
+#
+# Copyright 2003-2009 by Michael Sweet.
+#
+# This program is free software; you can redistribute it and/or
+# modify it under the terms of the GNU Library General Public
+# License as published by the Free Software Foundation; either
+# version 2, or (at your option) any later version.
+#
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+# GNU General Public License for more details.
+#
+
+Summary: Miniature XML development library
+Name: mxml
+Version: 2.6
+Release: 1
+License: LGPL
+Group: Development/Libraries
+Source: http://www.easysw.com/~mike/mxml/mxml-%{version}.tar.gz
+Url: http://www.easysw.com/~mike/mxml/
+Packager: Michael Sweet <mxml@easysw.com>
+Vendor: Michael Sweet
+
+# Use buildroot so as not to disturb the version already installed
+BuildRoot: /var/tmp/%{name}-root
+
+%description
+Mini-XML is a small XML parsing library that you can use to read
+XML and XML-like data files in your application without
+requiring large non-standard libraries. Mini-XML provides the
+following functionality:
+
+ - Reading of UTF-8 and UTF-16 and writing of UTF-8 encoded
+ XML files and strings.
+ - Data is stored in a linked-list tree structure, preserving
+ the XML data hierarchy.
+ - Supports arbitrary element names, attributes, and
+ attribute values with no preset limits, just available
+ memory.
+ - Supports integer, real, opaque ("cdata"), and text data
+ types in "leaf" nodes.
+ - Functions for creating and managing trees of data.
+ - "Find" and "walk" functions for easily locating and
+ navigating trees of data.
+
+Mini-XML doesn't do validation or other types of processing on
+the data based upon schema files or other sources of definition
+information, nor does it support character entities other than
+those required by the XML specification.
+
+%prep
+%setup
+
+%build
+CFLAGS="$RPM_OPT_FLAGS" CXXFLAGS="$RPM_OPT_FLAGS" LDFLAGS="$RPM_OPT_FLAGS" ./configure --enable-shared --prefix=/usr
+
+# If we got this far, all prerequisite libraries must be here.
+make
+
+%install
+# Make sure the RPM_BUILD_ROOT directory exists.
+rm -rf $RPM_BUILD_ROOT
+
+make BUILDROOT=$RPM_BUILD_ROOT install
+
+%clean
+rm -rf $RPM_BUILD_ROOT
+
+%files
+%defattr(-,root,root)
+
+%dir /usr/bin
+/usr/bin/*
+%dir /usr/include
+/usr/include/mxml.h
+%dir /usr/lib
+/usr/lib/*
+%dir /usr/lib/pkgconfig
+/usr/lib/pkgconfig/mxml.pc
+%dir /usr/share/doc/mxml
+/usr/share/doc/mxml/*
+%dir /usr/share/man/man1
+/usr/share/man/man1/*
+%dir /usr/share/man/man3
+/usr/share/man/man3/*
+
+#
+# End of "$Id: mxml.spec 399 2009-05-17 17:20:51Z mike $".
+#
diff -Naur mxml-2.6/mxmldoc.c mxml-2.6-haiku/mxmldoc.c
--- mxml-2.6/mxmldoc.c 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/mxmldoc.c 2009-05-05 13:38:00.000000000 +0000
@@ -0,0 +1,5772 @@
+/*#define DEBUG 1*/
+/*
+ * "$Id: mxmldoc.c 390 2009-05-05 13:38:00Z mike $"
+ *
+ * Documentation generator using Mini-XML, a small XML-like file parsing
+ * library.
+ *
+ * Copyright 2003-2009 by Michael Sweet.
+ *
+ * This program is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU Library General Public
+ * License as published by the Free Software Foundation; either
+ * version 2, or (at your option) any later version.
+ *
+ * This program is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+ * GNU General Public License for more details.
+ *
+ * Contents:
+ *
+ * main() - Main entry for test program.
+ * add_variable() - Add a variable or argument.
+ * find_public() - Find a public function, type, etc.
+ * get_comment_info() - Get info from comment.
+ * get_text() - Get the text for a node.
+ * load_cb() - Set the type of child nodes.
+ * new_documentation() - Create a new documentation tree.
+ * remove_directory() - Remove a directory.
+ * safe_strcpy() - Copy a string allowing for overlapping strings.
+ * scan_file() - Scan a source file.
+ * sort_node() - Insert a node sorted into a tree.
+ * update_comment() - Update a comment node.
+ * usage() - Show program usage...
+ * write_description() - Write the description text.
+ * write_element() - Write an element's text nodes.
+ * write_file() - Copy a file to the output.
+ * write_function() - Write documentation for a function.
+ * write_html() - Write HTML documentation.
+ * write_html_head() - Write the standard HTML header.
+ * write_man() - Write manpage documentation.
+ * write_scu() - Write a structure, class, or union.
+ * write_string() - Write a string, quoting HTML special chars as needed.
+ * write_toc() - Write a table-of-contents.
+ * write_tokens() - Write <Token> nodes for all APIs.
+ * ws_cb() - Whitespace callback for saving.
+ */
+
+/*
+ * Include necessary headers...
+ */
+
+#include "config.h"
+#include "mxml.h"
+#include <time.h>
+#include <sys/stat.h>
+#ifndef WIN32
+# include <dirent.h>
+# include <unistd.h>
+# include <spawn.h>
+# include <sys/wait.h>
+extern char **environ;
+#endif /* !WIN32 */
+
+
+/*
+ * This program scans source and header files and produces public API
+ * documentation for code that conforms to the CUPS Configuration
+ * Management Plan (CMP) coding standards. Please see the following web
+ * page for details:
+ *
+ * http://www.cups.org/cmp.html
+ *
+ * Using Mini-XML, this program creates and maintains an XML representation
+ * of the public API code documentation which can then be converted to HTML
+ * as desired. The following is a poor-man's schema:
+ *
+ * <?xml version="1.0"?>
+ * <mxmldoc xmlns="http://www.easysw.com"
+ * xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"
+ * xsi:schemaLocation="http://www.minixml.org/mxmldoc.xsd">
+ *
+ * <namespace name=""> [optional...]
+ * <constant name="">
+ * <description>descriptive text</description>
+ * </constant>
+ *
+ * <enumeration name="">
+ * <description>descriptive text</description>
+ * <constant name="">...</constant>
+ * </enumeration>
+ *
+ * <typedef name="">
+ * <description>descriptive text</description>
+ * <type>type string</type>
+ * </typedef>
+ *
+ * <function name="" scope="">
+ * <description>descriptive text</description>
+ * <argument name="" direction="I|O|IO" default="">
+ * <description>descriptive text</description>
+ * <type>type string</type>
+ * </argument>
+ * <returnvalue>
+ * <description>descriptive text</description>
+ * <type>type string</type>
+ * </returnvalue>
+ * <seealso>function names separated by spaces</seealso>
+ * </function>
+ *
+ * <variable name="" scope="">
+ * <description>descriptive text</description>
+ * <type>type string</type>
+ * </variable>
+ *
+ * <struct name="">
+ * <description>descriptive text</description>
+ * <variable name="">...</variable>
+ * <function name="">...</function>
+ * </struct>
+ *
+ * <union name="">
+ * <description>descriptive text</description>
+ * <variable name="">...</variable>
+ * </union>
+ *
+ * <class name="" parent="">
+ * <description>descriptive text</description>
+ * <class name="">...</class>
+ * <enumeration name="">...</enumeration>
+ * <function name="">...</function>
+ * <struct name="">...</struct>
+ * <variable name="">...</variable>
+ * </class>
+ * </namespace>
+ * </mxmldoc>
+ */
+
+
+/*
+ * Basic states for file parser...
+ */
+
+#define STATE_NONE 0 /* No state - whitespace, etc. */
+#define STATE_PREPROCESSOR 1 /* Preprocessor directive */
+#define STATE_C_COMMENT 2 /* Inside a C comment */
+#define STATE_CXX_COMMENT 3 /* Inside a C++ comment */
+#define STATE_STRING 4 /* Inside a string constant */
+#define STATE_CHARACTER 5 /* Inside a character constant */
+#define STATE_IDENTIFIER 6 /* Inside a keyword/identifier */
+
+
+/*
+ * Output modes...
+ */
+
+#define OUTPUT_NONE 0 /* No output */
+#define OUTPUT_HTML 1 /* Output HTML */
+#define OUTPUT_XML 2 /* Output XML */
+#define OUTPUT_MAN 3 /* Output nroff/man */
+#define OUTPUT_TOKENS 4 /* Output docset Tokens.xml file */
+
+
+/*
+ * Local functions...
+ */
+
+static mxml_node_t *add_variable(mxml_node_t *parent, const char *name,
+ mxml_node_t *type);
+static mxml_node_t *find_public(mxml_node_t *node, mxml_node_t *top,
+ const char *name);
+static char *get_comment_info(mxml_node_t *description);
+static char *get_text(mxml_node_t *node, char *buffer, int buflen);
+static mxml_type_t load_cb(mxml_node_t *node);
+static mxml_node_t *new_documentation(mxml_node_t **mxmldoc);
+static int remove_directory(const char *path);
+static void safe_strcpy(char *dst, const char *src);
+static int scan_file(const char *filename, FILE *fp,
+ mxml_node_t *doc);
+static void sort_node(mxml_node_t *tree, mxml_node_t *func);
+static void update_comment(mxml_node_t *parent,
+ mxml_node_t *comment);
+static void usage(const char *option);
+static void write_description(FILE *out, mxml_node_t *description,
+ const char *element, int summary);
+static void write_element(FILE *out, mxml_node_t *doc,
+ mxml_node_t *element, int mode);
+static void write_file(FILE *out, const char *file);
+static void write_function(FILE *out, mxml_node_t *doc,
+ mxml_node_t *function, int level);
+static void write_html(const char *section, const char *title,
+ const char *footerfile,
+ const char *headerfile,
+ const char *introfile, const char *cssfile,
+ const char *framefile,
+ const char *docset, const char *docversion,
+ const char *feedname, const char *feedurl,
+ mxml_node_t *doc);
+static void write_html_head(FILE *out, const char *section,
+ const char *title, const char *cssfile);
+static void write_man(const char *man_name, const char *section,
+ const char *title, const char *headerfile,
+ const char *footerfile, const char *introfile,
+ mxml_node_t *doc);
+static void write_scu(FILE *out, mxml_node_t *doc,
+ mxml_node_t *scut);
+static void write_string(FILE *out, const char *s, int mode);
+static void write_toc(FILE *out, mxml_node_t *doc,
+ const char *introfile, const char *target,
+ int xml);
+static void write_tokens(FILE *out, mxml_node_t *doc,
+ const char *path);
+static const char *ws_cb(mxml_node_t *node, int where);
+
+
+/*
+ * 'main()' - Main entry for test program.
+ */
+
+int /* O - Exit status */
+main(int argc, /* I - Number of command-line args */
+ char *argv[]) /* I - Command-line args */
+{
+ int i; /* Looping var */
+ int len; /* Length of argument */
+ FILE *fp; /* File to read */
+ mxml_node_t *doc; /* XML documentation tree */
+ mxml_node_t *mxmldoc; /* mxmldoc node */
+ const char *cssfile, /* CSS stylesheet file */
+ *docset, /* Documentation set directory */
+ *docversion, /* Documentation set version */
+ *feedname, /* Feed name for documentation set */
+ *feedurl, /* Feed URL for documentation set */
+ *footerfile, /* Footer file */
+ *framefile, /* Framed HTML basename */
+ *headerfile, /* Header file */
+ *introfile, /* Introduction file */
+ *name, /* Name of manpage */
+ *path, /* Path to help file for tokens */
+ *section, /* Section/keywords of documentation */
+ *title, /* Title of documentation */
+ *xmlfile; /* XML file */
+ int mode, /* Output mode */
+ update; /* Updated XML file */
+
+
+ /*
+ * Check arguments...
+ */
+
+ cssfile = NULL;
+ doc = NULL;
+ docset = NULL;
+ docversion = NULL;
+ feedname = NULL;
+ feedurl = NULL;
+ footerfile = NULL;
+ framefile = NULL;
+ headerfile = NULL;
+ introfile = NULL;
+ mode = OUTPUT_HTML;
+ mxmldoc = NULL;
+ name = NULL;
+ path = NULL;
+ section = NULL;
+ title = NULL;
+ update = 0;
+ xmlfile = NULL;
+
+ for (i = 1; i < argc; i ++)
+ if (!strcmp(argv[i], "--help"))
+ {
+ /*
+ * Show help...
+ */
+
+ usage(NULL);
+ }
+ else if (!strcmp(argv[i], "--css") && !cssfile)
+ {
+ /*
+ * Set CSS stylesheet file...
+ */
+
+ i ++;
+ if (i < argc)
+ cssfile = argv[i];
+ else
+ usage(NULL);
+ }
+ else if (!strcmp(argv[i], "--docset") && !docset)
+ {
+ /*
+ * Set documentation set directory...
+ */
+
+ i ++;
+ if (i < argc)
+ docset = argv[i];
+ else
+ usage(NULL);
+ }
+ else if (!strcmp(argv[i], "--docversion") && !docversion)
+ {
+ /*
+ * Set documentation set directory...
+ */
+
+ i ++;
+ if (i < argc)
+ docversion = argv[i];
+ else
+ usage(NULL);
+ }
+ else if (!strcmp(argv[i], "--footer") && !footerfile)
+ {
+ /*
+ * Set footer file...
+ */
+
+ i ++;
+ if (i < argc)
+ footerfile = argv[i];
+ else
+ usage(NULL);
+ }
+ else if (!strcmp(argv[i], "--feedname") && !feedname)
+ {
+ /*
+ * Set documentation set feed name...
+ */
+
+ i ++;
+ if (i < argc)
+ feedname = argv[i];
+ else
+ usage(NULL);
+ }
+ else if (!strcmp(argv[i], "--feedurl") && !feedurl)
+ {
+ /*
+ * Set documentation set feed name...
+ */
+
+ i ++;
+ if (i < argc)
+ feedurl = argv[i];
+ else
+ usage(NULL);
+ }
+ else if (!strcmp(argv[i], "--framed") && !framefile)
+ {
+ /*
+ * Set base filename for framed HTML output...
+ */
+
+ i ++;
+ if (i < argc)
+ framefile = argv[i];
+ else
+ usage(NULL);
+ }
+ else if (!strcmp(argv[i], "--header") && !headerfile)
+ {
+ /*
+ * Set header file...
+ */
+
+ i ++;
+ if (i < argc)
+ headerfile = argv[i];
+ else
+ usage(NULL);
+ }
+ else if (!strcmp(argv[i], "--intro") && !introfile)
+ {
+ /*
+ * Set intro file...
+ */
+
+ i ++;
+ if (i < argc)
+ introfile = argv[i];
+ else
+ usage(NULL);
+ }
+ else if (!strcmp(argv[i], "--man") && !name)
+ {
+ /*
+ * Output manpage...
+ */
+
+ i ++;
+ if (i < argc)
+ {
+ mode = OUTPUT_MAN;
+ name = argv[i];
+ }
+ else
+ usage(NULL);
+ }
+ else if (!strcmp(argv[i], "--no-output"))
+ mode = OUTPUT_NONE;
+ else if (!strcmp(argv[i], "--section") && !section)
+ {
+ /*
+ * Set section/keywords...
+ */
+
+ i ++;
+ if (i < argc)
+ section = argv[i];
+ else
+ usage(NULL);
+ }
+ else if (!strcmp(argv[i], "--title") && !title)
+ {
+ /*
+ * Set title...
+ */
+
+ i ++;
+ if (i < argc)
+ title = argv[i];
+ else
+ usage(NULL);
+ }
+ else if (!strcmp(argv[i], "--tokens"))
+ {
+ /*
+ * Output Tokens.xml file...
+ */
+
+ mode = OUTPUT_TOKENS;
+
+ i ++;
+ if (i < argc)
+ path = argv[i];
+ else
+ usage(NULL);
+ }
+ else if (argv[i][0] == '-')
+ {
+ /*
+ * Unknown/bad option...
+ */
+
+ usage(argv[i]);
+ }
+ else
+ {
+ /*
+ * Process XML or source file...
+ */
+
+ len = (int)strlen(argv[i]);
+ if (len > 4 && !strcmp(argv[i] + len - 4, ".xml"))
+ {
+ /*
+ * Set XML file...
+ */
+
+ if (xmlfile)
+ usage(NULL);
+
+ xmlfile = argv[i];
+
+ if (!doc)
+ {
+ if ((fp = fopen(argv[i], "r")) != NULL)
+ {
+ /*
+ * Read the existing XML file...
+ */
+
+ doc = mxmlLoadFile(NULL, fp, load_cb);
+
+ fclose(fp);
+
+ if (!doc)
+ {
+ mxmldoc = NULL;
+
+ fprintf(stderr,
+ "mxmldoc: Unable to read the XML documentation file "
+ "\"%s\"!\n", argv[i]);
+ }
+ else if ((mxmldoc = mxmlFindElement(doc, doc, "mxmldoc", NULL,
+ NULL, MXML_DESCEND)) == NULL)
+ {
+ fprintf(stderr,
+ "mxmldoc: XML documentation file \"%s\" is missing "
+ "<mxmldoc> node!!\n", argv[i]);
+
+ mxmlDelete(doc);
+ doc = NULL;
+ }
+ }
+ else
+ {
+ doc = NULL;
+ mxmldoc = NULL;
+ }
+
+ if (!doc)
+ doc = new_documentation(&mxmldoc);
+ }
+ }
+ else
+ {
+ /*
+ * Load source file...
+ */
+
+ update = 1;
+
+ if (!doc)
+ doc = new_documentation(&mxmldoc);
+
+ if ((fp = fopen(argv[i], "r")) == NULL)
+ {
+ fprintf(stderr, "mxmldoc: Unable to open source file \"%s\": %s\n",
+ argv[i], strerror(errno));
+ mxmlDelete(doc);
+ return (1);
+ }
+ else if (scan_file(argv[i], fp, mxmldoc))
+ {
+ fclose(fp);
+ mxmlDelete(doc);
+ return (1);
+ }
+ else
+ fclose(fp);
+ }
+ }
+
+ if (update && xmlfile)
+ {
+ /*
+ * Save the updated XML documentation file...
+ */
+
+ if ((fp = fopen(xmlfile, "w")) != NULL)
+ {
+ /*
+ * Write over the existing XML file...
+ */
+
+ mxmlSetWrapMargin(0);
+
+ if (mxmlSaveFile(doc, fp, ws_cb))
+ {
+ fprintf(stderr,
+ "mxmldoc: Unable to write the XML documentation file \"%s\": "
+ "%s!\n", xmlfile, strerror(errno));
+ fclose(fp);
+ mxmlDelete(doc);
+ return (1);
+ }
+
+ fclose(fp);
+ }
+ else
+ {
+ fprintf(stderr,
+ "mxmldoc: Unable to create the XML documentation file \"%s\": "
+ "%s!\n", xmlfile, strerror(errno));
+ mxmlDelete(doc);
+ return (1);
+ }
+ }
+
+ switch (mode)
+ {
+ case OUTPUT_HTML :
+ /*
+ * Write HTML documentation...
+ */
+
+ write_html(section, title ? title : "Documentation", footerfile,
+ headerfile, introfile, cssfile, framefile, docset,
+ docversion, feedname, feedurl, mxmldoc);
+ break;
+
+ case OUTPUT_MAN :
+ /*
+ * Write manpage documentation...
+ */
+
+ write_man(name, section, title, footerfile, headerfile, introfile,
+ mxmldoc);
+ break;
+
+ case OUTPUT_TOKENS :
+ fputs("<?xml version=\"1.0\" encoding=\"UTF-8\"?>\n"
+ "<Tokens version=\"1.0\">\n", stdout);
+
+ write_tokens(stdout, mxmldoc, path);
+
+ fputs("</Tokens>\n", stdout);
+ break;
+ }
+
+ /*
+ * Delete the tree and return...
+ */
+
+ mxmlDelete(doc);
+
+ return (0);
+}
+
+
+/*
+ * 'add_variable()' - Add a variable or argument.
+ */
+
+static mxml_node_t * /* O - New variable/argument */
+add_variable(mxml_node_t *parent, /* I - Parent node */
+ const char *name, /* I - "argument" or "variable" */
+ mxml_node_t *type) /* I - Type nodes */
+{
+ mxml_node_t *variable, /* New variable */
+ *node, /* Current node */
+ *next; /* Next node */
+ char buffer[16384], /* String buffer */
+ *bufptr; /* Pointer into buffer */
+
+
+#ifdef DEBUG
+ fprintf(stderr, "add_variable(parent=%p, name=\"%s\", type=%p)\n",
+ parent, name, type);
+#endif /* DEBUG */
+
+ /*
+ * Range check input...
+ */
+
+ if (!type || !type->child)
+ return (NULL);
+
+ /*
+ * Create the variable/argument node...
+ */
+
+ variable = mxmlNewElement(parent, name);
+
+ /*
+ * Check for a default value...
+ */
+
+ for (node = type->child; node; node = node->next)
+ if (!strcmp(node->value.text.string, "="))
+ break;
+
+ if (node)
+ {
+ /*
+ * Default value found, copy it and add as a "default" attribute...
+ */
+
+ for (bufptr = buffer; node; bufptr += strlen(bufptr))
+ {
+ if (node->value.text.whitespace && bufptr > buffer)
+ *bufptr++ = ' ';
+
+ strcpy(bufptr, node->value.text.string);
+
+ next = node->next;
+ mxmlDelete(node);
+ node = next;
+ }
+
+ mxmlElementSetAttr(variable, "default", buffer);
+ }
+
+ /*
+ * Extract the argument/variable name...
+ */
+
+ if (type->last_child->value.text.string[0] == ')')
+ {
+ /*
+ * Handle "type (*name)(args)"...
+ */
+
+ for (node = type->child; node; node = node->next)
+ if (node->value.text.string[0] == '(')
+ break;
+
+ for (bufptr = buffer; node; bufptr += strlen(bufptr))
+ {
+ if (node->value.text.whitespace && bufptr > buffer)
+ *bufptr++ = ' ';
+
+ strcpy(bufptr, node->value.text.string);
+
+ next = node->next;
+ mxmlDelete(node);
+ node = next;
+ }
+ }
+ else
+ {
+ /*
+ * Handle "type name"...
+ */
+
+ strcpy(buffer, type->last_child->value.text.string);
+ mxmlDelete(type->last_child);
+ }
+
+ /*
+ * Set the name...
+ */
+
+ mxmlElementSetAttr(variable, "name", buffer);
+
+ /*
+ * Add the remaining type information to the variable node...
+ */
+
+ mxmlAdd(variable, MXML_ADD_AFTER, MXML_ADD_TO_PARENT, type);
+
+ /*
+ * Add new new variable node...
+ */
+
+ return (variable);
+}
+
+
+/*
+ * 'find_public()' - Find a public function, type, etc.
+ */
+
+static mxml_node_t * /* I - Found node or NULL */
+find_public(mxml_node_t *node, /* I - Current node */
+ mxml_node_t *top, /* I - Top node */
+ const char *name) /* I - Name of element */
+{
+ mxml_node_t *description, /* Description node */
+ *comment; /* Comment node */
+
+
+ for (node = mxmlFindElement(node, top, name, NULL, NULL,
+ node == top ? MXML_DESCEND_FIRST :
+ MXML_NO_DESCEND);
+ node;
+ node = mxmlFindElement(node, top, name, NULL, NULL, MXML_NO_DESCEND))
+ {
+ /*
+ * Get the description for this node...
+ */
+
+ description = mxmlFindElement(node, node, "description", NULL, NULL,
+ MXML_DESCEND_FIRST);
+
+ /*
+ * A missing or empty description signals a private node...
+ */
+
+ if (!description)
+ continue;
+
+ /*
+ * Look for @private@ in the comment text...
+ */
+
+ for (comment = description->child; comment; comment = comment->next)
+ if ((comment->type == MXML_TEXT &&
+ strstr(comment->value.text.string, "@private@")) ||
+ (comment->type == MXML_OPAQUE &&
+ strstr(comment->value.opaque, "@private@")))
+ break;
+
+ if (!comment)
+ {
+ /*
+ * No @private@, so return this node...
+ */
+
+ return (node);
+ }
+ }
+
+ /*
+ * If we get here, there are no (more) public nodes...
+ */
+
+ return (NULL);
+}
+
+
+/*
+ * 'get_comment_info()' - Get info from comment.
+ */
+
+static char * /* O - Info from comment */
+get_comment_info(
+ mxml_node_t *description) /* I - Description node */
+{
+ char text[10240], /* Description text */
+ since[255], /* @since value */
+ *ptr; /* Pointer into text */
+ static char info[1024]; /* Info string */
+
+
+ if (!description)
+ return ("");
+
+ get_text(description, text, sizeof(text));
+
+ for (ptr = strchr(text, '@'); ptr; ptr = strchr(ptr + 1, '@'))
+ {
+ if (!strncmp(ptr, "@deprecated@", 12))
+ return ("<span class=\"info\">&nbsp;DEPRECATED&nbsp;</span>");
+ else if (!strncmp(ptr, "@since ", 7))
+ {
+ strncpy(since, ptr + 7, sizeof(since) - 1);
+ since[sizeof(since) - 1] = '\0';
+
+ if ((ptr = strchr(since, '@')) != NULL)
+ *ptr = '\0';
+
+ snprintf(info, sizeof(info), "<span class=\"info\">&nbsp;%s&nbsp;</span>", since);
+ return (info);
+ }
+ }
+
+ return ("");
+}
+
+
+/*
+ * 'get_text()' - Get the text for a node.
+ */
+
+static char * /* O - Text in node */
+get_text(mxml_node_t *node, /* I - Node to get */
+ char *buffer, /* I - Buffer */
+ int buflen) /* I - Size of buffer */
+{
+ char *ptr, /* Pointer into buffer */
+ *end; /* End of buffer */
+ int len; /* Length of node */
+ mxml_node_t *current; /* Current node */
+
+
+ ptr = buffer;
+ end = buffer + buflen - 1;
+
+ for (current = node->child; current && ptr < end; current = current->next)
+ {
+ if (current->type == MXML_TEXT)
+ {
+ if (current->value.text.whitespace)
+ *ptr++ = ' ';
+
+ len = (int)strlen(current->value.text.string);
+ if (len > (int)(end - ptr))
+ len = (int)(end - ptr);
+
+ memcpy(ptr, current->value.text.string, len);
+ ptr += len;
+ }
+ else if (current->type == MXML_OPAQUE)
+ {
+ len = (int)strlen(current->value.opaque);
+ if (len > (int)(end - ptr))
+ len = (int)(end - ptr);
+
+ memcpy(ptr, current->value.opaque, len);
+ ptr += len;
+ }
+ }
+
+ *ptr = '\0';
+
+ return (buffer);
+}
+
+
+/*
+ * 'load_cb()' - Set the type of child nodes.
+ */
+
+static mxml_type_t /* O - Node type */
+load_cb(mxml_node_t *node) /* I - Node */
+{
+ if (!strcmp(node->value.element.name, "description"))
+ return (MXML_OPAQUE);
+ else
+ return (MXML_TEXT);
+}
+
+
+/*
+ * 'new_documentation()' - Create a new documentation tree.
+ */
+
+static mxml_node_t * /* O - New documentation */
+new_documentation(mxml_node_t **mxmldoc)/* O - mxmldoc node */
+{
+ mxml_node_t *doc; /* New documentation */
+
+
+ /*
+ * Create an empty XML documentation file...
+ */
+
+ doc = mxmlNewXML(NULL);
+
+ *mxmldoc = mxmlNewElement(doc, "mxmldoc");
+
+ mxmlElementSetAttr(*mxmldoc, "xmlns", "http://www.easysw.com");
+ mxmlElementSetAttr(*mxmldoc, "xmlns:xsi",
+ "http://www.w3.org/2001/XMLSchema-instance");
+ mxmlElementSetAttr(*mxmldoc, "xsi:schemaLocation",
+ "http://www.minixml.org/mxmldoc.xsd");
+
+ return (doc);
+}
+
+
+/*
+ * 'remove_directory()' - Remove a directory.
+ */
+
+static int /* O - 1 on success, 0 on failure */
+remove_directory(const char *path) /* I - Directory to remove */
+{
+#ifdef WIN32
+ /* TODO: Add Windows directory removal code */
+
+#else
+ DIR *dir; /* Directory */
+ struct dirent *dent; /* Current directory entry */
+ char filename[1024]; /* Current filename */
+ struct stat fileinfo; /* File information */
+
+
+ if ((dir = opendir(path)) == NULL)
+ {
+ fprintf(stderr, "mxmldoc: Unable to open directory \"%s\": %s\n", path,
+ strerror(errno));
+ return (0);
+ }
+
+ while ((dent = readdir(dir)) != NULL)
+ {
+ /*
+ * Skip "." and ".."...
+ */
+
+ if (!strcmp(dent->d_name, ".") || !strcmp(dent->d_name, ".."))
+ continue;
+
+ /*
+ * See if we have a file or directory...
+ */
+
+ snprintf(filename, sizeof(filename), "%s/%s", path, dent->d_name);
+
+ if (stat(filename, &fileinfo))
+ {
+ fprintf(stderr, "mxmldoc: Unable to stat \"%s\": %s\n", filename,
+ strerror(errno));
+ closedir(dir);
+ return (0);
+ }
+
+ if (S_ISDIR(fileinfo.st_mode))
+ {
+ if (!remove_directory(filename))
+ {
+ closedir(dir);
+ return (0);
+ }
+ }
+ else if (unlink(filename))
+ {
+ fprintf(stderr, "mxmldoc: Unable to remove \"%s\": %s\n", filename,
+ strerror(errno));
+ closedir(dir);
+ return (0);
+ }
+ }
+
+ closedir(dir);
+
+ if (rmdir(path))
+ {
+ fprintf(stderr, "mxmldoc: Unable to remove directory \"%s\": %s\n", path,
+ strerror(errno));
+ return (0);
+ }
+#endif /* WIN32 */
+
+ return (1);
+}
+
+
+/*
+ * 'safe_strcpy()' - Copy a string allowing for overlapping strings.
+ */
+
+static void
+safe_strcpy(char *dst, /* I - Destination string */
+ const char *src) /* I - Source string */
+{
+ while (*src)
+ *dst++ = *src++;
+
+ *dst = '\0';
+}
+
+
+/*
+ * 'scan_file()' - Scan a source file.
+ */
+
+static int /* O - 0 on success, -1 on error */
+scan_file(const char *filename, /* I - Filename */
+ FILE *fp, /* I - File to scan */
+ mxml_node_t *tree) /* I - Function tree */
+{
+ int state, /* Current parser state */
+ braces, /* Number of braces active */
+ parens; /* Number of active parenthesis */
+ int ch; /* Current character */
+ char buffer[65536], /* String buffer */
+ *bufptr; /* Pointer into buffer */
+ const char *scope; /* Current variable/function scope */
+ mxml_node_t *comment, /* <comment> node */
+ *constant, /* <constant> node */
+ *enumeration, /* <enumeration> node */
+ *function, /* <function> node */
+ *fstructclass, /* function struct/class node */
+ *structclass, /* <struct> or <class> node */
+ *typedefnode, /* <typedef> node */
+ *variable, /* <variable> or <argument> node */
+ *returnvalue, /* <returnvalue> node */
+ *type, /* <type> node */
+ *description, /* <description> node */
+ *node, /* Current node */
+ *next; /* Next node */
+#if DEBUG > 1
+ mxml_node_t *temp; /* Temporary node */
+ int oldstate, /* Previous state */
+ oldch; /* Old character */
+ static const char *states[] = /* State strings */
+ {
+ "STATE_NONE",
+ "STATE_PREPROCESSOR",
+ "STATE_C_COMMENT",
+ "STATE_CXX_COMMENT",
+ "STATE_STRING",
+ "STATE_CHARACTER",
+ "STATE_IDENTIFIER"
+ };
+#endif /* DEBUG > 1 */
+
+
+#ifdef DEBUG
+ fprintf(stderr, "scan_file(filename=\"%s\", fp=%p, tree=%p)\n", filename,
+ fp, tree);
+#endif /* DEBUG */
+
+ /*
+ * Initialize the finite state machine...
+ */
+
+ state = STATE_NONE;
+ braces = 0;
+ parens = 0;
+ bufptr = buffer;
+
+ comment = mxmlNewElement(MXML_NO_PARENT, "temp");
+ constant = NULL;
+ enumeration = NULL;
+ function = NULL;
+ variable = NULL;
+ returnvalue = NULL;
+ type = NULL;
+ description = NULL;
+ typedefnode = NULL;
+ structclass = NULL;
+ fstructclass = NULL;
+
+ if (!strcmp(tree->value.element.name, "class"))
+ scope = "private";
+ else
+ scope = NULL;
+
+ /*
+ * Read until end-of-file...
+ */
+
+ while ((ch = getc(fp)) != EOF)
+ {
+#if DEBUG > 1
+ oldstate = state;
+ oldch = ch;
+#endif /* DEBUG > 1 */
+
+ switch (state)
+ {
+ case STATE_NONE : /* No state - whitespace, etc. */
+ switch (ch)
+ {
+ case '/' : /* Possible C/C++ comment */
+ ch = getc(fp);
+ bufptr = buffer;
+
+ if (ch == '*')
+ state = STATE_C_COMMENT;
+ else if (ch == '/')
+ state = STATE_CXX_COMMENT;
+ else
+ {
+ ungetc(ch, fp);
+
+ if (type)
+ {
+#ifdef DEBUG
+ fputs("Identifier: <<<< / >>>\n", stderr);
+#endif /* DEBUG */
+ ch = type->last_child->value.text.string[0];
+ mxmlNewText(type, isalnum(ch) || ch == '_', "/");
+ }
+ }
+ break;
+
+ case '#' : /* Preprocessor */
+#ifdef DEBUG
+ fputs(" #preprocessor...\n", stderr);
+#endif /* DEBUG */
+ state = STATE_PREPROCESSOR;
+ break;
+
+ case '\'' : /* Character constant */
+ state = STATE_CHARACTER;
+ bufptr = buffer;
+ *bufptr++ = ch;
+ break;
+
+ case '\"' : /* String constant */
+ state = STATE_STRING;
+ bufptr = buffer;
+ *bufptr++ = ch;
+ break;
+
+ case '{' :
+#ifdef DEBUG
+ fprintf(stderr, " open brace, function=%p, type=%p...\n",
+ function, type);
+ if (type)
+ fprintf(stderr, " type->child=\"%s\"...\n",
+ type->child->value.text.string);
+#endif /* DEBUG */
+
+ if (function)
+ {
+ if (fstructclass)
+ {
+ sort_node(fstructclass, function);
+ fstructclass = NULL;
+ }
+ else
+ sort_node(tree, function);
+
+ function = NULL;
+ }
+ else if (type && type->child &&
+ ((!strcmp(type->child->value.text.string, "typedef") &&
+ type->child->next &&
+ (!strcmp(type->child->next->value.text.string, "struct") ||
+ !strcmp(type->child->next->value.text.string, "union") ||
+ !strcmp(type->child->next->value.text.string, "class"))) ||
+ !strcmp(type->child->value.text.string, "union") ||
+ !strcmp(type->child->value.text.string, "struct") ||
+ !strcmp(type->child->value.text.string, "class")))
+ {
+ /*
+ * Start of a class or structure...
+ */
+
+ if (!strcmp(type->child->value.text.string, "typedef"))
+ {
+#ifdef DEBUG
+ fputs(" starting typedef...\n", stderr);
+#endif /* DEBUG */
+
+ typedefnode = mxmlNewElement(MXML_NO_PARENT, "typedef");
+ mxmlDelete(type->child);
+ }
+ else
+ typedefnode = NULL;
+
+ structclass = mxmlNewElement(MXML_NO_PARENT,
+ type->child->value.text.string);
+
+#ifdef DEBUG
+ fprintf(stderr, "%c%s: <<<< %s >>>\n",
+ toupper(type->child->value.text.string[0]),
+ type->child->value.text.string + 1,
+ type->child->next ?
+ type->child->next->value.text.string : "(noname)");
+
+ fputs(" type =", stderr);
+ for (node = type->child; node; node = node->next)
+ fprintf(stderr, " \"%s\"", node->value.text.string);
+ putc('\n', stderr);
+
+ fprintf(stderr, " scope = %s\n", scope ? scope : "(null)");
+#endif /* DEBUG */
+
+ if (type->child->next)
+ {
+ mxmlElementSetAttr(structclass, "name",
+ type->child->next->value.text.string);
+ sort_node(tree, structclass);
+ }
+
+ if (typedefnode && type->child)
+ type->child->value.text.whitespace = 0;
+ else if (structclass && type->child &&
+ type->child->next && type->child->next->next)
+ {
+ for (bufptr = buffer, node = type->child->next->next;
+ node;
+ bufptr += strlen(bufptr))
+ {
+ if (node->value.text.whitespace && bufptr > buffer)
+ *bufptr++ = ' ';
+
+ strcpy(bufptr, node->value.text.string);
+
+ next = node->next;
+ mxmlDelete(node);
+ node = next;
+ }
+
+ mxmlElementSetAttr(structclass, "parent", buffer);
+
+ mxmlDelete(type);
+ type = NULL;
+ }
+ else
+ {
+ mxmlDelete(type);
+ type = NULL;
+ }
+
+ if (typedefnode && comment->last_child)
+ {
+ /*
+ * Copy comment for typedef as well as class/struct/union...
+ */
+
+ mxmlNewText(comment, 0,
+ comment->last_child->value.text.string);
+ description = mxmlNewElement(typedefnode, "description");
+#ifdef DEBUG
+ fprintf(stderr,
+ " duplicating comment %p/%p for typedef...\n",
+ comment->last_child, comment->child);
+#endif /* DEBUG */
+ update_comment(typedefnode, comment->last_child);
+ mxmlAdd(description, MXML_ADD_AFTER, MXML_ADD_TO_PARENT,
+ comment->last_child);
+ }
+
+ description = mxmlNewElement(structclass, "description");
+#ifdef DEBUG
+ fprintf(stderr, " adding comment %p/%p to %s...\n",
+ comment->last_child, comment->child,
+ structclass->value.element.name);
+#endif /* DEBUG */
+ update_comment(structclass, comment->last_child);
+ mxmlAdd(description, MXML_ADD_AFTER, MXML_ADD_TO_PARENT,
+ comment->last_child);
+
+ if (scan_file(filename, fp, structclass))
+ {
+ mxmlDelete(comment);
+ return (-1);
+ }
+
+#ifdef DEBUG
+ fputs(" ended typedef...\n", stderr);
+#endif /* DEBUG */
+ structclass = NULL;
+ break;
+ }
+ else if (type && type->child && type->child->next &&
+ (!strcmp(type->child->value.text.string, "enum") ||
+ (!strcmp(type->child->value.text.string, "typedef") &&
+ !strcmp(type->child->next->value.text.string, "enum"))))
+ {
+ /*
+ * Enumeration type...
+ */
+
+ if (!strcmp(type->child->value.text.string, "typedef"))
+ {
+#ifdef DEBUG
+ fputs(" starting typedef...\n", stderr);
+#endif /* DEBUG */
+
+ typedefnode = mxmlNewElement(MXML_NO_PARENT, "typedef");
+ mxmlDelete(type->child);
+ }
+ else
+ typedefnode = NULL;
+
+ enumeration = mxmlNewElement(MXML_NO_PARENT, "enumeration");
+
+#ifdef DEBUG
+ fprintf(stderr, "Enumeration: <<<< %s >>>\n",
+ type->child->next ?
+ type->child->next->value.text.string : "(noname)");
+#endif /* DEBUG */
+
+ if (type->child->next)
+ {
+ mxmlElementSetAttr(enumeration, "name",
+ type->child->next->value.text.string);
+ sort_node(tree, enumeration);
+ }
+
+ if (typedefnode && type->child)
+ type->child->value.text.whitespace = 0;
+ else
+ {
+ mxmlDelete(type);
+ type = NULL;
+ }
+
+ if (typedefnode && comment->last_child)
+ {
+ /*
+ * Copy comment for typedef as well as class/struct/union...
+ */
+
+ mxmlNewText(comment, 0,
+ comment->last_child->value.text.string);
+ description = mxmlNewElement(typedefnode, "description");
+#ifdef DEBUG
+ fprintf(stderr,
+ " duplicating comment %p/%p for typedef...\n",
+ comment->last_child, comment->child);
+#endif /* DEBUG */
+ update_comment(typedefnode, comment->last_child);
+ mxmlAdd(description, MXML_ADD_AFTER, MXML_ADD_TO_PARENT,
+ comment->last_child);
+ }
+
+ description = mxmlNewElement(enumeration, "description");
+#ifdef DEBUG
+ fprintf(stderr, " adding comment %p/%p to enumeration...\n",
+ comment->last_child, comment->child);
+#endif /* DEBUG */
+ update_comment(enumeration, comment->last_child);
+ mxmlAdd(description, MXML_ADD_AFTER, MXML_ADD_TO_PARENT,
+ comment->last_child);
+ }
+ else if (type && type->child &&
+ !strcmp(type->child->value.text.string, "extern"))
+ {
+ if (scan_file(filename, fp, tree))
+ {
+ mxmlDelete(comment);
+ return (-1);
+ }
+ }
+ else if (type)
+ {
+ mxmlDelete(type);
+ type = NULL;
+ }
+
+ braces ++;
+ function = NULL;
+ variable = NULL;
+ break;
+
+ case '}' :
+#ifdef DEBUG
+ fputs(" close brace...\n", stderr);
+#endif /* DEBUG */
+
+ if (structclass)
+ scope = NULL;
+
+ if (!typedefnode)
+ enumeration = NULL;
+
+ constant = NULL;
+ structclass = NULL;
+
+ if (braces > 0)
+ braces --;
+ else
+ {
+ mxmlDelete(comment);
+ return (0);
+ }
+ break;
+
+ case '(' :
+ if (type)
+ {
+#ifdef DEBUG
+ fputs("Identifier: <<<< ( >>>\n", stderr);
+#endif /* DEBUG */
+ mxmlNewText(type, 0, "(");
+ }
+
+ parens ++;
+ break;
+
+ case ')' :
+ if (type && parens)
+ {
+#ifdef DEBUG
+ fputs("Identifier: <<<< ) >>>\n", stderr);
+#endif /* DEBUG */
+ mxmlNewText(type, 0, ")");
+ }
+
+ if (function && type && !parens)
+ {
+ /*
+ * Check for "void" argument...
+ */
+
+ if (type->child && type->child->next)
+ variable = add_variable(function, "argument", type);
+ else
+ mxmlDelete(type);
+
+ type = NULL;
+ }
+
+ if (parens > 0)
+ parens --;
+ break;
+
+ case ';' :
+#ifdef DEBUG
+ fputs("Identifier: <<<< ; >>>\n", stderr);
+ fprintf(stderr, " enumeration=%p, function=%p, type=%p, type->child=%p, typedefnode=%p\n",
+ enumeration, function, type, type ? type->child : NULL, typedefnode);
+#endif /* DEBUG */
+
+ if (function)
+ {
+ if (!strcmp(tree->value.element.name, "class"))
+ {
+#ifdef DEBUG
+ fputs(" ADDING FUNCTION TO CLASS\n", stderr);
+#endif /* DEBUG */
+ sort_node(tree, function);
+ }
+ else
+ mxmlDelete(function);
+
+ function = NULL;
+ variable = NULL;
+ }
+
+ if (type)
+ {
+ /*
+ * See if we have a typedef...
+ */
+
+ if (type->child &&
+ !strcmp(type->child->value.text.string, "typedef"))
+ {
+ /*
+ * Yes, add it!
+ */
+
+ typedefnode = mxmlNewElement(MXML_NO_PARENT, "typedef");
+
+ for (node = type->child->next; node; node = node->next)
+ if (!strcmp(node->value.text.string, "("))
+ break;
+
+ if (node)
+ {
+ for (node = node->next; node; node = node->next)
+ if (strcmp(node->value.text.string, "*"))
+ break;
+ }
+
+ if (!node)
+ node = type->last_child;
+
+#ifdef DEBUG
+ fprintf(stderr, " ADDING TYPEDEF FOR %p(%s)...\n",
+ node, node->value.text.string);
+#endif /* DEBUG */
+
+ mxmlElementSetAttr(typedefnode, "name",
+ node->value.text.string);
+ sort_node(tree, typedefnode);
+
+ if (type->child != node)
+ mxmlDelete(type->child);
+
+ mxmlDelete(node);
+
+ if (type->child)
+ type->child->value.text.whitespace = 0;
+
+ mxmlAdd(typedefnode, MXML_ADD_AFTER, MXML_ADD_TO_PARENT,
+ type);
+ type = NULL;
+ break;
+ }
+ else if (typedefnode && enumeration)
+ {
+ /*
+ * Add enum typedef...
+ */
+
+ node = type->child;
+
+#ifdef DEBUG
+ fprintf(stderr, " ADDING TYPEDEF FOR %p(%s)...\n",
+ node, node->value.text.string);
+#endif /* DEBUG */
+
+ mxmlElementSetAttr(typedefnode, "name",
+ node->value.text.string);
+ sort_node(tree, typedefnode);
+ mxmlDelete(type);
+
+ type = mxmlNewElement(typedefnode, "type");
+ mxmlNewText(type, 0, "enum");
+ mxmlNewText(type, 1,
+ mxmlElementGetAttr(enumeration, "name"));
+ enumeration = NULL;
+ type = NULL;
+ break;
+ }
+
+ mxmlDelete(type);
+ type = NULL;
+ }
+ break;
+
+ case ':' :
+ if (type)
+ {
+#ifdef DEBUG
+ fputs("Identifier: <<<< : >>>\n", stderr);
+#endif /* DEBUG */
+ mxmlNewText(type, 1, ":");
+ }
+ break;
+
+ case '*' :
+ if (type)
+ {
+#ifdef DEBUG
+ fputs("Identifier: <<<< * >>>\n", stderr);
+#endif /* DEBUG */
+ ch = type->last_child->value.text.string[0];
+ mxmlNewText(type, isalnum(ch) || ch == '_', "*");
+ }
+ break;
+
+ case ',' :
+ if (type && !enumeration)
+ {
+#ifdef DEBUG
+ fputs("Identifier: <<<< , >>>\n", stderr);
+#endif /* DEBUG */
+ mxmlNewText(type, 0, ",");
+ }
+ break;
+
+ case '&' :
+ if (type)
+ {
+#ifdef DEBUG
+ fputs("Identifier: <<<< & >>>\n", stderr);
+#endif /* DEBUG */
+ mxmlNewText(type, 1, "&");
+ }
+ break;
+
+ case '+' :
+ if (type)
+ {
+#ifdef DEBUG
+ fputs("Identifier: <<<< + >>>\n", stderr);
+#endif /* DEBUG */
+ ch = type->last_child->value.text.string[0];
+ mxmlNewText(type, isalnum(ch) || ch == '_', "+");
+ }
+ break;
+
+ case '-' :
+ if (type)
+ {
+#ifdef DEBUG
+ fputs("Identifier: <<<< - >>>\n", stderr);
+#endif /* DEBUG */
+ ch = type->last_child->value.text.string[0];
+ mxmlNewText(type, isalnum(ch) || ch == '_', "-");
+ }
+ break;
+
+ case '=' :
+ if (type)
+ {
+#ifdef DEBUG
+ fputs("Identifier: <<<< = >>>\n", stderr);
+#endif /* DEBUG */
+ ch = type->last_child->value.text.string[0];
+ mxmlNewText(type, isalnum(ch) || ch == '_', "=");
+ }
+ break;
+
+ default : /* Other */
+ if (isalnum(ch) || ch == '_' || ch == '.' || ch == ':' || ch == '~')
+ {
+ state = STATE_IDENTIFIER;
+ bufptr = buffer;
+ *bufptr++ = ch;
+ }
+ break;
+ }
+ break;
+
+ case STATE_PREPROCESSOR : /* Preprocessor directive */
+ if (ch == '\n')
+ state = STATE_NONE;
+ else if (ch == '\\')
+ getc(fp);
+ break;
+
+ case STATE_C_COMMENT : /* Inside a C comment */
+ switch (ch)
+ {
+ case '\n' :
+ while ((ch = getc(fp)) != EOF)
+ if (ch == '*')
+ {
+ ch = getc(fp);
+
+ if (ch == '/')
+ {
+ *bufptr = '\0';
+
+ if (comment->child != comment->last_child)
+ {
+#ifdef DEBUG
+ fprintf(stderr, " removing comment %p(%20.20s), last comment %p(%20.20s)...\n",
+ comment->child,
+ comment->child ? comment->child->value.text.string : "",
+ comment->last_child,
+ comment->last_child ? comment->last_child->value.text.string : "");
+#endif /* DEBUG */
+ mxmlDelete(comment->child);
+#ifdef DEBUG
+ fprintf(stderr, " new comment %p, last comment %p...\n",
+ comment->child, comment->last_child);
+#endif /* DEBUG */
+ }
+
+#ifdef DEBUG
+ fprintf(stderr,
+ " processing comment, variable=%p, "
+ "constant=%p, typedefnode=%p, tree=\"%s\"\n",
+ variable, constant, typedefnode,
+ tree->value.element.name);
+#endif /* DEBUG */
+
+ if (variable)
+ {
+ if (strstr(buffer, "@private@"))
+ {
+ /*
+ * Delete private variables...
+ */
+
+ mxmlDelete(variable);
+ }
+ else
+ {
+ description = mxmlNewElement(variable, "description");
+#ifdef DEBUG
+ fprintf(stderr,
+ " adding comment %p/%p to variable...\n",
+ comment->last_child, comment->child);
+#endif /* DEBUG */
+ mxmlNewText(comment, 0, buffer);
+ update_comment(variable,
+ mxmlNewText(description, 0, buffer));
+ }
+
+ variable = NULL;
+ }
+ else if (constant)
+ {
+ if (strstr(buffer, "@private@"))
+ {
+ /*
+ * Delete private constants...
+ */
+
+ mxmlDelete(constant);
+ }
+ else
+ {
+ description = mxmlNewElement(constant, "description");
+#ifdef DEBUG
+ fprintf(stderr,
+ " adding comment %p/%p to constant...\n",
+ comment->last_child, comment->child);
+#endif /* DEBUG */
+ mxmlNewText(comment, 0, buffer);
+ update_comment(constant,
+ mxmlNewText(description, 0, buffer));
+ }
+
+ constant = NULL;
+ }
+ else if (typedefnode)
+ {
+ if (strstr(buffer, "@private@"))
+ {
+ /*
+ * Delete private typedefs...
+ */
+
+ mxmlDelete(typedefnode);
+
+ if (structclass)
+ {
+ mxmlDelete(structclass);
+ structclass = NULL;
+ }
+
+ if (enumeration)
+ {
+ mxmlDelete(enumeration);
+ enumeration = NULL;
+ }
+ }
+ else
+ {
+ description = mxmlNewElement(typedefnode, "description");
+#ifdef DEBUG
+ fprintf(stderr,
+ " adding comment %p/%p to typedef %s...\n",
+ comment->last_child, comment->child,
+ mxmlElementGetAttr(typedefnode, "name"));
+#endif /* DEBUG */
+ mxmlNewText(comment, 0, buffer);
+ update_comment(typedefnode,
+ mxmlNewText(description, 0, buffer));
+
+ if (structclass)
+ {
+ description = mxmlNewElement(structclass, "description");
+ update_comment(structclass,
+ mxmlNewText(description, 0, buffer));
+ }
+ else if (enumeration)
+ {
+ description = mxmlNewElement(enumeration, "description");
+ update_comment(enumeration,
+ mxmlNewText(description, 0, buffer));
+ }
+ }
+
+ typedefnode = NULL;
+ }
+ else if (strcmp(tree->value.element.name, "mxmldoc") &&
+ !mxmlFindElement(tree, tree, "description",
+ NULL, NULL, MXML_DESCEND_FIRST))
+ {
+ description = mxmlNewElement(tree, "description");
+#ifdef DEBUG
+ fprintf(stderr, " adding comment %p/%p to parent...\n",
+ comment->last_child, comment->child);
+#endif /* DEBUG */
+ mxmlNewText(comment, 0, buffer);
+ update_comment(tree,
+ mxmlNewText(description, 0, buffer));
+ }
+ else
+ {
+#ifdef DEBUG
+ fprintf(stderr, " before adding comment, child=%p, last_child=%p\n",
+ comment->child, comment->last_child);
+#endif /* DEBUG */
+ mxmlNewText(comment, 0, buffer);
+#ifdef DEBUG
+ fprintf(stderr, " after adding comment, child=%p, last_child=%p\n",
+ comment->child, comment->last_child);
+#endif /* DEBUG */
+ }
+#ifdef DEBUG
+ fprintf(stderr, "C comment: <<<< %s >>>\n", buffer);
+#endif /* DEBUG */
+
+ state = STATE_NONE;
+ break;
+ }
+ else
+ ungetc(ch, fp);
+ }
+ else if (ch == '\n' && bufptr > buffer &&
+ bufptr < (buffer + sizeof(buffer) - 1))
+ *bufptr++ = ch;
+ else if (!isspace(ch))
+ break;
+
+ if (ch != EOF)
+ ungetc(ch, fp);
+
+ if (bufptr > buffer && bufptr < (buffer + sizeof(buffer) - 1))
+ *bufptr++ = '\n';
+ break;
+
+ case '/' :
+ if (ch == '/' && bufptr > buffer && bufptr[-1] == '*')
+ {
+ while (bufptr > buffer &&
+ (bufptr[-1] == '*' || isspace(bufptr[-1] & 255)))
+ bufptr --;
+ *bufptr = '\0';
+
+ if (comment->child != comment->last_child)
+ {
+#ifdef DEBUG
+ fprintf(stderr, " removing comment %p(%20.20s), last comment %p(%20.20s)...\n",
+ comment->child,
+ comment->child ? comment->child->value.text.string : "",
+ comment->last_child,
+ comment->last_child ? comment->last_child->value.text.string : "");
+#endif /* DEBUG */
+ mxmlDelete(comment->child);
+#ifdef DEBUG
+ fprintf(stderr, " new comment %p, last comment %p...\n",
+ comment->child, comment->last_child);
+#endif /* DEBUG */
+ }
+
+#ifdef DEBUG
+ fprintf(stderr,
+ " processing comment, variable=%p, "
+ "constant=%p, typedefnode=%p, tree=\"%s\"\n",
+ variable, constant, typedefnode,
+ tree->value.element.name);
+#endif /* DEBUG */
+
+ if (variable)
+ {
+ if (strstr(buffer, "@private@"))
+ {
+ /*
+ * Delete private variables...
+ */
+
+ mxmlDelete(variable);
+ }
+ else
+ {
+ description = mxmlNewElement(variable, "description");
+#ifdef DEBUG
+ fprintf(stderr, " adding comment %p/%p to variable...\n",
+ comment->last_child, comment->child);
+#endif /* DEBUG */
+ mxmlNewText(comment, 0, buffer);
+ update_comment(variable,
+ mxmlNewText(description, 0, buffer));
+ }
+
+ variable = NULL;
+ }
+ else if (constant)
+ {
+ if (strstr(buffer, "@private@"))
+ {
+ /*
+ * Delete private constants...
+ */
+
+ mxmlDelete(constant);
+ }
+ else
+ {
+ description = mxmlNewElement(constant, "description");
+#ifdef DEBUG
+ fprintf(stderr, " adding comment %p/%p to constant...\n",
+ comment->last_child, comment->child);
+#endif /* DEBUG */
+ mxmlNewText(comment, 0, buffer);
+ update_comment(constant,
+ mxmlNewText(description, 0, buffer));
+ }
+
+ constant = NULL;
+ }
+ else if (typedefnode)
+ {
+ if (strstr(buffer, "@private@"))
+ {
+ /*
+ * Delete private typedefs...
+ */
+
+ mxmlDelete(typedefnode);
+
+ if (structclass)
+ {
+ mxmlDelete(structclass);
+ structclass = NULL;
+ }
+
+ if (enumeration)
+ {
+ mxmlDelete(enumeration);
+ enumeration = NULL;
+ }
+ }
+ else
+ {
+ description = mxmlNewElement(typedefnode, "description");
+#ifdef DEBUG
+ fprintf(stderr,
+ " adding comment %p/%p to typedef %s...\n",
+ comment->last_child, comment->child,
+ mxmlElementGetAttr(typedefnode, "name"));
+#endif /* DEBUG */
+ mxmlNewText(comment, 0, buffer);
+ update_comment(typedefnode,
+ mxmlNewText(description, 0, buffer));
+
+ if (structclass)
+ {
+ description = mxmlNewElement(structclass, "description");
+ update_comment(structclass,
+ mxmlNewText(description, 0, buffer));
+ }
+ else if (enumeration)
+ {
+ description = mxmlNewElement(enumeration, "description");
+ update_comment(enumeration,
+ mxmlNewText(description, 0, buffer));
+ }
+ }
+
+ typedefnode = NULL;
+ }
+ else if (strcmp(tree->value.element.name, "mxmldoc") &&
+ !mxmlFindElement(tree, tree, "description",
+ NULL, NULL, MXML_DESCEND_FIRST))
+ {
+ description = mxmlNewElement(tree, "description");
+#ifdef DEBUG
+ fprintf(stderr, " adding comment %p/%p to parent...\n",
+ comment->last_child, comment->child);
+#endif /* DEBUG */
+ mxmlNewText(comment, 0, buffer);
+ update_comment(tree,
+ mxmlNewText(description, 0, buffer));
+ }
+ else
+ mxmlNewText(comment, 0, buffer);
+
+#ifdef DEBUG
+ fprintf(stderr, "C comment: <<<< %s >>>\n", buffer);
+#endif /* DEBUG */
+
+ state = STATE_NONE;
+ break;
+ }
+
+ default :
+ if (ch == ' ' && bufptr == buffer)
+ break;
+
+ if (bufptr < (buffer + sizeof(buffer) - 1))
+ *bufptr++ = ch;
+ break;
+ }
+ break;
+
+ case STATE_CXX_COMMENT : /* Inside a C++ comment */
+ if (ch == '\n')
+ {
+ state = STATE_NONE;
+ *bufptr = '\0';
+
+ if (comment->child != comment->last_child)
+ {
+#ifdef DEBUG
+ fprintf(stderr, " removing comment %p(%20.20s), last comment %p(%20.20s)...\n",
+ comment->child,
+ comment->child ? comment->child->value.text.string : "",
+ comment->last_child,
+ comment->last_child ? comment->last_child->value.text.string : "");
+#endif /* DEBUG */
+ mxmlDelete(comment->child);
+#ifdef DEBUG
+ fprintf(stderr, " new comment %p, last comment %p...\n",
+ comment->child, comment->last_child);
+#endif /* DEBUG */
+ }
+
+ if (variable)
+ {
+ if (strstr(buffer, "@private@"))
+ {
+ /*
+ * Delete private variables...
+ */
+
+ mxmlDelete(variable);
+ }
+ else
+ {
+ description = mxmlNewElement(variable, "description");
+#ifdef DEBUG
+ fprintf(stderr, " adding comment %p/%p to variable...\n",
+ comment->last_child, comment->child);
+#endif /* DEBUG */
+ mxmlNewText(comment, 0, buffer);
+ update_comment(variable,
+ mxmlNewText(description, 0, buffer));
+ }
+
+ variable = NULL;
+ }
+ else if (constant)
+ {
+ if (strstr(buffer, "@private@"))
+ {
+ /*
+ * Delete private constants...
+ */
+
+ mxmlDelete(constant);
+ }
+ else
+ {
+ description = mxmlNewElement(constant, "description");
+#ifdef DEBUG
+ fprintf(stderr, " adding comment %p/%p to constant...\n",
+ comment->last_child, comment->child);
+#endif /* DEBUG */
+ mxmlNewText(comment, 0, buffer);
+ update_comment(constant,
+ mxmlNewText(description, 0, buffer));
+ }
+
+ constant = NULL;
+ }
+ else if (typedefnode)
+ {
+ if (strstr(buffer, "@private@"))
+ {
+ /*
+ * Delete private typedefs...
+ */
+
+ mxmlDelete(typedefnode);
+ typedefnode = NULL;
+
+ if (structclass)
+ {
+ mxmlDelete(structclass);
+ structclass = NULL;
+ }
+
+ if (enumeration)
+ {
+ mxmlDelete(enumeration);
+ enumeration = NULL;
+ }
+ }
+ else
+ {
+ description = mxmlNewElement(typedefnode, "description");
+#ifdef DEBUG
+ fprintf(stderr, " adding comment %p/%p to typedef %s...\n",
+ comment->last_child, comment->child,
+ mxmlElementGetAttr(typedefnode, "name"));
+#endif /* DEBUG */
+ mxmlNewText(comment, 0, buffer);
+ update_comment(typedefnode,
+ mxmlNewText(description, 0, buffer));
+
+ if (structclass)
+ {
+ description = mxmlNewElement(structclass, "description");
+ update_comment(structclass,
+ mxmlNewText(description, 0, buffer));
+ }
+ else if (enumeration)
+ {
+ description = mxmlNewElement(enumeration, "description");
+ update_comment(enumeration,
+ mxmlNewText(description, 0, buffer));
+ }
+ }
+ }
+ else if (strcmp(tree->value.element.name, "mxmldoc") &&
+ !mxmlFindElement(tree, tree, "description",
+ NULL, NULL, MXML_DESCEND_FIRST))
+ {
+ description = mxmlNewElement(tree, "description");
+#ifdef DEBUG
+ fprintf(stderr, " adding comment %p/%p to parent...\n",
+ comment->last_child, comment->child);
+#endif /* DEBUG */
+ mxmlNewText(comment, 0, buffer);
+ update_comment(tree,
+ mxmlNewText(description, 0, buffer));
+ }
+ else
+ mxmlNewText(comment, 0, buffer);
+
+#ifdef DEBUG
+ fprintf(stderr, "C++ comment: <<<< %s >>>\n", buffer);
+#endif /* DEBUG */
+ }
+ else if (ch == ' ' && bufptr == buffer)
+ break;
+ else if (bufptr < (buffer + sizeof(buffer) - 1))
+ *bufptr++ = ch;
+ break;
+
+ case STATE_STRING : /* Inside a string constant */
+ *bufptr++ = ch;
+
+ if (ch == '\\')
+ *bufptr++ = getc(fp);
+ else if (ch == '\"')
+ {
+ *bufptr = '\0';
+
+ if (type)
+ mxmlNewText(type, type->child != NULL, buffer);
+
+ state = STATE_NONE;
+ }
+ break;
+
+ case STATE_CHARACTER : /* Inside a character constant */
+ *bufptr++ = ch;
+
+ if (ch == '\\')
+ *bufptr++ = getc(fp);
+ else if (ch == '\'')
+ {
+ *bufptr = '\0';
+
+ if (type)
+ mxmlNewText(type, type->child != NULL, buffer);
+
+ state = STATE_NONE;
+ }
+ break;
+
+ case STATE_IDENTIFIER : /* Inside a keyword or identifier */
+ if (isalnum(ch) || ch == '_' || ch == '[' || ch == ']' ||
+ (ch == ',' && (parens > 1 || (type && !enumeration && !function))) ||
+ ch == ':' || ch == '.' || ch == '~')
+ {
+ if (bufptr < (buffer + sizeof(buffer) - 1))
+ *bufptr++ = ch;
+ }
+ else
+ {
+ ungetc(ch, fp);
+ *bufptr = '\0';
+ state = STATE_NONE;
+
+#ifdef DEBUG
+ fprintf(stderr, " braces=%d, type=%p, type->child=%p, buffer=\"%s\"\n",
+ braces, type, type ? type->child : NULL, buffer);
+#endif /* DEBUG */
+
+ if (!braces)
+ {
+ if (!type || !type->child)
+ {
+ if (!strcmp(tree->value.element.name, "class"))
+ {
+ if (!strcmp(buffer, "public") ||
+ !strcmp(buffer, "public:"))
+ {
+ scope = "public";
+#ifdef DEBUG
+ fputs(" scope = public\n", stderr);
+#endif /* DEBUG */
+ break;
+ }
+ else if (!strcmp(buffer, "private") ||
+ !strcmp(buffer, "private:"))
+ {
+ scope = "private";
+#ifdef DEBUG
+ fputs(" scope = private\n", stderr);
+#endif /* DEBUG */
+ break;
+ }
+ else if (!strcmp(buffer, "protected") ||
+ !strcmp(buffer, "protected:"))
+ {
+ scope = "protected";
+#ifdef DEBUG
+ fputs(" scope = protected\n", stderr);
+#endif /* DEBUG */
+ break;
+ }
+ }
+ }
+
+ if (!type)
+ type = mxmlNewElement(MXML_NO_PARENT, "type");
+
+#ifdef DEBUG
+ fprintf(stderr, " function=%p (%s), type->child=%p, ch='%c', parens=%d\n",
+ function,
+ function ? mxmlElementGetAttr(function, "name") : "null",
+ type->child, ch, parens);
+#endif /* DEBUG */
+
+ if (!function && ch == '(')
+ {
+ if (type->child &&
+ !strcmp(type->child->value.text.string, "extern"))
+ {
+ /*
+ * Remove external declarations...
+ */
+
+ mxmlDelete(type);
+ type = NULL;
+ break;
+ }
+
+ if (type->child &&
+ !strcmp(type->child->value.text.string, "static") &&
+ !strcmp(tree->value.element.name, "mxmldoc"))
+ {
+ /*
+ * Remove static functions...
+ */
+
+ mxmlDelete(type);
+ type = NULL;
+ break;
+ }
+
+ function = mxmlNewElement(MXML_NO_PARENT, "function");
+ if ((bufptr = strchr(buffer, ':')) != NULL && bufptr[1] == ':')
+ {
+ *bufptr = '\0';
+ bufptr += 2;
+
+ if ((fstructclass =
+ mxmlFindElement(tree, tree, "class", "name", buffer,
+ MXML_DESCEND_FIRST)) == NULL)
+ fstructclass =
+ mxmlFindElement(tree, tree, "struct", "name", buffer,
+ MXML_DESCEND_FIRST);
+ }
+ else
+ bufptr = buffer;
+
+ mxmlElementSetAttr(function, "name", bufptr);
+
+ if (scope)
+ mxmlElementSetAttr(function, "scope", scope);
+
+#ifdef DEBUG
+ fprintf(stderr, "function: %s\n", buffer);
+ fprintf(stderr, " scope = %s\n", scope ? scope : "(null)");
+ fprintf(stderr, " comment = %p\n", comment);
+ fprintf(stderr, " child = (%p) %s\n",
+ comment->child,
+ comment->child ?
+ comment->child->value.text.string : "(null)");
+ fprintf(stderr, " last_child = (%p) %s\n",
+ comment->last_child,
+ comment->last_child ?
+ comment->last_child->value.text.string : "(null)");
+#endif /* DEBUG */
+
+ if (type->last_child &&
+ strcmp(type->last_child->value.text.string, "void"))
+ {
+ returnvalue = mxmlNewElement(function, "returnvalue");
+
+ mxmlAdd(returnvalue, MXML_ADD_AFTER, MXML_ADD_TO_PARENT, type);
+
+ description = mxmlNewElement(returnvalue, "description");
+#ifdef DEBUG
+ fprintf(stderr, " adding comment %p/%p to returnvalue...\n",
+ comment->last_child, comment->child);
+#endif /* DEBUG */
+ update_comment(returnvalue, comment->last_child);
+ mxmlAdd(description, MXML_ADD_AFTER, MXML_ADD_TO_PARENT,
+ comment->last_child);
+ }
+ else
+ mxmlDelete(type);
+
+ description = mxmlNewElement(function, "description");
+#ifdef DEBUG
+ fprintf(stderr, " adding comment %p/%p to function...\n",
+ comment->last_child, comment->child);
+#endif /* DEBUG */
+ update_comment(function, comment->last_child);
+ mxmlAdd(description, MXML_ADD_AFTER, MXML_ADD_TO_PARENT,
+ comment->last_child);
+
+ type = NULL;
+ }
+ else if (function && ((ch == ')' && parens == 1) || ch == ','))
+ {
+ /*
+ * Argument definition...
+ */
+
+ if (strcmp(buffer, "void"))
+ {
+ mxmlNewText(type, type->child != NULL &&
+ type->last_child->value.text.string[0] != '(' &&
+ type->last_child->value.text.string[0] != '*',
+ buffer);
+
+#ifdef DEBUG
+ fprintf(stderr, "Argument: <<<< %s >>>\n", buffer);
+#endif /* DEBUG */
+
+ variable = add_variable(function, "argument", type);
+ }
+ else
+ mxmlDelete(type);
+
+ type = NULL;
+ }
+ else if (type->child && !function && (ch == ';' || ch == ','))
+ {
+#ifdef DEBUG
+ fprintf(stderr, " got semicolon, typedefnode=%p, structclass=%p\n",
+ typedefnode, structclass);
+#endif /* DEBUG */
+
+ if (typedefnode || structclass)
+ {
+#ifdef DEBUG
+ fprintf(stderr, "Typedef/struct/class: <<<< %s >>>>\n", buffer);
+#endif /* DEBUG */
+
+ if (typedefnode)
+ {
+ mxmlElementSetAttr(typedefnode, "name", buffer);
+
+ sort_node(tree, typedefnode);
+ }
+
+ if (structclass && !mxmlElementGetAttr(structclass, "name"))
+ {
+#ifdef DEBUG
+ fprintf(stderr, "setting struct/class name to %s!\n",
+ type->last_child->value.text.string);
+#endif /* DEBUG */
+ mxmlElementSetAttr(structclass, "name", buffer);
+
+ sort_node(tree, structclass);
+ structclass = NULL;
+ }
+
+ if (typedefnode)
+ mxmlAdd(typedefnode, MXML_ADD_BEFORE, MXML_ADD_TO_PARENT,
+ type);
+ else
+ mxmlDelete(type);
+
+ type = NULL;
+ typedefnode = NULL;
+ }
+ else if (type->child &&
+ !strcmp(type->child->value.text.string, "typedef"))
+ {
+ /*
+ * Simple typedef...
+ */
+
+#ifdef DEBUG
+ fprintf(stderr, "Typedef: <<<< %s >>>\n", buffer);
+#endif /* DEBUG */
+
+ typedefnode = mxmlNewElement(MXML_NO_PARENT, "typedef");
+ mxmlElementSetAttr(typedefnode, "name", buffer);
+ mxmlDelete(type->child);
+
+ sort_node(tree, typedefnode);
+
+ if (type->child)
+ type->child->value.text.whitespace = 0;
+
+ mxmlAdd(typedefnode, MXML_ADD_AFTER, MXML_ADD_TO_PARENT, type);
+ type = NULL;
+ }
+ else if (!parens)
+ {
+ /*
+ * Variable definition...
+ */
+
+ if (type->child &&
+ !strcmp(type->child->value.text.string, "static") &&
+ !strcmp(tree->value.element.name, "mxmldoc"))
+ {
+ /*
+ * Remove static functions...
+ */
+
+ mxmlDelete(type);
+ type = NULL;
+ break;
+ }
+
+ mxmlNewText(type, type->child != NULL &&
+ type->last_child->value.text.string[0] != '(' &&
+ type->last_child->value.text.string[0] != '*',
+ buffer);
+
+#ifdef DEBUG
+ fprintf(stderr, "Variable: <<<< %s >>>>\n", buffer);
+ fprintf(stderr, " scope = %s\n", scope ? scope : "(null)");
+#endif /* DEBUG */
+
+ variable = add_variable(MXML_NO_PARENT, "variable", type);
+ type = NULL;
+
+ sort_node(tree, variable);
+
+ if (scope)
+ mxmlElementSetAttr(variable, "scope", scope);
+ }
+ }
+ else
+ {
+#ifdef DEBUG
+ fprintf(stderr, "Identifier: <<<< %s >>>>\n", buffer);
+#endif /* DEBUG */
+
+ mxmlNewText(type, type->child != NULL &&
+ type->last_child->value.text.string[0] != '(' &&
+ type->last_child->value.text.string[0] != '*',
+ buffer);
+ }
+ }
+ else if (enumeration && !isdigit(buffer[0] & 255))
+ {
+#ifdef DEBUG
+ fprintf(stderr, "Constant: <<<< %s >>>\n", buffer);
+#endif /* DEBUG */
+
+ constant = mxmlNewElement(MXML_NO_PARENT, "constant");
+ mxmlElementSetAttr(constant, "name", buffer);
+ sort_node(enumeration, constant);
+ }
+ else if (type)
+ {
+ mxmlDelete(type);
+ type = NULL;
+ }
+ }
+ break;
+ }
+
+#if DEBUG > 1
+ if (state != oldstate)
+ {
+ fprintf(stderr, " changed states from %s to %s on receipt of character '%c'...\n",
+ states[oldstate], states[state], oldch);
+ fprintf(stderr, " variable = %p\n", variable);
+ if (type)
+ {
+ fputs(" type =", stderr);
+ for (temp = type->child; temp; temp = temp->next)
+ fprintf(stderr, " \"%s\"", temp->value.text.string);
+ fputs("\n", stderr);
+ }
+ }
+#endif /* DEBUG > 1 */
+ }
+
+ mxmlDelete(comment);
+
+ /*
+ * All done, return with no errors...
+ */
+
+ return (0);
+}
+
+
+/*
+ * 'sort_node()' - Insert a node sorted into a tree.
+ */
+
+static void
+sort_node(mxml_node_t *tree, /* I - Tree to sort into */
+ mxml_node_t *node) /* I - Node to add */
+{
+ mxml_node_t *temp; /* Current node */
+ const char *tempname, /* Name of current node */
+ *nodename, /* Name of node */
+ *scope; /* Scope */
+
+
+#if DEBUG > 1
+ fprintf(stderr, " sort_node(tree=%p, node=%p)\n", tree, node);
+#endif /* DEBUG > 1 */
+
+ /*
+ * Range check input...
+ */
+
+ if (!tree || !node || node->parent == tree)
+ return;
+
+ /*
+ * Get the node name...
+ */
+
+ if ((nodename = mxmlElementGetAttr(node, "name")) == NULL)
+ return;
+
+ if (nodename[0] == '_')
+ return; /* Hide private names */
+
+#if DEBUG > 1
+ fprintf(stderr, " nodename=%p (\"%s\")\n", nodename, nodename);
+#endif /* DEBUG > 1 */
+
+ /*
+ * Delete any existing definition at this level, if one exists...
+ */
+
+ if ((temp = mxmlFindElement(tree, tree, node->value.element.name,
+ "name", nodename, MXML_DESCEND_FIRST)) != NULL)
+ {
+ /*
+ * Copy the scope if needed...
+ */
+
+ if ((scope = mxmlElementGetAttr(temp, "scope")) != NULL &&
+ mxmlElementGetAttr(node, "scope") == NULL)
+ {
+#ifdef DEBUG
+ fprintf(stderr, " copying scope %s for %s\n", scope, nodename);
+#endif /* DEBUG */
+
+ mxmlElementSetAttr(node, "scope", scope);
+ }
+
+ mxmlDelete(temp);
+ }
+
+ /*
+ * Add the node into the tree at the proper place...
+ */
+
+ for (temp = tree->child; temp; temp = temp->next)
+ {
+#if DEBUG > 1
+ fprintf(stderr, " temp=%p\n", temp);
+#endif /* DEBUG > 1 */
+
+ if ((tempname = mxmlElementGetAttr(temp, "name")) == NULL)
+ continue;
+
+#if DEBUG > 1
+ fprintf(stderr, " tempname=%p (\"%s\")\n", tempname, tempname);
+#endif /* DEBUG > 1 */
+
+ if (strcmp(nodename, tempname) < 0)
+ break;
+ }
+
+ if (temp)
+ mxmlAdd(tree, MXML_ADD_BEFORE, temp, node);
+ else
+ mxmlAdd(tree, MXML_ADD_AFTER, MXML_ADD_TO_PARENT, node);
+}
+
+
+/*
+ * 'update_comment()' - Update a comment node.
+ */
+
+static void
+update_comment(mxml_node_t *parent, /* I - Parent node */
+ mxml_node_t *comment) /* I - Comment node */
+{
+ char *ptr; /* Pointer into comment */
+
+
+#ifdef DEBUG
+ fprintf(stderr, "update_comment(parent=%p, comment=%p)\n",
+ parent, comment);
+#endif /* DEBUG */
+
+ /*
+ * Range check the input...
+ */
+
+ if (!parent || !comment)
+ return;
+
+ /*
+ * Update the comment...
+ */
+
+ ptr = comment->value.text.string;
+
+ if (*ptr == '\'')
+ {
+ /*
+ * Convert "'name()' - description" to "description".
+ */
+
+ for (ptr ++; *ptr && *ptr != '\''; ptr ++);
+
+ if (*ptr == '\'')
+ {
+ ptr ++;
+ while (isspace(*ptr & 255))
+ ptr ++;
+
+ if (*ptr == '-')
+ ptr ++;
+
+ while (isspace(*ptr & 255))
+ ptr ++;
+
+ safe_strcpy(comment->value.text.string, ptr);
+ }
+ }
+ else if (!strncmp(ptr, "I ", 2) || !strncmp(ptr, "O ", 2) ||
+ !strncmp(ptr, "IO ", 3))
+ {
+ /*
+ * 'Convert "I - description", "IO - description", or "O - description"
+ * to description + directory attribute.
+ */
+
+ ptr = strchr(ptr, ' ');
+ *ptr++ = '\0';
+
+ if (!strcmp(parent->value.element.name, "argument"))
+ mxmlElementSetAttr(parent, "direction", comment->value.text.string);
+
+ while (isspace(*ptr & 255))
+ ptr ++;
+
+ if (*ptr == '-')
+ ptr ++;
+
+ while (isspace(*ptr & 255))
+ ptr ++;
+
+ safe_strcpy(comment->value.text.string, ptr);
+ }
+
+ /*
+ * Eliminate leading and trailing *'s...
+ */
+
+ for (ptr = comment->value.text.string; *ptr == '*'; ptr ++);
+ for (; isspace(*ptr & 255); ptr ++);
+ if (ptr > comment->value.text.string)
+ safe_strcpy(comment->value.text.string, ptr);
+
+ for (ptr = comment->value.text.string + strlen(comment->value.text.string) - 1;
+ ptr > comment->value.text.string && *ptr == '*';
+ ptr --)
+ *ptr = '\0';
+ for (; ptr > comment->value.text.string && isspace(*ptr & 255); ptr --)
+ *ptr = '\0';
+
+#ifdef DEBUG
+ fprintf(stderr, " updated comment = %s\n", comment->value.text.string);
+#endif /* DEBUG */
+}
+
+
+/*
+ * 'usage()' - Show program usage...
+ */
+
+static void
+usage(const char *option) /* I - Unknown option */
+{
+ if (option)
+ printf("mxmldoc: Bad option \"%s\"!\n\n", option);
+
+ puts("Usage: mxmldoc [options] [filename.xml] [source files] >filename.html");
+ puts("Options:");
+ puts(" --css filename.css Set CSS stylesheet file");
+ puts(" --docset bundleid.docset Generate documentation set");
+ puts(" --docversion version Set documentation version");
+ puts(" --feedname name Set documentation set feed name");
+ puts(" --feedurl url Set documentation set feed URL");
+ puts(" --footer footerfile Set footer file");
+ puts(" --framed basename Generate framed HTML to basename*.html");
+ puts(" --header headerfile Set header file");
+ puts(" --intro introfile Set introduction file");
+ puts(" --man name Generate man page");
+ puts(" --no-output Do no generate documentation file");
+ puts(" --section section Set section name");
+ puts(" --title title Set documentation title");
+ puts(" --tokens path Generate Xcode docset Tokens.xml file");
+
+ exit(1);
+}
+
+
+/*
+ * 'write_description()' - Write the description text.
+ */
+
+static void
+write_description(
+ FILE *out, /* I - Output file */
+ mxml_node_t *description, /* I - Description node */
+ const char *element, /* I - HTML element, if any */
+ int summary) /* I - Show summary */
+{
+ char text[10240], /* Text for description */
+ *start, /* Start of code/link */
+ *ptr; /* Pointer into text */
+ int col; /* Current column */
+
+
+ if (!description)
+ return;
+
+ get_text(description, text, sizeof(text));
+
+ ptr = strstr(text, "\n\n");
+
+ if (summary)
+ {
+ if (ptr)
+ *ptr = '\0';
+
+ ptr = text;
+ }
+ else if (!ptr || !ptr[2])
+ return;
+ else
+ ptr += 2;
+
+ if (element && *element)
+ fprintf(out, "<%s class=\"%s\">", element,
+ summary ? "description" : "discussion");
+ else if (!summary)
+ fputs(".PP\n", out);
+
+ for (col = 0; *ptr; ptr ++)
+ {
+ if (*ptr == '@' &&
+ (!strncmp(ptr + 1, "deprecated@", 11) ||
+ !strncmp(ptr + 1, "since ", 6)))
+ {
+ ptr ++;
+ while (*ptr && *ptr != '@')
+ ptr ++;
+
+ if (!*ptr)
+ return;
+ }
+ else if (!strncmp(ptr, "@code ", 6))
+ {
+ for (ptr += 6; isspace(*ptr & 255); ptr ++);
+
+ for (start = ptr, ptr ++; *ptr && *ptr != '@'; ptr ++);
+
+ if (*ptr)
+ *ptr = '\0';
+ else
+ ptr --;
+
+ if (element && *element)
+ fprintf(out, "<code>%s</code>", start);
+ else if (element)
+ fputs(start, out);
+ else
+ fprintf(out, "\\fB%s\\fR", start);
+ }
+ else if (!strncmp(ptr, "@link ", 6))
+ {
+ for (ptr += 6; isspace(*ptr & 255); ptr ++);
+
+ for (start = ptr, ptr ++; *ptr && *ptr != '@'; ptr ++);
+
+ if (*ptr)
+ *ptr = '\0';
+ else
+ ptr --;
+
+ if (element && *element)
+ fprintf(out, "<a href=\"#%s\"><code>%s</code></a>", start, start);
+ else if (element)
+ fputs(start, out);
+ else
+ fprintf(out, "\\fI%s\\fR", start);
+ }
+ else if (element)
+ {
+ if (*ptr == '&')
+ fputs("&amp;", out);
+ else if (*ptr == '<')
+ fputs("&lt;", out);
+ else if (*ptr == '>')
+ fputs("&gt;", out);
+ else if (*ptr == '\"')
+ fputs("&quot;", out);
+ else if (*ptr & 128)
+ {
+ /*
+ * Convert UTF-8 to Unicode constant...
+ */
+
+ int ch; /* Unicode character */
+
+
+ ch = *ptr & 255;
+
+ if ((ch & 0xe0) == 0xc0)
+ {
+ ch = ((ch & 0x1f) << 6) | (ptr[1] & 0x3f);
+ ptr ++;
+ }
+ else if ((ch & 0xf0) == 0xe0)
+ {
+ ch = ((((ch * 0x0f) << 6) | (ptr[1] & 0x3f)) << 6) | (ptr[2] & 0x3f);
+ ptr += 2;
+ }
+
+ if (ch == 0xa0)
+ {
+ /*
+ * Handle non-breaking space as-is...
+ */
+
+ fputs("&nbsp;", out);
+ }
+ else
+ fprintf(out, "&#x%x;", ch);
+ }
+ else if (*ptr == '\n' && ptr[1] == '\n' && ptr[2] && ptr[2] != '@')
+ {
+ fputs("<br>\n<br>\n", out);
+ ptr ++;
+ }
+ else
+ putc(*ptr, out);
+ }
+ else if (*ptr == '\n' && ptr[1] == '\n' && ptr[2] && ptr[2] != '@')
+ {
+ fputs("\n.PP\n", out);
+ ptr ++;
+ }
+ else
+ {
+ if (*ptr == '\\' || (*ptr == '.' && col == 0))
+ putc('\\', out);
+
+ putc(*ptr, out);
+
+ if (*ptr == '\n')
+ col = 0;
+ else
+ col ++;
+ }
+ }
+
+ if (element && *element)
+ fprintf(out, "</%s>\n", element);
+ else if (!element)
+ putc('\n', out);
+}
+
+
+/*
+ * 'write_element()' - Write an element's text nodes.
+ */
+
+static void
+write_element(FILE *out, /* I - Output file */
+ mxml_node_t *doc, /* I - Document tree */
+ mxml_node_t *element, /* I - Element to write */
+ int mode) /* I - Output mode */
+{
+ mxml_node_t *node; /* Current node */
+
+
+ if (!element)
+ return;
+
+ for (node = element->child;
+ node;
+ node = mxmlWalkNext(node, element, MXML_NO_DESCEND))
+ if (node->type == MXML_TEXT)
+ {
+ if (node->value.text.whitespace)
+ putc(' ', out);
+
+ if (mode == OUTPUT_HTML &&
+ (mxmlFindElement(doc, doc, "class", "name", node->value.text.string,
+ MXML_DESCEND) ||
+ mxmlFindElement(doc, doc, "enumeration", "name",
+ node->value.text.string, MXML_DESCEND) ||
+ mxmlFindElement(doc, doc, "struct", "name", node->value.text.string,
+ MXML_DESCEND) ||
+ mxmlFindElement(doc, doc, "typedef", "name", node->value.text.string,
+ MXML_DESCEND) ||
+ mxmlFindElement(doc, doc, "union", "name", node->value.text.string,
+ MXML_DESCEND)))
+ {
+ fputs("<a href=\"#", out);
+ write_string(out, node->value.text.string, mode);
+ fputs("\">", out);
+ write_string(out, node->value.text.string, mode);
+ fputs("</a>", out);
+ }
+ else
+ write_string(out, node->value.text.string, mode);
+ }
+
+ if (!strcmp(element->value.element.name, "type") &&
+ element->last_child->value.text.string[0] != '*')
+ putc(' ', out);
+}
+
+
+/*
+ * 'write_file()' - Copy a file to the output.
+ */
+
+static void
+write_file(FILE *out, /* I - Output file */
+ const char *file) /* I - File to copy */
+{
+ FILE *fp; /* Copy file */
+ char line[8192]; /* Line from file */
+
+
+ if ((fp = fopen(file, "r")) == NULL)
+ {
+ fprintf(stderr, "mxmldoc: Unable to open \"%s\": %s\n", file,
+ strerror(errno));
+ return;
+ }
+
+ while (fgets(line, sizeof(line), fp))
+ fputs(line, out);
+
+ fclose(fp);
+}
+
+
+/*
+ * 'write_function()' - Write documentation for a function.
+ */
+
+static void
+write_function(FILE *out, /* I - Output file */
+ mxml_node_t *doc, /* I - Document */
+ mxml_node_t *function, /* I - Function */
+ int level) /* I - Base heading level */
+{
+ mxml_node_t *arg, /* Current argument */
+ *adesc, /* Description of argument */
+ *description, /* Description of function */
+ *type, /* Type for argument */
+ *node; /* Node in description */
+ const char *name, /* Name of function/type */
+ *defval; /* Default value */
+ char prefix; /* Prefix character */
+ char *sep; /* Newline separator */
+
+
+ name = mxmlElementGetAttr(function, "name");
+ description = mxmlFindElement(function, function, "description", NULL,
+ NULL, MXML_DESCEND_FIRST);
+
+ fprintf(out, "<h%d class=\"%s\">%s<a name=\"%s\">%s</a></h%d>\n",
+ level, level == 3 ? "function" : "method",
+ get_comment_info(description), name, name, level);
+
+ if (description)
+ write_description(out, description, "p", 1);
+
+ fputs("<p class=\"code\">\n", out);
+
+ arg = mxmlFindElement(function, function, "returnvalue", NULL,
+ NULL, MXML_DESCEND_FIRST);
+
+ if (arg)
+ write_element(out, doc, mxmlFindElement(arg, arg, "type", NULL,
+ NULL, MXML_DESCEND_FIRST),
+ OUTPUT_HTML);
+ else
+ fputs("void ", out);
+
+ fprintf(out, "%s ", name);
+ for (arg = mxmlFindElement(function, function, "argument", NULL, NULL,
+ MXML_DESCEND_FIRST), prefix = '(';
+ arg;
+ arg = mxmlFindElement(arg, function, "argument", NULL, NULL,
+ MXML_NO_DESCEND), prefix = ',')
+ {
+ type = mxmlFindElement(arg, arg, "type", NULL, NULL,
+ MXML_DESCEND_FIRST);
+
+ fprintf(out, "%c<br>\n&nbsp;&nbsp;&nbsp;&nbsp;", prefix);
+ if (type->child)
+ write_element(out, doc, type, OUTPUT_HTML);
+
+ fputs(mxmlElementGetAttr(arg, "name"), out);
+ if ((defval = mxmlElementGetAttr(arg, "default")) != NULL)
+ fprintf(out, " %s", defval);
+ }
+
+ if (prefix == '(')
+ fputs("(void);</p>\n", out);
+ else
+ {
+ fprintf(out,
+ "<br>\n);</p>\n"
+ "<h%d class=\"parameters\">Parameters</h%d>\n"
+ "<dl>\n", level + 1, level + 1);
+
+ for (arg = mxmlFindElement(function, function, "argument", NULL, NULL,
+ MXML_DESCEND_FIRST);
+ arg;
+ arg = mxmlFindElement(arg, function, "argument", NULL, NULL,
+ MXML_NO_DESCEND))
+ {
+ fprintf(out, "<dt>%s</dt>\n", mxmlElementGetAttr(arg, "name"));
+
+ adesc = mxmlFindElement(arg, arg, "description", NULL, NULL,
+ MXML_DESCEND_FIRST);
+
+ write_description(out, adesc, "dd", 1);
+ write_description(out, adesc, "dd", 0);
+ }
+
+ fputs("</dl>\n", out);
+ }
+
+ arg = mxmlFindElement(function, function, "returnvalue", NULL,
+ NULL, MXML_DESCEND_FIRST);
+
+ if (arg)
+ {
+ fprintf(out, "<h%d class=\"returnvalue\">Return Value</h%d>\n", level + 1,
+ level + 1);
+
+ adesc = mxmlFindElement(arg, arg, "description", NULL, NULL,
+ MXML_DESCEND_FIRST);
+
+ write_description(out, adesc, "p", 1);
+ write_description(out, adesc, "p", 0);
+ }
+
+ if (description)
+ {
+ for (node = description->child; node; node = node->next)
+ if (node->value.text.string &&
+ (sep = strstr(node->value.text.string, "\n\n")) != NULL)
+ {
+ sep += 2;
+ if (*sep && strncmp(sep, "@since ", 7) &&
+ strncmp(sep, "@deprecated@", 12))
+ break;
+ }
+
+ if (node)
+ {
+ fprintf(out, "<h%d class=\"discussion\">Discussion</h%d>\n", level + 1,
+ level + 1);
+ write_description(out, description, "p", 0);
+ }
+ }
+}
+
+
+/*
+ * 'write_html()' - Write HTML documentation.
+ */
+
+static void
+write_html(const char *section, /* I - Section */
+ const char *title, /* I - Title */
+ const char *footerfile, /* I - Footer file */
+ const char *headerfile, /* I - Header file */
+ const char *introfile, /* I - Intro file */
+ const char *cssfile, /* I - Stylesheet file */
+ const char *framefile, /* I - Framed HTML basename */
+ const char *docset, /* I - Documentation set directory */
+ const char *docversion, /* I - Documentation set version */
+ const char *feedname, /* I - Feed name for doc set */
+ const char *feedurl, /* I - Feed URL for doc set */
+ mxml_node_t *doc) /* I - XML documentation */
+{
+ FILE *out; /* Output file */
+ mxml_node_t *function, /* Current function */
+ *scut, /* Struct/class/union/typedef */
+ *arg, /* Current argument */
+ *description, /* Description of function/var */
+ *type; /* Type for argument */
+ const char *name, /* Name of function/type */
+ *defval, /* Default value */
+ *basename; /* Base filename for framed output */
+ char filename[1024]; /* Current output filename */
+
+
+ if (framefile)
+ {
+ /*
+ * Get the basename of the frame file...
+ */
+
+ if ((basename = strrchr(framefile, '/')) != NULL)
+ basename ++;
+ else
+ basename = framefile;
+
+ if (strstr(basename, ".html"))
+ fputs("mxmldoc: Frame base name should not contain .html extension!\n",
+ stderr);
+
+ /*
+ * Create the container HTML file for the frames...
+ */
+
+ snprintf(filename, sizeof(filename), "%s.html", framefile);
+
+ if ((out = fopen(filename, "w")) == NULL)
+ {
+ fprintf(stderr, "mxmldoc: Unable to create \"%s\": %s\n", filename,
+ strerror(errno));
+ return;
+ }
+
+ fputs("<!DOCTYPE html PUBLIC \"-//W3C//DTD HTML 4.01 Frameset//EN\" "
+ "\"http://www.w3.org/TR/html4/frameset.dtd\">\n"
+ "<html>\n"
+ "<head>\n"
+ "<title>", out);
+ write_string(out, title, OUTPUT_HTML);
+ fputs("</title>\n", out);
+
+ if (section)
+ fprintf(out, "<meta name=\"keywords\" content=\"%s\">\n", section);
+
+ fputs("<meta name=\"creator\" content=\"" MXML_VERSION "\">\n"
+ "<frameset cols=\"250,*\">\n", out);
+ fprintf(out, "<frame src=\"%s-toc.html\">\n", basename);
+ fprintf(out, "<frame name=\"body\" src=\"%s-body.html\">\n", basename);
+ fputs("</frameset>\n"
+ "<noframes>\n"
+ "<h1>", out);
+ write_string(out, title, OUTPUT_HTML);
+ fprintf(out,
+ "</h1>\n"
+ "<ul>\n"
+ "\t<li><a href=\"%s-toc.html\">Table of Contents</a></li>\n"
+ "\t<li><a href=\"%s-body.html\">Body</a></li>\n"
+ "</ul>\n", basename, basename);
+ fputs("</noframes>\n"
+ "</html>\n", out);
+ fclose(out);
+
+ /*
+ * Write the table-of-contents file...
+ */
+
+ snprintf(filename, sizeof(filename), "%s-toc.html", framefile);
+
+ if ((out = fopen(filename, "w")) == NULL)
+ {
+ fprintf(stderr, "mxmldoc: Unable to create \"%s\": %s\n", filename,
+ strerror(errno));
+ return;
+ }
+
+ write_html_head(out, section, title, cssfile);
+
+ snprintf(filename, sizeof(filename), "%s-body.html", basename);
+
+ fputs("<div class=\"contents\">\n", out);
+ fprintf(out, "<h1 class=\"title\"><a href=\"%s\" target=\"body\">",
+ filename);
+ write_string(out, title, OUTPUT_HTML);
+ fputs("</a></h1>\n", out);
+
+ write_toc(out, doc, introfile, filename, 0);
+
+ fputs("</div>\n"
+ "</body>\n"
+ "</html>\n", out);
+ fclose(out);
+
+ /*
+ * Finally, open the body file...
+ */
+
+ snprintf(filename, sizeof(filename), "%s-body.html", framefile);
+
+ if ((out = fopen(filename, "w")) == NULL)
+ {
+ fprintf(stderr, "mxmldoc: Unable to create \"%s\": %s\n", filename,
+ strerror(errno));
+ return;
+ }
+ }
+ else if (docset)
+ {
+ /*
+ * Create an Xcode documentation set - start by removing any existing
+ * output directory...
+ */
+
+#ifdef __APPLE__
+ const char *id; /* Identifier */
+
+
+ if (!access(docset, 0) && !remove_directory(docset))
+ return;
+
+ /*
+ * Then make the Apple standard bundle directory structure...
+ */
+
+ if (mkdir(docset, 0755))
+ {
+ fprintf(stderr, "mxmldoc: Unable to create \"%s\": %s\n", docset,
+ strerror(errno));
+ return;
+ }
+
+ snprintf(filename, sizeof(filename), "%s/Contents", docset);
+ if (mkdir(filename, 0755))
+ {
+ fprintf(stderr, "mxmldoc: Unable to create \"%s\": %s\n", filename,
+ strerror(errno));
+ return;
+ }
+
+ snprintf(filename, sizeof(filename), "%s/Contents/Resources", docset);
+ if (mkdir(filename, 0755))
+ {
+ fprintf(stderr, "mxmldoc: Unable to create \"%s\": %s\n", filename,
+ strerror(errno));
+ return;
+ }
+
+ snprintf(filename, sizeof(filename), "%s/Contents/Resources/Documentation",
+ docset);
+ if (mkdir(filename, 0755))
+ {
+ fprintf(stderr, "mxmldoc: Unable to create \"%s\": %s\n", filename,
+ strerror(errno));
+ return;
+ }
+
+ /*
+ * The Info.plist file, which describes the documentation set...
+ */
+
+ if ((id = strrchr(docset, '/')) != NULL)
+ id ++;
+ else
+ id = docset;
+
+ snprintf(filename, sizeof(filename), "%s/Contents/Info.plist", docset);
+ if ((out = fopen(filename, "w")) == NULL)
+ {
+ fprintf(stderr, "mxmldoc: Unable to create \"%s\": %s\n", filename,
+ strerror(errno));
+ return;
+ }
+
+ fputs("<?xml version=\"1.0\" encoding=\"UTF-8\"?>\n"
+ "<!DOCTYPE plist PUBLIC \"-//Apple//DTD PLIST 1.0//EN\" \"http://www.apple.com/DTDs/PropertyList-1.0.dtd\">\n"
+ "<plist version=\"1.0\">\n"
+ "<dict>\n"
+ "\t<key>CFBundleIdentifier</key>\n"
+ "\t<string>", out);
+ write_string(out, id, OUTPUT_HTML);
+ fputs("</string>\n"
+ "\t<key>CFBundleName</key>\n"
+ "\t<string>", out);
+ write_string(out, title, OUTPUT_HTML);
+ fputs("</string>\n"
+ "\t<key>CFBundleVersion</key>\n"
+ "\t<string>", out);
+ write_string(out, docversion ? docversion : "0.0", OUTPUT_HTML);
+ fputs("</string>\n", out);
+
+ if (feedname)
+ {
+ fputs("\t<key>DocSetFeedName</key>\n"
+ "\t<string>", out);
+ write_string(out, feedname ? feedname : title, OUTPUT_HTML);
+ fputs("</string>\n", out);
+ }
+
+ if (feedurl)
+ {
+ fputs("\t<key>DocSetFeedURL</key>\n"
+ "\t<string>", out);
+ write_string(out, feedurl, OUTPUT_HTML);
+ fputs("</string>\n", out);
+ }
+
+ fputs("</dict>\n"
+ "</plist>\n", out);
+
+ fclose(out);
+
+ /*
+ * Next the Nodes.xml file...
+ */
+
+ snprintf(filename, sizeof(filename), "%s/Contents/Resources/Nodes.xml",
+ docset);
+ if ((out = fopen(filename, "w")) == NULL)
+ {
+ fprintf(stderr, "mxmldoc: Unable to create \"%s\": %s\n", filename,
+ strerror(errno));
+ return;
+ }
+
+ fputs("<?xml version=\"1.0\" encoding=\"UTF-8\"?>\n"
+ "<DocSetNodes version=\"1.0\">\n"
+ "<TOC>\n"
+ "<Node id=\"0\">\n"
+ "<Name>", out);
+ write_string(out, title, OUTPUT_HTML);
+ fputs("</Name>\n"
+ "<Path>Documentation/index.html</Path>\n"
+ "<Subnodes>\n", out);
+
+ write_toc(out, doc, introfile, NULL, 1);
+
+ fputs("</Subnodes>\n"
+ "</Node>\n"
+ "</TOC>\n"
+ "</DocSetNodes>\n", out);
+
+ fclose(out);
+
+ /*
+ * Then the Tokens.xml file...
+ */
+
+ snprintf(filename, sizeof(filename), "%s/Contents/Resources/Tokens.xml",
+ docset);
+ if ((out = fopen(filename, "w")) == NULL)
+ {
+ fprintf(stderr, "mxmldoc: Unable to create \"%s\": %s\n", filename,
+ strerror(errno));
+ return;
+ }
+
+ fputs("<?xml version=\"1.0\" encoding=\"UTF-8\"?>\n"
+ "<Tokens version=\"1.0\">\n", out);
+
+ write_tokens(out, doc, "index.html");
+
+ fputs("</Tokens>\n", out);
+
+ fclose(out);
+
+ /*
+ * Finally the HTML file...
+ */
+
+ snprintf(filename, sizeof(filename),
+ "%s/Contents/Resources/Documentation/index.html",
+ docset);
+ if ((out = fopen(filename, "w")) == NULL)
+ {
+ fprintf(stderr, "mxmldoc: Unable to create \"%s\": %s\n", filename,
+ strerror(errno));
+ return;
+ }
+
+#else
+ fputs("mxmldoc: Xcode documentation sets can only be created on "
+ "Mac OS X.\n", stderr);
+ return;
+#endif /* __APPLE__ */
+ }
+ else
+ out = stdout;
+
+ /*
+ * Standard header...
+ */
+
+ write_html_head(out, section, title, cssfile);
+
+ fputs("<div class='body'>\n", out);
+
+ /*
+ * Header...
+ */
+
+ if (headerfile)
+ {
+ /*
+ * Use custom header...
+ */
+
+ write_file(out, headerfile);
+ }
+ else
+ {
+ /*
+ * Use standard header...
+ */
+
+ fputs("<h1 class=\"title\">", out);
+ write_string(out, title, OUTPUT_HTML);
+ fputs("</h1>\n", out);
+ }
+
+ /*
+ * Table of contents...
+ */
+
+ if (!framefile)
+ write_toc(out, doc, introfile, NULL, 0);
+
+ /*
+ * Intro...
+ */
+
+ if (introfile)
+ write_file(out, introfile);
+
+ /*
+ * List of classes...
+ */
+
+ if ((scut = find_public(doc, doc, "class")) != NULL)
+ {
+ fputs("<h2 class=\"title\"><a name=\"CLASSES\">Classes</a></h2>\n", out);
+
+ while (scut)
+ {
+ write_scu(out, doc, scut);
+
+ scut = find_public(scut, doc, "class");
+ }
+ }
+
+ /*
+ * List of functions...
+ */
+
+ if ((function = find_public(doc, doc, "function")) != NULL)
+ {
+ fputs("<h2 class=\"title\"><a name=\"FUNCTIONS\">Functions</a></h2>\n", out);
+
+ while (function)
+ {
+ write_function(out, doc, function, 3);
+
+ function = find_public(function, doc, "function");
+ }
+ }
+
+ /*
+ * List of types...
+ */
+
+ if ((scut = find_public(doc, doc, "typedef")) != NULL)
+ {
+ fputs("<h2 class=\"title\"><a name=\"TYPES\">Data Types</a></h2>\n", out);
+
+ while (scut)
+ {
+ name = mxmlElementGetAttr(scut, "name");
+ description = mxmlFindElement(scut, scut, "description", NULL,
+ NULL, MXML_DESCEND_FIRST);
+ fprintf(out, "<h3 class=\"typedef\">%s<a name=\"%s\">%s</a></h3>\n",
+ get_comment_info(description), name, name);
+
+ if (description)
+ write_description(out, description, "p", 1);
+
+ fputs("<p class=\"code\">\n"
+ "typedef ", out);
+
+ type = mxmlFindElement(scut, scut, "type", NULL, NULL,
+ MXML_DESCEND_FIRST);
+
+ for (type = type->child; type; type = type->next)
+ if (!strcmp(type->value.text.string, "("))
+ break;
+ else
+ {
+ if (type->value.text.whitespace)
+ putc(' ', out);
+
+ if (mxmlFindElement(doc, doc, "class", "name",
+ type->value.text.string, MXML_DESCEND) ||
+ mxmlFindElement(doc, doc, "enumeration", "name",
+ type->value.text.string, MXML_DESCEND) ||
+ mxmlFindElement(doc, doc, "struct", "name",
+ type->value.text.string, MXML_DESCEND) ||
+ mxmlFindElement(doc, doc, "typedef", "name",
+ type->value.text.string, MXML_DESCEND) ||
+ mxmlFindElement(doc, doc, "union", "name",
+ type->value.text.string, MXML_DESCEND))
+ {
+ fputs("<a href=\"#", out);
+ write_string(out, type->value.text.string, OUTPUT_HTML);
+ fputs("\">", out);
+ write_string(out, type->value.text.string, OUTPUT_HTML);
+ fputs("</a>", out);
+ }
+ else
+ write_string(out, type->value.text.string, OUTPUT_HTML);
+ }
+
+ if (type)
+ {
+ /*
+ * Output function type...
+ */
+
+ if (type->prev && type->prev->value.text.string[0] != '*')
+ putc(' ', out);
+
+ fprintf(out, "(*%s", name);
+
+ for (type = type->next->next; type; type = type->next)
+ {
+ if (type->value.text.whitespace)
+ putc(' ', out);
+
+ if (mxmlFindElement(doc, doc, "class", "name",
+ type->value.text.string, MXML_DESCEND) ||
+ mxmlFindElement(doc, doc, "enumeration", "name",
+ type->value.text.string, MXML_DESCEND) ||
+ mxmlFindElement(doc, doc, "struct", "name",
+ type->value.text.string, MXML_DESCEND) ||
+ mxmlFindElement(doc, doc, "typedef", "name",
+ type->value.text.string, MXML_DESCEND) ||
+ mxmlFindElement(doc, doc, "union", "name",
+ type->value.text.string, MXML_DESCEND))
+ {
+ fputs("<a href=\"#", out);
+ write_string(out, type->value.text.string, OUTPUT_HTML);
+ fputs("\">", out);
+ write_string(out, type->value.text.string, OUTPUT_HTML);
+ fputs("</a>", out);
+ }
+ else
+ write_string(out, type->value.text.string, OUTPUT_HTML);
+ }
+
+ fputs(";\n", out);
+ }
+ else
+ {
+ type = mxmlFindElement(scut, scut, "type", NULL, NULL,
+ MXML_DESCEND_FIRST);
+ if (type->last_child->value.text.string[0] != '*')
+ putc(' ', out);
+
+ fprintf(out, "%s;\n", name);
+ }
+
+ fputs("</p>\n", out);
+
+ scut = find_public(scut, doc, "typedef");
+ }
+ }
+
+ /*
+ * List of structures...
+ */
+
+ if ((scut = find_public(doc, doc, "struct")) != NULL)
+ {
+ fputs("<h2 class=\"title\"><a name=\"STRUCTURES\">Structures</a></h2>\n",
+ out);
+
+ while (scut)
+ {
+ write_scu(out, doc, scut);
+
+ scut = find_public(scut, doc, "struct");
+ }
+ }
+
+ /*
+ * List of unions...
+ */
+
+ if ((scut = find_public(doc, doc, "union")) != NULL)
+ {
+ fputs("<h2 class=\"title\"><a name=\"UNIONS\">Unions</a></h2>\n", out);
+
+ while (scut)
+ {
+ write_scu(out, doc, scut);
+
+ scut = find_public(scut, doc, "union");
+ }
+ }
+
+ /*
+ * Variables...
+ */
+
+ if ((arg = find_public(doc, doc, "variable")) != NULL)
+ {
+ fputs("<h2 class=\"title\"><a name=\"VARIABLES\">Variables</a></h2>\n",
+ out);
+
+ while (arg)
+ {
+ name = mxmlElementGetAttr(arg, "name");
+ description = mxmlFindElement(arg, arg, "description", NULL,
+ NULL, MXML_DESCEND_FIRST);
+ fprintf(out, "<h3 class=\"variable\">%s<a name=\"%s\">%s</a></h3>\n",
+ get_comment_info(description), name, name);
+
+ if (description)
+ write_description(out, description, "p", 1);
+
+ fputs("<p class=\"code\">", out);
+
+ write_element(out, doc, mxmlFindElement(arg, arg, "type", NULL,
+ NULL, MXML_DESCEND_FIRST),
+ OUTPUT_HTML);
+ fputs(mxmlElementGetAttr(arg, "name"), out);
+ if ((defval = mxmlElementGetAttr(arg, "default")) != NULL)
+ fprintf(out, " %s", defval);
+ fputs(";</p>\n", out);
+
+ arg = find_public(arg, doc, "variable");
+ }
+ }
+
+ /*
+ * List of enumerations...
+ */
+
+ if ((scut = find_public(doc, doc, "enumeration")) != NULL)
+ {
+ fputs("<h2 class=\"title\"><a name=\"ENUMERATIONS\">Constants</a></h2>\n",
+ out);
+
+ while (scut)
+ {
+ name = mxmlElementGetAttr(scut, "name");
+ description = mxmlFindElement(scut, scut, "description", NULL,
+ NULL, MXML_DESCEND_FIRST);
+ fprintf(out, "<h3 class=\"enumeration\">%s<a name=\"%s\">%s</a></h3>\n",
+ get_comment_info(description), name, name);
+
+ if (description)
+ write_description(out, description, "p", 1);
+
+ fputs("<h4 class=\"constants\">Constants</h4>\n"
+ "<dl>\n", out);
+
+ for (arg = mxmlFindElement(scut, scut, "constant", NULL, NULL,
+ MXML_DESCEND_FIRST);
+ arg;
+ arg = mxmlFindElement(arg, scut, "constant", NULL, NULL,
+ MXML_NO_DESCEND))
+ {
+ description = mxmlFindElement(arg, arg, "description", NULL,
+ NULL, MXML_DESCEND_FIRST);
+ fprintf(out, "<dt>%s %s</dt>\n",
+ mxmlElementGetAttr(arg, "name"), get_comment_info(description));
+
+ write_description(out, description, "dd", 1);
+ write_description(out, description, "dd", 0);
+ }
+
+ fputs("</dl>\n", out);
+
+ scut = find_public(scut, doc, "enumeration");
+ }
+ }
+
+ /*
+ * Footer...
+ */
+
+ if (footerfile)
+ {
+ /*
+ * Use custom footer...
+ */
+
+ write_file(out, footerfile);
+ }
+
+ fputs("</div>\n"
+ "</body>\n"
+ "</html>\n", out);
+
+ /*
+ * Close output file as needed...
+ */
+
+ if (out != stdout)
+ fclose(out);
+
+#ifdef __APPLE__
+ /*
+ * When generating document sets, run the docsetutil program to index it...
+ */
+
+ if (docset)
+ {
+ const char *args[4]; /* Argument array */
+ pid_t pid; /* Process ID */
+ int status; /* Exit status */
+
+
+ args[0] = "/Developer/usr/bin/docsetutil";
+ args[1] = "index";
+ args[2] = docset;
+ args[3] = NULL;
+
+ if (posix_spawn(&pid, args[0], NULL, NULL, (char **)args, environ))
+ {
+ fprintf(stderr, "mxmldoc: Unable to index documentation set \"%s\": %s\n",
+ docset, strerror(errno));
+ }
+ else
+ {
+ while (wait(&status) != pid);
+
+ if (status)
+ {
+ if (WIFEXITED(status))
+ fprintf(stderr, "mxmldoc: docsetutil exited with status %d\n",
+ WEXITSTATUS(status));
+ else
+ fprintf(stderr, "mxmldoc: docsetutil crashed with signal %d\n",
+ WTERMSIG(status));
+ }
+ else
+ {
+ /*
+ * Remove unneeded temporary XML files...
+ */
+
+ snprintf(filename, sizeof(filename), "%s/Contents/Resources/Nodes.xml",
+ docset);
+ unlink(filename);
+
+ snprintf(filename, sizeof(filename), "%s/Contents/Resources/Tokens.xml",
+ docset);
+ unlink(filename);
+ }
+ }
+ }
+#endif /* __APPLE__ */
+}
+
+
+/*
+ * 'write_html_head()' - Write the standard HTML header.
+ */
+
+static void
+write_html_head(FILE *out, /* I - Output file */
+ const char *section, /* I - Section */
+ const char *title, /* I - Title */
+ const char *cssfile) /* I - Stylesheet */
+{
+ fputs("<!DOCTYPE HTML PUBLIC \"-//W3C//DTD HTML 4.01 Transitional//EN\" "
+ "\"http://www.w3.org/TR/html4/loose.dtd\">\n"
+ "<html>\n", out);
+
+ if (section)
+ fprintf(out, "<!-- SECTION: %s -->\n", section);
+
+ fputs("<head>\n"
+ "<title>", out);
+ write_string(out, title, OUTPUT_HTML);
+ fputs("</title>\n", out);
+
+ if (section)
+ fprintf(out, "<meta name=\"keywords\" content=\"%s\">\n", section);
+
+ fputs("<meta name=\"creator\" content=\"" MXML_VERSION "\">\n"
+ "<style type=\"text/css\"><!--\n", out);
+
+ if (cssfile)
+ {
+ /*
+ * Use custom stylesheet file...
+ */
+
+ write_file(out, cssfile);
+ }
+ else
+ {
+ /*
+ * Use standard stylesheet...
+ */
+
+ fputs("body, p, h1, h2, h3, h4 {\n"
+ " font-family: lucida grande, geneva, helvetica, arial, sans-serif;\n"
+ "}\n"
+ "div.body h1 {\n"
+ " font-size: 250%;\n"
+ " font-weight: bold;\n"
+ " margin: 0;\n"
+ "}\n"
+ "div.body h2 {\n"
+ " font-size: 250%;\n"
+ " margin-top: 1.5em;\n"
+ "}\n"
+ "div.body h3 {\n"
+ " font-size: 150%;\n"
+ " margin-bottom: 0.5em;\n"
+ " margin-top: 1.5em;\n"
+ "}\n"
+ "div.body h4 {\n"
+ " font-size: 110%;\n"
+ " margin-bottom: 0.5em;\n"
+ " margin-top: 1.5em;\n"
+ "}\n"
+ "div.body h5 {\n"
+ " font-size: 100%;\n"
+ " margin-bottom: 0.5em;\n"
+ " margin-top: 1.5em;\n"
+ "}\n"
+ "div.contents {\n"
+ " background: #e8e8e8;\n"
+ " border: solid thin black;\n"
+ " padding: 10px;\n"
+ "}\n"
+ "div.contents h1 {\n"
+ " font-size: 110%;\n"
+ "}\n"
+ "div.contents h2 {\n"
+ " font-size: 100%;\n"
+ "}\n"
+ "div.contents ul.contents {\n"
+ " font-size: 80%;\n"
+ "}\n"
+ ".class {\n"
+ " border-bottom: solid 2px gray;\n"
+ "}\n"
+ ".constants {\n"
+ "}\n"
+ ".description {\n"
+ " margin-top: 0.5em;\n"
+ "}\n"
+ ".discussion {\n"
+ "}\n"
+ ".enumeration {\n"
+ " border-bottom: solid 2px gray;\n"
+ "}\n"
+ ".function {\n"
+ " border-bottom: solid 2px gray;\n"
+ " margin-bottom: 0;\n"
+ "}\n"
+ ".members {\n"
+ "}\n"
+ ".method {\n"
+ "}\n"
+ ".parameters {\n"
+ "}\n"
+ ".returnvalue {\n"
+ "}\n"
+ ".struct {\n"
+ " border-bottom: solid 2px gray;\n"
+ "}\n"
+ ".typedef {\n"
+ " border-bottom: solid 2px gray;\n"
+ "}\n"
+ ".union {\n"
+ " border-bottom: solid 2px gray;\n"
+ "}\n"
+ ".variable {\n"
+ "}\n"
+ "code, p.code, pre, ul.code li {\n"
+ " font-family: monaco, courier, monospace;\n"
+ " font-size: 90%;\n"
+ "}\n"
+ "a:link, a:visited {\n"
+ " text-decoration: none;\n"
+ "}\n"
+ "span.info {\n"
+ " background: black;\n"
+ " border: solid thin black;\n"
+ " color: white;\n"
+ " font-size: 80%;\n"
+ " font-style: italic;\n"
+ " font-weight: bold;\n"
+ " white-space: nowrap;\n"
+ "}\n"
+ "h3 span.info, h4 span.info {\n"
+ " float: right;\n"
+ " font-size: 100%;\n"
+ "}\n"
+ "ul.code, ul.contents, ul.subcontents {\n"
+ " list-style-type: none;\n"
+ " margin: 0;\n"
+ " padding-left: 0;\n"
+ "}\n"
+ "ul.code li {\n"
+ " margin: 0;\n"
+ "}\n"
+ "ul.contents > li {\n"
+ " margin-top: 1em;\n"
+ "}\n"
+ "ul.contents li ul.code, ul.contents li ul.subcontents {\n"
+ " padding-left: 2em;\n"
+ "}\n"
+ "div.body dl {\n"
+ " margin-top: 0;\n"
+ "}\n"
+ "div.body dt {\n"
+ " font-style: italic;\n"
+ " margin-top: 0;\n"
+ "}\n"
+ "div.body dd {\n"
+ " margin-bottom: 0.5em;\n"
+ "}\n"
+ "h1.title {\n"
+ "}\n"
+ "h2.title {\n"
+ " border-bottom: solid 2px black;\n"
+ "}\n"
+ "h3.title {\n"
+ " border-bottom: solid 2px black;\n"
+ "}\n", out);
+ }
+
+ fputs("--></style>\n"
+ "</head>\n"
+ "<body>\n", out);
+}
+
+
+/*
+ * 'write_man()' - Write manpage documentation.
+ */
+
+static void
+write_man(const char *man_name, /* I - Name of manpage */
+ const char *section, /* I - Section */
+ const char *title, /* I - Title */
+ const char *footerfile, /* I - Footer file */
+ const char *headerfile, /* I - Header file */
+ const char *introfile, /* I - Intro file */
+ mxml_node_t *doc) /* I - XML documentation */
+{
+ int i; /* Looping var */
+ mxml_node_t *function, /* Current function */
+ *scut, /* Struct/class/union/typedef */
+ *arg, /* Current argument */
+ *description, /* Description of function/var */
+ *type; /* Type for argument */
+ const char *name, /* Name of function/type */
+ *cname, /* Class name */
+ *defval, /* Default value */
+ *parent; /* Parent class */
+ int inscope; /* Variable/method scope */
+ char prefix; /* Prefix character */
+ time_t curtime; /* Current time */
+ struct tm *curdate; /* Current date */
+ char buffer[1024]; /* String buffer */
+ static const char * const scopes[] = /* Scope strings */
+ {
+ "private",
+ "protected",
+ "public"
+ };
+
+
+ /*
+ * Standard man page...
+ */
+
+ curtime = time(NULL);
+ curdate = localtime(&curtime);
+ strftime(buffer, sizeof(buffer), "%x", curdate);
+
+ printf(".TH %s %s \"%s\" \"%s\" \"%s\"\n", man_name, section ? section : "3",
+ title ? title : "", buffer, title ? title : "");
+
+ /*
+ * Header...
+ */
+
+ if (headerfile)
+ {
+ /*
+ * Use custom header...
+ */
+
+ write_file(stdout, headerfile);
+ }
+ else
+ {
+ /*
+ * Use standard header...
+ */
+
+ puts(".SH NAME");
+ printf("%s \\- %s\n", man_name, title ? title : man_name);
+ }
+
+ /*
+ * Intro...
+ */
+
+ if (introfile)
+ write_file(stdout, introfile);
+
+ /*
+ * List of classes...
+ */
+
+ if (find_public(doc, doc, "class"))
+ {
+ puts(".SH CLASSES");
+
+ for (scut = find_public(doc, doc, "class");
+ scut;
+ scut = find_public(scut, doc, "class"))
+ {
+ cname = mxmlElementGetAttr(scut, "name");
+ description = mxmlFindElement(scut, scut, "description", NULL,
+ NULL, MXML_DESCEND_FIRST);
+ printf(".SS %s\n", cname);
+
+ write_description(stdout, description, NULL, 1);
+
+ printf(".PP\n"
+ ".nf\n"
+ "class %s", cname);
+ if ((parent = mxmlElementGetAttr(scut, "parent")) != NULL)
+ printf(" %s", parent);
+ puts("\n{");
+
+ for (i = 0; i < 3; i ++)
+ {
+ inscope = 0;
+
+ for (arg = mxmlFindElement(scut, scut, "variable", "scope", scopes[i],
+ MXML_DESCEND_FIRST);
+ arg;
+ arg = mxmlFindElement(arg, scut, "variable", "scope", scopes[i],
+ MXML_NO_DESCEND))
+ {
+ if (!inscope)
+ {
+ inscope = 1;
+ printf(" %s:\n", scopes[i]);
+ }
+
+ printf(" ");
+ write_element(stdout, doc, mxmlFindElement(arg, arg, "type", NULL,
+ NULL, MXML_DESCEND_FIRST),
+ OUTPUT_MAN);
+ printf("%s;\n", mxmlElementGetAttr(arg, "name"));
+ }
+
+ for (function = mxmlFindElement(scut, scut, "function", "scope",
+ scopes[i], MXML_DESCEND_FIRST);
+ function;
+ function = mxmlFindElement(function, scut, "function", "scope",
+ scopes[i], MXML_NO_DESCEND))
+ {
+ if (!inscope)
+ {
+ inscope = 1;
+ printf(" %s:\n", scopes[i]);
+ }
+
+ name = mxmlElementGetAttr(function, "name");
+
+ printf(" ");
+
+ arg = mxmlFindElement(function, function, "returnvalue", NULL,
+ NULL, MXML_DESCEND_FIRST);
+
+ if (arg)
+ write_element(stdout, doc, mxmlFindElement(arg, arg, "type", NULL,
+ NULL, MXML_DESCEND_FIRST),
+ OUTPUT_MAN);
+ else if (strcmp(cname, name) && strcmp(cname, name + 1))
+ fputs("void ", stdout);
+
+ printf("%s", name);
+
+ for (arg = mxmlFindElement(function, function, "argument", NULL, NULL,
+ MXML_DESCEND_FIRST), prefix = '(';
+ arg;
+ arg = mxmlFindElement(arg, function, "argument", NULL, NULL,
+ MXML_NO_DESCEND), prefix = ',')
+ {
+ type = mxmlFindElement(arg, arg, "type", NULL, NULL,
+ MXML_DESCEND_FIRST);
+
+ putchar(prefix);
+ if (prefix == ',')
+ putchar(' ');
+
+ if (type->child)
+ write_element(stdout, doc, type, OUTPUT_MAN);
+ fputs(mxmlElementGetAttr(arg, "name"), stdout);
+ if ((defval = mxmlElementGetAttr(arg, "default")) != NULL)
+ printf(" %s", defval);
+ }
+
+ if (prefix == '(')
+ puts("(void);");
+ else
+ puts(");");
+ }
+ }
+
+ puts("};\n"
+ ".fi");
+
+ write_description(stdout, description, NULL, 0);
+ }
+ }
+
+ /*
+ * List of enumerations...
+ */
+
+ if (find_public(doc, doc, "enumeration"))
+ {
+ puts(".SH ENUMERATIONS");
+
+ for (scut = find_public(doc, doc, "enumeration");
+ scut;
+ scut = find_public(scut, doc, "enumeration"))
+ {
+ name = mxmlElementGetAttr(scut, "name");
+ description = mxmlFindElement(scut, scut, "description", NULL,
+ NULL, MXML_DESCEND_FIRST);
+ printf(".SS %s\n", name);
+
+ write_description(stdout, description, NULL, 1);
+ write_description(stdout, description, NULL, 0);
+
+ for (arg = mxmlFindElement(scut, scut, "constant", NULL, NULL,
+ MXML_DESCEND_FIRST);
+ arg;
+ arg = mxmlFindElement(arg, scut, "constant", NULL, NULL,
+ MXML_NO_DESCEND))
+ {
+ description = mxmlFindElement(arg, arg, "description", NULL,
+ NULL, MXML_DESCEND_FIRST);
+ printf(".TP 5\n%s\n.br\n", mxmlElementGetAttr(arg, "name"));
+ write_description(stdout, description, NULL, 1);
+ }
+ }
+ }
+
+ /*
+ * List of functions...
+ */
+
+ if (find_public(doc, doc, "function"))
+ {
+ puts(".SH FUNCTIONS");
+
+ for (function = find_public(doc, doc, "function");
+ function;
+ function = find_public(function, doc, "function"))
+ {
+ name = mxmlElementGetAttr(function, "name");
+ description = mxmlFindElement(function, function, "description", NULL,
+ NULL, MXML_DESCEND_FIRST);
+ printf(".SS %s\n", name);
+
+ write_description(stdout, description, NULL, 1);
+
+ puts(".PP\n"
+ ".nf");
+
+ arg = mxmlFindElement(function, function, "returnvalue", NULL,
+ NULL, MXML_DESCEND_FIRST);
+
+ if (arg)
+ write_element(stdout, doc, mxmlFindElement(arg, arg, "type", NULL,
+ NULL, MXML_DESCEND_FIRST),
+ OUTPUT_MAN);
+ else
+ fputs("void", stdout);
+
+ printf(" %s ", name);
+ for (arg = mxmlFindElement(function, function, "argument", NULL, NULL,
+ MXML_DESCEND_FIRST), prefix = '(';
+ arg;
+ arg = mxmlFindElement(arg, function, "argument", NULL, NULL,
+ MXML_NO_DESCEND), prefix = ',')
+ {
+ type = mxmlFindElement(arg, arg, "type", NULL, NULL,
+ MXML_DESCEND_FIRST);
+
+ printf("%c\n ", prefix);
+ if (type->child)
+ write_element(stdout, doc, type, OUTPUT_MAN);
+ fputs(mxmlElementGetAttr(arg, "name"), stdout);
+ if ((defval = mxmlElementGetAttr(arg, "default")) != NULL)
+ printf(" %s", defval);
+ }
+
+ if (prefix == '(')
+ puts("(void);");
+ else
+ puts("\n);");
+
+ puts(".fi");
+
+ write_description(stdout, description, NULL, 0);
+ }
+ }
+
+ /*
+ * List of structures...
+ */
+
+ if (find_public(doc, doc, "struct"))
+ {
+ puts(".SH STRUCTURES");
+
+ for (scut = find_public(doc, doc, "struct");
+ scut;
+ scut = find_public(scut, doc, "struct"))
+ {
+ cname = mxmlElementGetAttr(scut, "name");
+ description = mxmlFindElement(scut, scut, "description", NULL,
+ NULL, MXML_DESCEND_FIRST);
+ printf(".SS %s\n", cname);
+
+ write_description(stdout, description, NULL, 1);
+
+ printf(".PP\n"
+ ".nf\n"
+ "struct %s\n{\n", cname);
+ for (arg = mxmlFindElement(scut, scut, "variable", NULL, NULL,
+ MXML_DESCEND_FIRST);
+ arg;
+ arg = mxmlFindElement(arg, scut, "variable", NULL, NULL,
+ MXML_NO_DESCEND))
+ {
+ printf(" ");
+ write_element(stdout, doc, mxmlFindElement(arg, arg, "type", NULL,
+ NULL, MXML_DESCEND_FIRST),
+ OUTPUT_MAN);
+ printf("%s;\n", mxmlElementGetAttr(arg, "name"));
+ }
+
+ for (function = mxmlFindElement(scut, scut, "function", NULL, NULL,
+ MXML_DESCEND_FIRST);
+ function;
+ function = mxmlFindElement(function, scut, "function", NULL, NULL,
+ MXML_NO_DESCEND))
+ {
+ name = mxmlElementGetAttr(function, "name");
+
+ printf(" ");
+
+ arg = mxmlFindElement(function, function, "returnvalue", NULL,
+ NULL, MXML_DESCEND_FIRST);
+
+ if (arg)
+ write_element(stdout, doc, mxmlFindElement(arg, arg, "type", NULL,
+ NULL, MXML_DESCEND_FIRST),
+ OUTPUT_MAN);
+ else if (strcmp(cname, name) && strcmp(cname, name + 1))
+ fputs("void ", stdout);
+
+ fputs(name, stdout);
+
+ for (arg = mxmlFindElement(function, function, "argument", NULL, NULL,
+ MXML_DESCEND_FIRST), prefix = '(';
+ arg;
+ arg = mxmlFindElement(arg, function, "argument", NULL, NULL,
+ MXML_NO_DESCEND), prefix = ',')
+ {
+ type = mxmlFindElement(arg, arg, "type", NULL, NULL,
+ MXML_DESCEND_FIRST);
+
+ putchar(prefix);
+ if (prefix == ',')
+ putchar(' ');
+
+ if (type->child)
+ write_element(stdout, doc, type, OUTPUT_MAN);
+ fputs(mxmlElementGetAttr(arg, "name"), stdout);
+ if ((defval = mxmlElementGetAttr(arg, "default")) != NULL)
+ printf(" %s", defval);
+ }
+
+ if (prefix == '(')
+ puts("(void);");
+ else
+ puts(");");
+ }
+
+ puts("};\n"
+ ".fi");
+
+ write_description(stdout, description, NULL, 0);
+ }
+ }
+
+ /*
+ * List of types...
+ */
+
+ if (find_public(doc, doc, "typedef"))
+ {
+ puts(".SH TYPES");
+
+ for (scut = find_public(doc, doc, "typedef");
+ scut;
+ scut = find_public(scut, doc, "typedef"))
+ {
+ name = mxmlElementGetAttr(scut, "name");
+ description = mxmlFindElement(scut, scut, "description", NULL,
+ NULL, MXML_DESCEND_FIRST);
+ printf(".SS %s\n", name);
+
+ write_description(stdout, description, NULL, 1);
+
+ fputs(".PP\n"
+ ".nf\n"
+ "typedef ", stdout);
+
+ type = mxmlFindElement(scut, scut, "type", NULL, NULL,
+ MXML_DESCEND_FIRST);
+
+ for (type = type->child; type; type = type->next)
+ if (!strcmp(type->value.text.string, "("))
+ break;
+ else
+ {
+ if (type->value.text.whitespace)
+ putchar(' ');
+
+ write_string(stdout, type->value.text.string, OUTPUT_MAN);
+ }
+
+ if (type)
+ {
+ /*
+ * Output function type...
+ */
+
+ printf(" (*%s", name);
+
+ for (type = type->next->next; type; type = type->next)
+ {
+ if (type->value.text.whitespace)
+ putchar(' ');
+
+ write_string(stdout, type->value.text.string, OUTPUT_MAN);
+ }
+
+ puts(";");
+ }
+ else
+ printf(" %s;\n", name);
+
+ puts(".fi");
+
+ write_description(stdout, description, NULL, 0);
+ }
+ }
+
+ /*
+ * List of unions...
+ */
+
+ if (find_public(doc, doc, "union"))
+ {
+ puts(".SH UNIONS");
+
+ for (scut = find_public(doc, doc, "union");
+ scut;
+ scut = find_public(scut, doc, "union"))
+ {
+ name = mxmlElementGetAttr(scut, "name");
+ description = mxmlFindElement(scut, scut, "description", NULL,
+ NULL, MXML_DESCEND_FIRST);
+ printf(".SS %s\n", name);
+
+ write_description(stdout, description, NULL, 1);
+
+ printf(".PP\n"
+ ".nf\n"
+ "union %s\n{\n", name);
+ for (arg = mxmlFindElement(scut, scut, "variable", NULL, NULL,
+ MXML_DESCEND_FIRST);
+ arg;
+ arg = mxmlFindElement(arg, scut, "variable", NULL, NULL,
+ MXML_NO_DESCEND))
+ {
+ printf(" ");
+ write_element(stdout, doc, mxmlFindElement(arg, arg, "type", NULL,
+ NULL, MXML_DESCEND_FIRST),
+ OUTPUT_MAN);
+ printf("%s;\n", mxmlElementGetAttr(arg, "name"));
+ }
+
+ puts("};\n"
+ ".fi");
+
+ write_description(stdout, description, NULL, 0);
+ }
+ }
+
+ /*
+ * Variables...
+ */
+
+ if (find_public(doc, doc, "variable"))
+ {
+ puts(".SH VARIABLES");
+
+ for (arg = find_public(doc, doc, "variable");
+ arg;
+ arg = find_public(arg, doc, "variable"))
+ {
+ name = mxmlElementGetAttr(arg, "name");
+ description = mxmlFindElement(arg, arg, "description", NULL,
+ NULL, MXML_DESCEND_FIRST);
+ printf(".SS %s\n", name);
+
+ write_description(stdout, description, NULL, 1);
+
+ puts(".PP\n"
+ ".nf");
+
+ write_element(stdout, doc, mxmlFindElement(arg, arg, "type", NULL,
+ NULL, MXML_DESCEND_FIRST),
+ OUTPUT_MAN);
+ fputs(mxmlElementGetAttr(arg, "name"), stdout);
+ if ((defval = mxmlElementGetAttr(arg, "default")) != NULL)
+ printf(" %s", defval);
+ puts(";\n"
+ ".fi");
+
+ write_description(stdout, description, NULL, 0);
+ }
+ }
+
+ if (footerfile)
+ {
+ /*
+ * Use custom footer...
+ */
+
+ write_file(stdout, footerfile);
+ }
+}
+
+
+/*
+ * 'write_scu()' - Write a structure, class, or union.
+ */
+
+static void
+write_scu(FILE *out, /* I - Output file */
+ mxml_node_t *doc, /* I - Document */
+ mxml_node_t *scut) /* I - Structure, class, or union */
+{
+ int i; /* Looping var */
+ mxml_node_t *function, /* Current function */
+ *arg, /* Current argument */
+ *description, /* Description of function/var */
+ *type; /* Type for argument */
+ const char *name, /* Name of function/type */
+ *cname, /* Class name */
+ *defval, /* Default value */
+ *parent, /* Parent class */
+ *scope; /* Scope for variable/function */
+ int inscope, /* Variable/method scope */
+ maxscope; /* Maximum scope */
+ char prefix; /* Prefix character */
+ static const char * const scopes[] = /* Scope strings */
+ {
+ "private",
+ "protected",
+ "public"
+ };
+
+
+ cname = mxmlElementGetAttr(scut, "name");
+ description = mxmlFindElement(scut, scut, "description", NULL,
+ NULL, MXML_DESCEND_FIRST);
+
+ fprintf(out, "<h3 class=\"%s\">%s<a name=\"%s\">%s</a></h3>\n",
+ scut->value.element.name, get_comment_info(description), cname,
+ cname);
+
+ if (description)
+ write_description(out, description, "p", 1);
+
+ fprintf(out, "<p class=\"code\">%s %s", scut->value.element.name, cname);
+ if ((parent = mxmlElementGetAttr(scut, "parent")) != NULL)
+ fprintf(out, " %s", parent);
+ fputs(" {<br>\n", out);
+
+ maxscope = !strcmp(scut->value.element.name, "class") ? 3 : 1;
+
+ for (i = 0; i < maxscope; i ++)
+ {
+ inscope = maxscope == 1;
+
+ for (arg = mxmlFindElement(scut, scut, "variable", NULL, NULL,
+ MXML_DESCEND_FIRST);
+ arg;
+ arg = mxmlFindElement(arg, scut, "variable", NULL, NULL,
+ MXML_NO_DESCEND))
+ {
+ if (maxscope > 1 &&
+ ((scope = mxmlElementGetAttr(arg, "scope")) == NULL ||
+ strcmp(scope, scopes[i])))
+ continue;
+
+ if (!inscope)
+ {
+ inscope = 1;
+ fprintf(out, "&nbsp;&nbsp;%s:<br>\n", scopes[i]);
+ }
+
+ fputs("&nbsp;&nbsp;&nbsp;&nbsp;", out);
+ write_element(out, doc, mxmlFindElement(arg, arg, "type", NULL,
+ NULL, MXML_DESCEND_FIRST),
+ OUTPUT_HTML);
+ fprintf(out, "%s;<br>\n", mxmlElementGetAttr(arg, "name"));
+ }
+
+ for (function = mxmlFindElement(scut, scut, "function", NULL, NULL,
+ MXML_DESCEND_FIRST);
+ function;
+ function = mxmlFindElement(function, scut, "function", NULL, NULL,
+ MXML_NO_DESCEND))
+ {
+ if (maxscope > 1 &&
+ ((scope = mxmlElementGetAttr(arg, "scope")) == NULL ||
+ strcmp(scope, scopes[i])))
+ continue;
+
+ if (!inscope)
+ {
+ inscope = 1;
+ fprintf(out, "&nbsp;&nbsp;%s:<br>\n", scopes[i]);
+ }
+
+ name = mxmlElementGetAttr(function, "name");
+
+ fputs("&nbsp;&nbsp;&nbsp;&nbsp;", out);
+
+ arg = mxmlFindElement(function, function, "returnvalue", NULL,
+ NULL, MXML_DESCEND_FIRST);
+
+ if (arg)
+ write_element(out, doc, mxmlFindElement(arg, arg, "type", NULL,
+ NULL, MXML_DESCEND_FIRST),
+ OUTPUT_HTML);
+ else if (strcmp(cname, name) && strcmp(cname, name + 1))
+ fputs("void ", out);
+
+ fprintf(out, "<a href=\"#%s.%s\">%s</a>", cname, name, name);
+
+ for (arg = mxmlFindElement(function, function, "argument", NULL, NULL,
+ MXML_DESCEND_FIRST), prefix = '(';
+ arg;
+ arg = mxmlFindElement(arg, function, "argument", NULL, NULL,
+ MXML_NO_DESCEND), prefix = ',')
+ {
+ type = mxmlFindElement(arg, arg, "type", NULL, NULL,
+ MXML_DESCEND_FIRST);
+
+ putc(prefix, out);
+ if (prefix == ',')
+ putc(' ', out);
+
+ if (type->child)
+ write_element(out, doc, type, OUTPUT_HTML);
+
+ fputs(mxmlElementGetAttr(arg, "name"), out);
+ if ((defval = mxmlElementGetAttr(arg, "default")) != NULL)
+ fprintf(out, " %s", defval);
+ }
+
+ if (prefix == '(')
+ fputs("(void);<br>\n", out);
+ else
+ fputs(");<br>\n", out);
+ }
+ }
+
+ fputs("};</p>\n"
+ "<h4 class=\"members\">Members</h4>\n"
+ "<dl>\n", out);
+
+ for (arg = mxmlFindElement(scut, scut, "variable", NULL, NULL,
+ MXML_DESCEND_FIRST);
+ arg;
+ arg = mxmlFindElement(arg, scut, "variable", NULL, NULL,
+ MXML_NO_DESCEND))
+ {
+ description = mxmlFindElement(arg, arg, "description", NULL,
+ NULL, MXML_DESCEND_FIRST);
+
+ fprintf(out, "<dt>%s %s</dt>\n",
+ mxmlElementGetAttr(arg, "name"), get_comment_info(description));
+
+ write_description(out, description, "dd", 1);
+ write_description(out, description, "dd", 0);
+ }
+
+ fputs("</dl>\n", out);
+
+ for (function = mxmlFindElement(scut, scut, "function", NULL, NULL,
+ MXML_DESCEND_FIRST);
+ function;
+ function = mxmlFindElement(function, scut, "function", NULL, NULL,
+ MXML_NO_DESCEND))
+ {
+ write_function(out, doc, function, 4);
+ }
+}
+
+
+/*
+ * 'write_string()' - Write a string, quoting HTML special chars as needed.
+ */
+
+static void
+write_string(FILE *out, /* I - Output file */
+ const char *s, /* I - String to write */
+ int mode) /* I - Output mode */
+{
+ switch (mode)
+ {
+ case OUTPUT_HTML :
+ case OUTPUT_XML :
+ while (*s)
+ {
+ if (*s == '&')
+ fputs("&amp;", out);
+ else if (*s == '<')
+ fputs("&lt;", out);
+ else if (*s == '>')
+ fputs("&gt;", out);
+ else if (*s == '\"')
+ fputs("&quot;", out);
+ else if (*s & 128)
+ {
+ /*
+ * Convert UTF-8 to Unicode constant...
+ */
+
+ int ch; /* Unicode character */
+
+
+ ch = *s & 255;
+
+ if ((ch & 0xe0) == 0xc0)
+ {
+ ch = ((ch & 0x1f) << 6) | (s[1] & 0x3f);
+ s ++;
+ }
+ else if ((ch & 0xf0) == 0xe0)
+ {
+ ch = ((((ch * 0x0f) << 6) | (s[1] & 0x3f)) << 6) | (s[2] & 0x3f);
+ s += 2;
+ }
+
+ if (ch == 0xa0)
+ {
+ /*
+ * Handle non-breaking space as-is...
+ */
+
+ fputs("&nbsp;", out);
+ }
+ else
+ fprintf(out, "&#x%x;", ch);
+ }
+ else
+ putc(*s, out);
+
+ s ++;
+ }
+ break;
+
+ case OUTPUT_MAN :
+ while (*s)
+ {
+ if (*s == '\\' || *s == '-')
+ putc('\\', out);
+
+ putc(*s++, out);
+ }
+ break;
+ }
+}
+
+
+/*
+ * 'write_toc()' - Write a table-of-contents.
+ */
+
+static void
+write_toc(FILE *out, /* I - Output file */
+ mxml_node_t *doc, /* I - Document */
+ const char *introfile, /* I - Introduction file */
+ const char *target, /* I - Target name */
+ int xml) /* I - Write XML nodes? */
+{
+ FILE *fp; /* Intro file */
+ mxml_node_t *function, /* Current function */
+ *scut, /* Struct/class/union/typedef */
+ *arg, /* Current argument */
+ *description; /* Description of function/var */
+ const char *name, /* Name of function/type */
+ *targetattr; /* Target attribute, if any */
+ int xmlid = 1; /* Current XML node ID */
+
+
+ /*
+ * If target is set, it is the frame file that contains the body.
+ * Otherwise, we are creating a single-file...
+ */
+
+ if (target)
+ targetattr = " target=\"body\"";
+ else
+ targetattr = "";
+
+ /*
+ * The table-of-contents is a nested unordered list. Start by
+ * reading any intro file to see if there are any headings there.
+ */
+
+ if (!xml)
+ fputs("<h2 class=\"title\">Contents</h2>\n"
+ "<ul class=\"contents\">\n", out);
+
+ if (introfile && (fp = fopen(introfile, "r")) != NULL)
+ {
+ char line[8192], /* Line from file */
+ *ptr, /* Pointer in line */
+ *end, /* End of line */
+ *anchor, /* Anchor name */
+ quote, /* Quote character for value */
+ level = '1', /* Current heading level */
+ newlevel; /* New heading level */
+ int inelement; /* In an element? */
+
+
+ while (fgets(line, sizeof(line), fp))
+ {
+ /*
+ * See if this line has a heading...
+ */
+
+ if ((ptr = strstr(line, "<h")) == NULL &&
+ (ptr = strstr(line, "<H")) == NULL)
+ continue;
+
+ if (ptr[2] != '2' && ptr[2] != '3')
+ continue;
+
+ newlevel = ptr[2];
+
+ /*
+ * Make sure we have the whole heading...
+ */
+
+ while (!strstr(line, "</h") && !strstr(line, "</H"))
+ {
+ end = line + strlen(line);
+
+ if (end == (line + sizeof(line) - 1) ||
+ !fgets(end, (int)(sizeof(line) - (end - line)), fp))
+ break;
+ }
+
+ /*
+ * Convert newlines and tabs to spaces...
+ */
+
+ for (ptr = line; *ptr; ptr ++)
+ if (isspace(*ptr & 255))
+ *ptr = ' ';
+
+ /*
+ * Find the anchor and text...
+ */
+
+ for (ptr = strchr(line, '<'); ptr; ptr = strchr(ptr + 1, '<'))
+ if (!strncmp(ptr, "<A NAME=", 8) || !strncmp(ptr, "<a name=", 8))
+ break;
+
+ if (!ptr)
+ continue;
+
+ ptr += 8;
+ inelement = 1;
+
+ if (*ptr == '\'' || *ptr == '\"')
+ {
+ /*
+ * Quoted anchor...
+ */
+
+ quote = *ptr++;
+ anchor = ptr;
+
+ while (*ptr && *ptr != quote)
+ ptr ++;
+
+ if (!*ptr)
+ continue;
+
+ *ptr++ = '\0';
+ }
+ else
+ {
+ /*
+ * Non-quoted anchor...
+ */
+
+ anchor = ptr;
+
+ while (*ptr && *ptr != '>' && !isspace(*ptr & 255))
+ ptr ++;
+
+ if (!*ptr)
+ continue;
+
+ if (*ptr == '>')
+ inelement = 0;
+
+ *ptr++ = '\0';
+ }
+
+ /*
+ * Write text until we see "</A>"...
+ */
+
+ if (xml)
+ {
+ if (newlevel < level)
+ fputs("</Node>\n"
+ "</Subnodes></Node>\n", out);
+ else if (newlevel > level && newlevel == '3')
+ fputs("<Subnodes>\n", out);
+ else if (xmlid > 1)
+ fputs("</Node>\n", out);
+
+ level = newlevel;
+
+ fprintf(out, "<Node id=\"%d\">\n"
+ "<Path>Documentation/index.html</Path>\n"
+ "<Anchor>%s</Anchor>\n"
+ "<Name>", xmlid ++, anchor);
+
+ quote = 0;
+
+ while (*ptr)
+ {
+ if (inelement)
+ {
+ if (*ptr == quote)
+ quote = 0;
+ else if (*ptr == '>')
+ inelement = 0;
+ else if (*ptr == '\'' || *ptr == '\"')
+ quote = *ptr;
+ }
+ else if (*ptr == '<')
+ {
+ if (!strncmp(ptr, "</A>", 4) || !strncmp(ptr, "</a>", 4))
+ break;
+
+ inelement = 1;
+ }
+ else
+ putc(*ptr, out);
+
+ ptr ++;
+ }
+
+ fputs("</Name>\n", out);
+ }
+ else
+ {
+ if (newlevel < level)
+ fputs("</li>\n"
+ "</ul></li>\n", out);
+ else if (newlevel > level)
+ fputs("<ul class=\"subcontents\">\n", out);
+ else if (xmlid > 1)
+ fputs("</li>\n", out);
+
+ level = newlevel;
+ xmlid ++;
+
+ fprintf(out, "<li><a href=\"%s#%s\"%s>", target ? target : "", anchor,
+ targetattr);
+
+ quote = 0;
+
+ while (*ptr)
+ {
+ if (inelement)
+ {
+ if (*ptr == quote)
+ quote = 0;
+ else if (*ptr == '>')
+ inelement = 0;
+ else if (*ptr == '\'' || *ptr == '\"')
+ quote = *ptr;
+ }
+ else if (*ptr == '<')
+ {
+ if (!strncmp(ptr, "</A>", 4) || !strncmp(ptr, "</a>", 4))
+ break;
+
+ inelement = 1;
+ }
+ else
+ putc(*ptr, out);
+
+ ptr ++;
+ }
+
+ fputs("</a>", out);
+ }
+ }
+
+ if (level > '1')
+ {
+ if (xml)
+ {
+ fputs("</Node>\n", out);
+
+ if (level == '3')
+ fputs("</Subnodes></Node>\n", out);
+ }
+ else
+ {
+ fputs("</li>\n", out);
+
+ if (level == '3')
+ fputs("</ul></li>\n", out);
+ }
+ }
+
+ fclose(fp);
+ }
+
+ /*
+ * Next the classes...
+ */
+
+ if ((scut = find_public(doc, doc, "class")) != NULL)
+ {
+ if (xml)
+ fprintf(out, "<Node id=\"%d\">\n"
+ "<Path>Documentation/index.html</Path>\n"
+ "<Anchor>CLASSES</Anchor>\n"
+ "<Name>Classes</Name>\n"
+ "<Subnodes>\n", xmlid ++);
+ else
+ fprintf(out, "<li><a href=\"%s#CLASSES\"%s>Classes</a>"
+ "<ul class=\"code\">\n",
+ target ? target : "", targetattr);
+
+ while (scut)
+ {
+ name = mxmlElementGetAttr(scut, "name");
+ description = mxmlFindElement(scut, scut, "description",
+ NULL, NULL, MXML_DESCEND_FIRST);
+
+ if (xml)
+ {
+ fprintf(out, "<Node id=\"%d\">\n"
+ "<Path>Documentation/index.html</Path>\n"
+ "<Anchor>%s</Anchor>\n"
+ "<Name>%s</Name>\n"
+ "</Node>\n", xmlid ++, name, name);
+ }
+ else
+ {
+ fprintf(out, "<li><a href=\"%s#%s\"%s title=\"",
+ target ? target : "", name, targetattr);
+ write_description(out, description, "", 1);
+ fprintf(out, "\">%s</a></li>\n", name);
+ }
+
+ scut = find_public(scut, doc, "class");
+ }
+
+ if (xml)
+ fputs("</Subnodes></Node>\n", out);
+ else
+ fputs("</ul></li>\n", out);
+ }
+
+ /*
+ * Functions...
+ */
+
+ if ((function = find_public(doc, doc, "function")) != NULL)
+ {
+ if (xml)
+ fprintf(out, "<Node id=\"%d\">\n"
+ "<Path>Documentation/index.html</Path>\n"
+ "<Anchor>FUNCTIONS</Anchor>\n"
+ "<Name>Functions</Name>\n"
+ "<Subnodes>\n", xmlid ++);
+ else
+ fprintf(out, "<li><a href=\"%s#FUNCTIONS\"%s>Functions</a>"
+ "<ul class=\"code\">\n", target ? target : "", targetattr);
+
+ while (function)
+ {
+ name = mxmlElementGetAttr(function, "name");
+ description = mxmlFindElement(function, function, "description",
+ NULL, NULL, MXML_DESCEND_FIRST);
+
+ if (xml)
+ {
+ fprintf(out, "<Node id=\"%d\">\n"
+ "<Path>Documentation/index.html</Path>\n"
+ "<Anchor>%s</Anchor>\n"
+ "<Name>%s</Name>\n"
+ "</Node>\n", xmlid ++, name, name);
+ }
+ else
+ {
+ fprintf(out, "<li><a href=\"%s#%s\"%s title=\"",
+ target ? target : "", name, targetattr);
+ write_description(out, description, "", 1);
+ fprintf(out, "\">%s</a></li>\n", name);
+ }
+
+ function = find_public(function, doc, "function");
+ }
+
+ if (xml)
+ fputs("</Subnodes></Node>\n", out);
+ else
+ fputs("</ul></li>\n", out);
+ }
+
+ /*
+ * Data types...
+ */
+
+ if ((scut = find_public(doc, doc, "typedef")) != NULL)
+ {
+ if (xml)
+ fprintf(out, "<Node id=\"%d\">\n"
+ "<Path>Documentation/index.html</Path>\n"
+ "<Anchor>TYPES</Anchor>\n"
+ "<Name>Data Types</Name>\n"
+ "<Subnodes>\n", xmlid ++);
+ else
+ fprintf(out, "<li><a href=\"%s#TYPES\"%s>Data Types</a>"
+ "<ul class=\"code\">\n", target ? target : "", targetattr);
+
+ while (scut)
+ {
+ name = mxmlElementGetAttr(scut, "name");
+ description = mxmlFindElement(scut, scut, "description",
+ NULL, NULL, MXML_DESCEND_FIRST);
+
+ if (xml)
+ {
+ fprintf(out, "<Node id=\"%d\">\n"
+ "<Path>Documentation/index.html</Path>\n"
+ "<Anchor>%s</Anchor>\n"
+ "<Name>%s</Name>\n"
+ "</Node>\n", xmlid ++, name, name);
+ }
+ else
+ {
+ fprintf(out, "\t<li><a href=\"%s#%s\"%s title=\"",
+ target ? target : "", name, targetattr);
+ write_description(out, description, "", 1);
+ fprintf(out, "\">%s</a></li>\n", name);
+ }
+
+ scut = find_public(scut, doc, "typedef");
+ }
+
+ if (xml)
+ fputs("</Subnodes></Node>\n", out);
+ else
+ fputs("</ul></li>\n", out);
+ }
+
+ /*
+ * Structures...
+ */
+
+ if ((scut = find_public(doc, doc, "struct")) != NULL)
+ {
+ if (xml)
+ fprintf(out, "<Node id=\"%d\">\n"
+ "<Path>Documentation/index.html</Path>\n"
+ "<Anchor>STRUCTURES</Anchor>\n"
+ "<Name>Structures</Name>\n"
+ "<Subnodes>\n", xmlid ++);
+ else
+ fprintf(out, "<li><a href=\"%s#STRUCTURES\"%s>Structures</a>"
+ "<ul class=\"code\">\n", target ? target : "", targetattr);
+
+ while (scut)
+ {
+ name = mxmlElementGetAttr(scut, "name");
+ description = mxmlFindElement(scut, scut, "description",
+ NULL, NULL, MXML_DESCEND_FIRST);
+
+ if (xml)
+ {
+ fprintf(out, "<Node id=\"%d\">\n"
+ "<Path>Documentation/index.html</Path>\n"
+ "<Anchor>%s</Anchor>\n"
+ "<Name>%s</Name>\n"
+ "</Node>\n", xmlid ++, name, name);
+ }
+ else
+ {
+ fprintf(out, "\t<li><a href=\"%s#%s\"%s title=\"",
+ target ? target : "", name, targetattr);
+ write_description(out, description, "", 1);
+ fprintf(out, "\">%s</a></li>\n", name);
+ }
+
+ scut = find_public(scut, doc, "struct");
+ }
+
+ if (xml)
+ fputs("</Subnodes></Node>\n", out);
+ else
+ fputs("</ul></li>\n", out);
+ }
+
+ /*
+ * Unions...
+ */
+
+ if ((scut = find_public(doc, doc, "union")) != NULL)
+ {
+ if (xml)
+ fprintf(out, "<Node id=\"%d\">\n"
+ "<Path>Documentation/index.html</Path>\n"
+ "<Anchor>UNIONS</Anchor>\n"
+ "<Name>Unions</Name>\n"
+ "<Subnodes>\n", xmlid ++);
+ else
+ fprintf(out,
+ "<li><a href=\"%s#UNIONS\"%s>Unions</a><ul class=\"code\">\n",
+ target ? target : "", targetattr);
+
+ while (scut)
+ {
+ name = mxmlElementGetAttr(scut, "name");
+ description = mxmlFindElement(scut, scut, "description",
+ NULL, NULL, MXML_DESCEND_FIRST);
+
+ if (xml)
+ {
+ fprintf(out, "<Node id=\"%d\">\n"
+ "<Path>Documentation/index.html</Path>\n"
+ "<Anchor>%s</Anchor>\n"
+ "<Name>%s</Name>\n"
+ "</Node>\n", xmlid ++, name, name);
+ }
+ else
+ {
+ fprintf(out, "\t<li><a href=\"%s#%s\"%s title=\"",
+ target ? target : "", name, targetattr);
+ write_description(out, description, "", 1);
+ fprintf(out, "\">%s</a></li>\n", name);
+ }
+
+ scut = find_public(scut, doc, "union");
+ }
+
+ if (xml)
+ fputs("</Subnodes></Node>\n", out);
+ else
+ fputs("</ul></li>\n", out);
+ }
+
+ /*
+ * Globals variables...
+ */
+
+ if ((arg = find_public(doc, doc, "variable")) != NULL)
+ {
+ if (xml)
+ fprintf(out, "<Node id=\"%d\">\n"
+ "<Path>Documentation/index.html</Path>\n"
+ "<Anchor>VARIABLES</Anchor>\n"
+ "<Name>Variables</Name>\n"
+ "<Subnodes>\n", xmlid ++);
+ else
+ fprintf(out, "<li><a href=\"%s#VARIABLES\"%s>Variables</a>"
+ "<ul class=\"code\">\n", target ? target : "", targetattr);
+
+ while (arg)
+ {
+ name = mxmlElementGetAttr(arg, "name");
+ description = mxmlFindElement(arg, arg, "description",
+ NULL, NULL, MXML_DESCEND_FIRST);
+
+ if (xml)
+ {
+ fprintf(out, "<Node id=\"%d\">\n"
+ "<Path>Documentation/index.html</Path>\n"
+ "<Anchor>%s</Anchor>\n"
+ "<Name>%s</Name>\n"
+ "</Node>\n", xmlid ++, name, name);
+ }
+ else
+ {
+ fprintf(out, "\t<li><a href=\"%s#%s\"%s title=\"",
+ target ? target : "", name, targetattr);
+ write_description(out, description, "", 1);
+ fprintf(out, "\">%s</a></li>\n", name);
+ }
+
+ arg = find_public(arg, doc, "variable");
+ }
+
+ if (xml)
+ fputs("</Subnodes></Node>\n", out);
+ else
+ fputs("</ul></li>\n", out);
+ }
+
+ /*
+ * Enumerations/constants...
+ */
+
+ if ((scut = find_public(doc, doc, "enumeration")) != NULL)
+ {
+ if (xml)
+ fprintf(out, "<Node id=\"%d\">\n"
+ "<Path>Documentation/index.html</Path>\n"
+ "<Anchor>ENUMERATIONS</Anchor>\n"
+ "<Name>Constants</Name>\n"
+ "<Subnodes>\n", xmlid ++);
+ else
+ fprintf(out, "<li><a href=\"%s#ENUMERATIONS\"%s>Constants</a>"
+ "<ul class=\"code\">\n", target ? target : "", targetattr);
+
+ while (scut)
+ {
+ name = mxmlElementGetAttr(scut, "name");
+ description = mxmlFindElement(scut, scut, "description",
+ NULL, NULL, MXML_DESCEND_FIRST);
+
+ if (xml)
+ {
+ fprintf(out, "<Node id=\"%d\">\n"
+ "<Path>Documentation/index.html</Path>\n"
+ "<Anchor>%s</Anchor>\n"
+ "<Name>%s</Name>\n"
+ "</Node>\n", xmlid ++, name, name);
+ }
+ else
+ {
+ fprintf(out, "\t<li><a href=\"%s#%s\"%s title=\"",
+ target ? target : "", name, targetattr);
+ write_description(out, description, "", 1);
+ fprintf(out, "\">%s</a></li>\n", name);
+ }
+
+ scut = find_public(scut, doc, "enumeration");
+ }
+
+ if (xml)
+ fputs("</Subnodes></Node>\n", out);
+ else
+ fputs("</ul></li>\n", out);
+ }
+}
+
+
+/*
+ * 'write_tokens()' - Write <Token> nodes for all APIs.
+ */
+
+static void
+write_tokens(FILE *out, /* I - Output file */
+ mxml_node_t *doc, /* I - Document */
+ const char *path) /* I - Path to help file */
+{
+ mxml_node_t *function, /* Current function */
+ *scut, /* Struct/class/union/typedef */
+ *arg, /* Current argument */
+ *description, /* Description of function/var */
+ *type, /* Type node */
+ *node; /* Current child node */
+ const char *name, /* Name of function/type */
+ *cename, /* Current class/enum name */
+ *defval; /* Default value for argument */
+ char prefix; /* Prefix for declarations */
+
+
+ /*
+ * Classes...
+ */
+
+ if ((scut = find_public(doc, doc, "class")) != NULL)
+ {
+ while (scut)
+ {
+ cename = mxmlElementGetAttr(scut, "name");
+ description = mxmlFindElement(scut, scut, "description",
+ NULL, NULL, MXML_DESCEND_FIRST);
+
+ fprintf(out, "<Token>\n"
+ "<Path>Documentation/%s</Path>\n"
+ "<Anchor>%s</Anchor>\n"
+ "<TokenIdentifier>//apple_ref/cpp/cl/%s</TokenIdentifier>\n"
+ "<Abstract>", path, cename, cename);
+ write_description(out, description, "", 1);
+ fputs("</Abstract>\n"
+ "</Token>\n", out);
+
+ if ((function = find_public(scut, scut, "function")) != NULL)
+ {
+ while (function)
+ {
+ name = mxmlElementGetAttr(function, "name");
+ description = mxmlFindElement(function, function, "description",
+ NULL, NULL, MXML_DESCEND_FIRST);
+
+ fprintf(out, "<Token>\n"
+ "<Path>Documentation/%s</Path>\n"
+ "<Anchor>%s.%s</Anchor>\n"
+ "<TokenIdentifier>//apple_ref/cpp/clm/%s/%s", path,
+ cename, name, cename, name);
+
+ arg = mxmlFindElement(function, function, "returnvalue", NULL,
+ NULL, MXML_DESCEND_FIRST);
+
+ if (arg && (type = mxmlFindElement(arg, arg, "type", NULL,
+ NULL, MXML_DESCEND_FIRST)) != NULL)
+ {
+ for (node = type->child; node; node = node->next)
+ fputs(node->value.text.string, out);
+ }
+ else if (strcmp(cename, name) && strcmp(cename, name + 1))
+ fputs("void", out);
+
+ fputs("/", out);
+
+ for (arg = mxmlFindElement(function, function, "argument", NULL, NULL,
+ MXML_DESCEND_FIRST), prefix = '(';
+ arg;
+ arg = mxmlFindElement(arg, function, "argument", NULL, NULL,
+ MXML_NO_DESCEND), prefix = ',')
+ {
+ type = mxmlFindElement(arg, arg, "type", NULL, NULL,
+ MXML_DESCEND_FIRST);
+
+ putc(prefix, out);
+
+ for (node = type->child; node; node = node->next)
+ fputs(node->value.text.string, out);
+
+ fputs(mxmlElementGetAttr(arg, "name"), out);
+ }
+
+ if (prefix == '(')
+ fputs("(void", out);
+
+ fputs(")</TokenIdentifier>\n"
+ "<Abstract>", out);
+ write_description(out, description, "", 1);
+ fputs("</Abstract>\n"
+ "<Declaration>", out);
+
+ arg = mxmlFindElement(function, function, "returnvalue", NULL,
+ NULL, MXML_DESCEND_FIRST);
+
+ if (arg)
+ write_element(out, doc, mxmlFindElement(arg, arg, "type", NULL,
+ NULL, MXML_DESCEND_FIRST),
+ OUTPUT_XML);
+ else if (strcmp(cename, name) && strcmp(cename, name + 1))
+ fputs("void ", out);
+
+ fputs(name, out);
+
+ for (arg = mxmlFindElement(function, function, "argument", NULL, NULL,
+ MXML_DESCEND_FIRST), prefix = '(';
+ arg;
+ arg = mxmlFindElement(arg, function, "argument", NULL, NULL,
+ MXML_NO_DESCEND), prefix = ',')
+ {
+ type = mxmlFindElement(arg, arg, "type", NULL, NULL,
+ MXML_DESCEND_FIRST);
+
+ putc(prefix, out);
+ if (prefix == ',')
+ putc(' ', out);
+
+ if (type->child)
+ write_element(out, doc, type, OUTPUT_XML);
+
+ fputs(mxmlElementGetAttr(arg, "name"), out);
+ if ((defval = mxmlElementGetAttr(arg, "default")) != NULL)
+ fprintf(out, " %s", defval);
+ }
+
+ if (prefix == '(')
+ fputs("(void);", out);
+ else
+ fputs(");", out);
+
+ fputs("</Declaration>\n"
+ "</Token>\n", out);
+
+ function = find_public(function, doc, "function");
+ }
+ }
+ scut = find_public(scut, doc, "class");
+ }
+ }
+
+ /*
+ * Functions...
+ */
+
+ if ((function = find_public(doc, doc, "function")) != NULL)
+ {
+ while (function)
+ {
+ name = mxmlElementGetAttr(function, "name");
+ description = mxmlFindElement(function, function, "description",
+ NULL, NULL, MXML_DESCEND_FIRST);
+
+ fprintf(out, "<Token>\n"
+ "<Path>Documentation/%s</Path>\n"
+ "<Anchor>%s</Anchor>\n"
+ "<TokenIdentifier>//apple_ref/c/func/%s</TokenIdentifier>\n"
+ "<Abstract>", path, name, name);
+ write_description(out, description, "", 1);
+ fputs("</Abstract>\n"
+ "<Declaration>", out);
+
+ arg = mxmlFindElement(function, function, "returnvalue", NULL,
+ NULL, MXML_DESCEND_FIRST);
+
+ if (arg)
+ write_element(out, doc, mxmlFindElement(arg, arg, "type", NULL,
+ NULL, MXML_DESCEND_FIRST),
+ OUTPUT_XML);
+ else // if (strcmp(cname, name) && strcmp(cname, name + 1))
+ fputs("void ", out);
+
+ fputs(name, out);
+
+ for (arg = mxmlFindElement(function, function, "argument", NULL, NULL,
+ MXML_DESCEND_FIRST), prefix = '(';
+ arg;
+ arg = mxmlFindElement(arg, function, "argument", NULL, NULL,
+ MXML_NO_DESCEND), prefix = ',')
+ {
+ type = mxmlFindElement(arg, arg, "type", NULL, NULL,
+ MXML_DESCEND_FIRST);
+
+ putc(prefix, out);
+ if (prefix == ',')
+ putc(' ', out);
+
+ if (type->child)
+ write_element(out, doc, type, OUTPUT_XML);
+
+ fputs(mxmlElementGetAttr(arg, "name"), out);
+ if ((defval = mxmlElementGetAttr(arg, "default")) != NULL)
+ fprintf(out, " %s", defval);
+ }
+
+ if (prefix == '(')
+ fputs("(void);", out);
+ else
+ fputs(");", out);
+
+ fputs("</Declaration>\n"
+ "</Token>\n", out);
+
+ function = find_public(function, doc, "function");
+ }
+ }
+
+ /*
+ * Data types...
+ */
+
+ if ((scut = find_public(doc, doc, "typedef")) != NULL)
+ {
+ while (scut)
+ {
+ name = mxmlElementGetAttr(scut, "name");
+ description = mxmlFindElement(scut, scut, "description",
+ NULL, NULL, MXML_DESCEND_FIRST);
+
+ fprintf(out, "<Token>\n"
+ "<Path>Documentation/%s</Path>\n"
+ "<Anchor>%s</Anchor>\n"
+ "<TokenIdentifier>//apple_ref/c/tdef/%s</TokenIdentifier>\n"
+ "<Abstract>", path, name, name);
+ write_description(out, description, "", 1);
+ fputs("</Abstract>\n"
+ "</Token>\n", out);
+
+ scut = find_public(scut, doc, "typedef");
+ }
+ }
+
+ /*
+ * Structures...
+ */
+
+ if ((scut = find_public(doc, doc, "struct")) != NULL)
+ {
+ while (scut)
+ {
+ name = mxmlElementGetAttr(scut, "name");
+ description = mxmlFindElement(scut, scut, "description",
+ NULL, NULL, MXML_DESCEND_FIRST);
+
+ fprintf(out, "<Token>\n"
+ "<Path>Documentation/%s</Path>\n"
+ "<Anchor>%s</Anchor>\n"
+ "<TokenIdentifier>//apple_ref/c/tag/%s</TokenIdentifier>\n"
+ "<Abstract>", path, name, name);
+ write_description(out, description, "", 1);
+ fputs("</Abstract>\n"
+ "</Token>\n", out);
+
+ scut = find_public(scut, doc, "struct");
+ }
+ }
+
+ /*
+ * Unions...
+ */
+
+ if ((scut = find_public(doc, doc, "union")) != NULL)
+ {
+ while (scut)
+ {
+ name = mxmlElementGetAttr(scut, "name");
+ description = mxmlFindElement(scut, scut, "description",
+ NULL, NULL, MXML_DESCEND_FIRST);
+
+ fprintf(out, "<Token>\n"
+ "<Path>Documentation/%s</Path>\n"
+ "<Anchor>%s</Anchor>\n"
+ "<TokenIdentifier>//apple_ref/c/tag/%s</TokenIdentifier>\n"
+ "<Abstract>", path, name, name);
+ write_description(out, description, "", 1);
+ fputs("</Abstract>\n"
+ "</Token>\n", out);
+
+ scut = find_public(scut, doc, "union");
+ }
+ }
+
+ /*
+ * Globals variables...
+ */
+
+ if ((arg = find_public(doc, doc, "variable")) != NULL)
+ {
+ while (arg)
+ {
+ name = mxmlElementGetAttr(arg, "name");
+ description = mxmlFindElement(arg, arg, "description",
+ NULL, NULL, MXML_DESCEND_FIRST);
+
+ fprintf(out, "<Token>\n"
+ "<Path>Documentation/%s</Path>\n"
+ "<Anchor>%s</Anchor>\n"
+ "<TokenIdentifier>//apple_ref/c/data/%s</TokenIdentifier>\n"
+ "<Abstract>", path, name, name);
+ write_description(out, description, "", 1);
+ fputs("</Abstract>\n"
+ "</Token>\n", out);
+
+ arg = find_public(arg, doc, "variable");
+ }
+ }
+
+ /*
+ * Enumerations/constants...
+ */
+
+ if ((scut = find_public(doc, doc, "enumeration")) != NULL)
+ {
+ while (scut)
+ {
+ cename = mxmlElementGetAttr(scut, "name");
+ description = mxmlFindElement(scut, scut, "description",
+ NULL, NULL, MXML_DESCEND_FIRST);
+
+ fprintf(out, "<Token>\n"
+ "<Path>Documentation/%s</Path>\n"
+ "<Anchor>%s</Anchor>\n"
+ "<TokenIdentifier>//apple_ref/c/tag/%s</TokenIdentifier>\n"
+ "<Abstract>", path, cename, cename);
+ write_description(out, description, "", 1);
+ fputs("</Abstract>\n"
+ "</Token>\n", out);
+
+ for (arg = mxmlFindElement(scut, scut, "constant", NULL, NULL,
+ MXML_DESCEND_FIRST);
+ arg;
+ arg = mxmlFindElement(arg, scut, "constant", NULL, NULL,
+ MXML_NO_DESCEND))
+ {
+ name = mxmlElementGetAttr(arg, "name");
+ description = mxmlFindElement(arg, arg, "description", NULL,
+ NULL, MXML_DESCEND_FIRST);
+ fprintf(out, "<Token>\n"
+ "<Path>Documentation/%s</Path>\n"
+ "<Anchor>%s</Anchor>\n"
+ "<TokenIdentifier>//apple_ref/c/econst/%s</TokenIdentifier>\n"
+ "<Abstract>", path, cename, name);
+ write_description(out, description, "", 1);
+ fputs("</Abstract>\n"
+ "</Token>\n", out);
+ }
+
+ scut = find_public(scut, doc, "enumeration");
+ }
+ }
+}
+
+
+/*
+ * 'ws_cb()' - Whitespace callback for saving.
+ */
+
+static const char * /* O - Whitespace string or NULL for none */
+ws_cb(mxml_node_t *node, /* I - Element node */
+ int where) /* I - Where value */
+{
+ const char *name; /* Name of element */
+ int depth; /* Depth of node */
+ static const char *spaces = " ";
+ /* Whitespace (40 spaces) for indent */
+
+
+ name = node->value.element.name;
+
+ switch (where)
+ {
+ case MXML_WS_BEFORE_CLOSE :
+ if (strcmp(name, "argument") &&
+ strcmp(name, "class") &&
+ strcmp(name, "constant") &&
+ strcmp(name, "enumeration") &&
+ strcmp(name, "function") &&
+ strcmp(name, "mxmldoc") &&
+ strcmp(name, "namespace") &&
+ strcmp(name, "returnvalue") &&
+ strcmp(name, "struct") &&
+ strcmp(name, "typedef") &&
+ strcmp(name, "union") &&
+ strcmp(name, "variable"))
+ return (NULL);
+
+ for (depth = -4; node; node = node->parent, depth += 2);
+ if (depth > 40)
+ return (spaces);
+ else if (depth < 2)
+ return (NULL);
+ else
+ return (spaces + 40 - depth);
+
+ case MXML_WS_AFTER_CLOSE :
+ return ("\n");
+
+ case MXML_WS_BEFORE_OPEN :
+ for (depth = -4; node; node = node->parent, depth += 2);
+ if (depth > 40)
+ return (spaces);
+ else if (depth < 2)
+ return (NULL);
+ else
+ return (spaces + 40 - depth);
+
+ default :
+ case MXML_WS_AFTER_OPEN :
+ if (strcmp(name, "argument") &&
+ strcmp(name, "class") &&
+ strcmp(name, "constant") &&
+ strcmp(name, "enumeration") &&
+ strcmp(name, "function") &&
+ strcmp(name, "mxmldoc") &&
+ strcmp(name, "namespace") &&
+ strcmp(name, "returnvalue") &&
+ strcmp(name, "struct") &&
+ strcmp(name, "typedef") &&
+ strcmp(name, "union") &&
+ strcmp(name, "variable") &&
+ strncmp(name, "?xml", 4))
+ return (NULL);
+ else
+ return ("\n");
+ }
+}
+
+
+/*
+ * End of "$Id: mxmldoc.c 390 2009-05-05 13:38:00Z mike $".
+ */
diff -Naur mxml-2.6/temp1.xmlfd mxml-2.6-haiku/temp1.xmlfd
--- mxml-2.6/temp1.xmlfd 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/temp1.xmlfd 2009-10-26 02:35:54.000000000 +0000
@@ -0,0 +1,29 @@
+<?xml version="1.0" encoding="UTF-8"?>
+<group>
+ <option>
+ <keyword type="opaque">InputSlot</keyword>
+ <default type="opaque">Auto</default>
+ <text>Media Source</text>
+ <order type="real">10.000000</order>
+ <choice>
+ <keyword type="opaque">Auto</keyword>
+ <text>Auto Tray Selection</text>
+ <code type="opaque" />
+ </choice>
+ <choice>
+ <keyword type="opaque">Upper</keyword>
+ <text>Tray 1</text>
+ <code type="opaque">&lt;&lt;/MediaPosition 0&gt;&gt;setpagedevice</code>
+ </choice>
+ <choice>
+ <keyword type="opaque">Lower</keyword>
+ <text>Tray 2</text>
+ <code type="opaque">&lt;&lt;/MediaPosition 1&gt;&gt;setpagedevice</code>
+ </choice>
+ </option>
+ <integer>123</integer>
+ <string>Now is the time for all good men to come to the aid of their
+country.</string>
+ <!-- this is a comment -->
+ <![CDATA[this is CDATA 0123456789ABCDEF]]>
+</group>
diff -Naur mxml-2.6/test/class.cxx mxml-2.6-haiku/test/class.cxx
--- mxml-2.6/test/class.cxx 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/test/class.cxx 2008-01-26 23:27:19.000000000 +0000
@@ -0,0 +1,84 @@
+class foo_c : public bar_c // Foo class derived from bar
+{
+ float foo; /* Real number */
+ int bar; /* Integer */
+
+ public:
+
+ foo_c(float f, int b);
+ ~foo_c();
+
+ // 'get_bar()' - Get the value of bar.
+ int // O - Value of bar
+ get_bar()
+ {
+ return (bar);
+ }
+
+ // 'get_foo()' - Get the value of foo.
+ float // O - Value of foo
+ get_foo()
+ {
+ return (foo);
+ }
+
+ // 'set_bar()' - Set the value of bar.
+ void
+ set_bar(int b) // I - Value of bar
+ {
+ bar = b;
+ }
+
+ // 'set_foo()' - Set the value of foo.
+ void
+ set_foo(float f) // I - Value of foo
+ {
+ foo = f;
+ }
+
+ // 'set_foobar()' - Set foo and optionally bar (should show default args).
+ void
+ set_foobar(float f, // I - Value of foo
+ int b = 0) // I - Value of bar
+ {
+ foo = f;
+ bar = b;
+ }
+
+ protected:
+
+ static int global; /* Global integer */
+
+ // 'get_global()' - Get the global integer.
+ int // O - Integer
+ get_global()
+ {
+ return (global);
+ }
+
+ private:
+
+ int barfoo; // Another private integer
+
+ public:
+
+ // 'get_barfoo()' - Get the barfoo value.
+ int // O - Barfoo value
+ get_barfoo()
+ {
+ return (barfoo);
+ }
+}
+
+// 'foo_c::foo_c()' - Create a foo_c class.
+foo_c::foo_c(float f, // I - Value of foo
+ int b) // I - Value of bar
+{
+ foo = f;
+ bar = b;
+}
+
+// 'foo_c::~foo_c()' - Destroy a foo_c class.
+foo_c::~foo_c()
+{
+}
diff -Naur mxml-2.6/test/dotest.sh mxml-2.6-haiku/test/dotest.sh
--- mxml-2.6/test/dotest.sh 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/test/dotest.sh 2008-03-19 21:09:21.000000000 +0000
@@ -0,0 +1,47 @@
+#!/bin/sh
+(cd ..; make mxmldoc-static)
+
+files=""
+mode=""
+
+while test $# -gt 0; do
+ arg="$1"
+ shift
+
+ case "$arg" in
+ -f) framed="--framed framed" ;;
+ -g) mode="gdb" ;;
+ -v) mode="valgrind" ;;
+ *.h | *.c | *.cxx) files="$files $arg" ;;
+ *)
+ echo "Usage: ./dotest.sh [-f] [-g] [-v] [files]"
+ exit 1
+ ;;
+ esac
+done
+
+if test "$files" = ""; then
+ files=*.cxx
+fi
+
+rm -f test.xml
+
+case "$mode" in
+ gdb)
+ echo "break malloc_error_break" >.gdbcmds
+ echo "set env DYLD_INSERT_LIBRARIES /usr/lib/libgmalloc.dylib" >>.gdbcmds
+ echo "run $framed test.xml $files >test.html 2>test.log" >>.gdbcmds
+ gdb -x .gdbcmds ../mxmldoc-static
+ ;;
+
+ valgrind)
+ valgrind --log-fd=3 --leak-check=yes \
+ ../mxmldoc-static $framed test.xml $files \
+ >test.html 2>test.log 3>test.valgrind
+ ;;
+
+ *)
+ ../mxmldoc-static $framed test.xml $files >test.html 2>test.log
+ ;;
+esac
+
diff -Naur mxml-2.6/test/enum.cxx mxml-2.6-haiku/test/enum.cxx
--- mxml-2.6/test/enum.cxx 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/test/enum.cxx 2009-05-05 04:43:18.000000000 +0000
@@ -0,0 +1,17 @@
+typedef enum foo_enum_e /* Sample enumeration type */
+{
+ FOO_ONE, /* One fish */
+ FOO_TWO, /* Two fish */
+ FOO_RED, /* Red fish */
+ FOO_BLUE, /* Blue fish */
+ FOO_PRIVATE /* Private fish @private@ */
+} foo_enum_t;
+
+typedef enum foo_enum2_e /* Sample enumeration type #2 */
+{
+ FOO2_ONE, /* One fish #2 */
+ FOO2_TWO, /* Two fish #2 */
+ FOO2_RED, /* Red fish #2 */
+ FOO2_BLUE, /* Blue fish #2 */
+ FOO2_PRIVATE /* Private fish #2 @private@ */
+} foo_enum2_t;
diff -Naur mxml-2.6/test/function.cxx mxml-2.6-haiku/test/function.cxx
--- mxml-2.6/test/function.cxx 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/test/function.cxx 2008-01-27 08:01:43.000000000 +0000
@@ -0,0 +1,107 @@
+/*
+ * 'foo_void_function()' - Do foo with bar.
+ *
+ * Use the @link foo_float_function@ or @link foo_int_function@ functions
+ * instead. Pass @code NULL@ for "three" then there is no string to print.
+ *
+ * @deprecated@
+ */
+
+void
+foo_void_function(int one, /* I - Integer */
+ float *two, /* O - Real number */
+ const char *three) /* I - String */
+{
+ if (one)
+ {
+ puts("Hello, World!");
+ }
+ else
+ puts(three);
+
+ *two = 2.0f;
+}
+
+
+/*
+ * 'foo_float_function()' - Do foo with bar.
+ *
+ * @since 1.2@
+ */
+
+float /* O - Real number */
+foo_float_function(int one, /* I - Integer */
+ const char *two) /* I - String */
+{
+ if (one)
+ {
+ puts("Hello, World!");
+ }
+ else
+ puts(two);
+
+ return (2.0f);
+}
+
+
+/*
+ * 'foo_default_string()' - Do something with a defaulted string arg.
+ */
+
+int /* O - Integer value */
+foo_default_string(int one, /* I - Integer */
+ const char *two = "2")
+ /* I - String */
+{
+ if (one)
+ {
+ puts("Hello, World!");
+ }
+ else
+ puts(two);
+
+ return (2);
+}
+
+
+/*
+ * 'foo_default_int()' - Do something with a defaulted int arg.
+ */
+
+int /* O - Integer value */
+foo_default_int(int one, /* I - Integer */
+ int two = 2) /* I - Integer */
+{
+ if (one)
+ {
+ puts("Hello, World!");
+ }
+ else
+ puts(two);
+
+ return (2);
+}
+
+
+/*
+ * 'foo_void_func()' - Function taking no arguments.
+ */
+
+void
+foo_void_func(void)
+{
+ puts("foo_void_func()");
+}
+
+
+/*
+ * 'foo_private_func()' - Private function.
+ *
+ * @private@
+ */
+
+void
+foo_private_func(void)
+{
+ puts("foo_private_func()");
+}
diff -Naur mxml-2.6/test/functype.cxx mxml-2.6-haiku/test/functype.cxx
--- mxml-2.6/test/functype.cxx 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/test/functype.cxx 2005-09-29 02:20:19.000000000 +0000
@@ -0,0 +1 @@
+typedef int (*foo_func_t)(void *foo, int bar); /**** Foo function type ****/
diff -Naur mxml-2.6/test/struct.cxx mxml-2.6-haiku/test/struct.cxx
--- mxml-2.6/test/struct.cxx 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/test/struct.cxx 2008-01-26 20:50:28.000000000 +0000
@@ -0,0 +1,55 @@
+typedef struct foo_s /* Foo structure */
+{
+ float foo; /* Real number */
+ int bar; /* Integer */
+
+ foo_s(float f, int b);
+ ~foo_s();
+
+ // 'get_bar()' - Get the value of bar.
+ int // O - Value of bar
+ get_bar()
+ {
+ return (bar);
+ }
+
+ // 'get_foo()' - Get the value of foo.
+ float // O - Value of foo
+ get_foo()
+ {
+ return (foo);
+ }
+
+ // 'set_bar()' - Set the value of bar.
+ void
+ set_bar(int b) // I - Value of bar
+ {
+ bar = b;
+ }
+
+ // 'set_foo()' - Set the value of foo.
+ void
+ set_foo(float f) // I - Value of foo
+ {
+ foo = f;
+ }
+} foo_t;
+
+// 'foo_s::foo_s()' - Create a foo_s structure.
+foo_s::foo_s(float f, // I - Value of foo
+ int b) // I - Value of bar
+{
+ foo = f;
+ bar = b;
+}
+
+// 'foo_s::~foo_s()' - Destroy a foo_s structure.
+foo_s::~foo_s()
+{
+}
+
+typedef struct foo_private_s /* @private@ */
+{
+ int a; /* Value of "a" */
+ char b[255]; /* Value of "b" */
+} foo_private_t;
diff -Naur mxml-2.6/test/type.cxx mxml-2.6-haiku/test/type.cxx
--- mxml-2.6/test/type.cxx 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/test/type.cxx 2005-11-30 15:31:58.000000000 +0000
@@ -0,0 +1,3 @@
+typedef int foo_simple_t; /* Simple integer type */
+
+typedef int foo_simple_private_t; /* @private@ */
diff -Naur mxml-2.6/test.xml mxml-2.6-haiku/test.xml
--- mxml-2.6/test.xml 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/test.xml 2005-01-29 17:03:33.000000000 +0000
@@ -0,0 +1,29 @@
+<?xml version="1.0" encoding="UTF-8"?>
+<group>
+ <option>
+ <keyword type="opaque">InputSlot</keyword>
+ <default type="opaque">Auto</default>
+ <text>Media Source</text>
+ <order type="real">10.000000</order>
+ <choice>
+ <keyword type="opaque">Auto</keyword>
+ <text>Auto Tray Selection</text>
+ <code type="opaque" />
+ </choice>
+ <choice>
+ <keyword type="opaque">Upper</keyword>
+ <text>Tray 1</text>
+ <code type="opaque">&lt;&lt;/MediaPosition 0&gt;&gt;setpagedevice</code>
+ </choice>
+ <choice>
+ <keyword type="opaque">Lower</keyword>
+ <text>Tray 2</text>
+ <code type="opaque">&lt;&lt;/MediaPosition 1&gt;&gt;setpagedevice</code>
+ </choice>
+ </option>
+ <integer>123</integer>
+ <string>Now is the time for all good men to come to the aid of their
+country.</string>
+ <!-- this is a comment -->
+ <![CDATA[this is CDATA 0123456789ABCDEF]]>
+</group>
diff -Naur mxml-2.6/testmxml.c mxml-2.6-haiku/testmxml.c
--- mxml-2.6/testmxml.c 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/testmxml.c 2009-02-05 06:06:11.000000000 +0000
@@ -0,0 +1,748 @@
+/*
+ * "$Id: testmxml.c 381 2009-02-05 06:06:11Z mike $"
+ *
+ * Test program for Mini-XML, a small XML-like file parsing library.
+ *
+ * Copyright 2003-2007 by Michael Sweet.
+ *
+ * This program is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU Library General Public
+ * License as published by the Free Software Foundation; either
+ * version 2, or (at your option) any later version.
+ *
+ * This program is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+ * GNU General Public License for more details.
+ *
+ * Contents:
+ *
+ * main() - Main entry for test program.
+ * sax_cb() - SAX callback.
+ * type_cb() - XML data type callback for mxmlLoadFile()...
+ * whitespace_cb() - Let the mxmlSaveFile() function know when to insert
+ * newlines and tabs...
+ */
+
+/*
+ * Include necessary headers...
+ */
+
+#include "config.h"
+#include "mxml.h"
+#ifndef WIN32
+# include <unistd.h>
+#endif /* !WIN32 */
+#include <fcntl.h>
+#ifndef O_BINARY
+# define O_BINARY 0
+#endif /* !O_BINARY */
+
+
+/*
+ * Globals...
+ */
+
+int event_counts[6];
+
+
+/*
+ * Local functions...
+ */
+
+void sax_cb(mxml_node_t *node, mxml_sax_event_t event, void *data);
+mxml_type_t type_cb(mxml_node_t *node);
+const char *whitespace_cb(mxml_node_t *node, int where);
+
+
+/*
+ * 'main()' - Main entry for test program.
+ */
+
+int /* O - Exit status */
+main(int argc, /* I - Number of command-line args */
+ char *argv[]) /* I - Command-line args */
+{
+ int i; /* Looping var */
+ FILE *fp; /* File to read */
+ int fd; /* File descriptor */
+ mxml_node_t *tree, /* XML tree */
+ *node; /* Node which should be in test.xml */
+ mxml_index_t *ind; /* XML index */
+ char buffer[16384]; /* Save string */
+ static const char *types[] = /* Strings for node types */
+ {
+ "MXML_ELEMENT",
+ "MXML_INTEGER",
+ "MXML_OPAQUE",
+ "MXML_REAL",
+ "MXML_TEXT"
+ };
+
+
+ /*
+ * Check arguments...
+ */
+
+ if (argc != 2)
+ {
+ fputs("Usage: testmxml filename.xml\n", stderr);
+ return (1);
+ }
+
+ /*
+ * Test the basic functionality...
+ */
+
+ tree = mxmlNewElement(MXML_NO_PARENT, "element");
+
+ if (!tree)
+ {
+ fputs("ERROR: No parent node in basic test!\n", stderr);
+ return (1);
+ }
+
+ if (tree->type != MXML_ELEMENT)
+ {
+ fprintf(stderr, "ERROR: Parent has type %s (%d), expected MXML_ELEMENT!\n",
+ tree->type < MXML_ELEMENT || tree->type > MXML_TEXT ?
+ "UNKNOWN" : types[tree->type], tree->type);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ if (strcmp(tree->value.element.name, "element"))
+ {
+ fprintf(stderr, "ERROR: Parent value is \"%s\", expected \"element\"!\n",
+ tree->value.element.name);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ mxmlNewInteger(tree, 123);
+ mxmlNewOpaque(tree, "opaque");
+ mxmlNewReal(tree, 123.4f);
+ mxmlNewText(tree, 1, "text");
+
+ mxmlLoadString(tree, "<group type='string'>string string string</group>",
+ MXML_NO_CALLBACK);
+ mxmlLoadString(tree, "<group type='integer'>1 2 3</group>",
+ MXML_INTEGER_CALLBACK);
+ mxmlLoadString(tree, "<group type='real'>1.0 2.0 3.0</group>",
+ MXML_REAL_CALLBACK);
+ mxmlLoadString(tree, "<group>opaque opaque opaque</group>",
+ MXML_OPAQUE_CALLBACK);
+
+ node = tree->child;
+
+ if (!node)
+ {
+ fputs("ERROR: No first child node in basic test!\n", stderr);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ if (node->type != MXML_INTEGER)
+ {
+ fprintf(stderr, "ERROR: First child has type %s (%d), expected MXML_INTEGER!\n",
+ node->type < MXML_ELEMENT || node->type > MXML_TEXT ?
+ "UNKNOWN" : types[node->type], node->type);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ if (node->value.integer != 123)
+ {
+ fprintf(stderr, "ERROR: First child value is %d, expected 123!\n",
+ node->value.integer);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ node = node->next;
+
+ if (!node)
+ {
+ fputs("ERROR: No second child node in basic test!\n", stderr);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ if (node->type != MXML_OPAQUE)
+ {
+ fprintf(stderr, "ERROR: Second child has type %s (%d), expected MXML_OPAQUE!\n",
+ node->type < MXML_ELEMENT || node->type > MXML_TEXT ?
+ "UNKNOWN" : types[node->type], node->type);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ if (!node->value.opaque || strcmp(node->value.opaque, "opaque"))
+ {
+ fprintf(stderr, "ERROR: Second child value is \"%s\", expected \"opaque\"!\n",
+ node->value.opaque ? node->value.opaque : "(null)");
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ node = node->next;
+
+ if (!node)
+ {
+ fputs("ERROR: No third child node in basic test!\n", stderr);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ if (node->type != MXML_REAL)
+ {
+ fprintf(stderr, "ERROR: Third child has type %s (%d), expected MXML_REAL!\n",
+ node->type < MXML_ELEMENT || node->type > MXML_TEXT ?
+ "UNKNOWN" : types[node->type], node->type);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ if (node->value.real != 123.4f)
+ {
+ fprintf(stderr, "ERROR: Third child value is %f, expected 123.4!\n",
+ node->value.real);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ node = node->next;
+
+ if (!node)
+ {
+ fputs("ERROR: No fourth child node in basic test!\n", stderr);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ if (node->type != MXML_TEXT)
+ {
+ fprintf(stderr, "ERROR: Fourth child has type %s (%d), expected MXML_TEXT!\n",
+ node->type < MXML_ELEMENT || node->type > MXML_TEXT ?
+ "UNKNOWN" : types[node->type], node->type);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ if (!node->value.text.whitespace ||
+ !node->value.text.string || strcmp(node->value.text.string, "text"))
+ {
+ fprintf(stderr, "ERROR: Fourth child value is %d,\"%s\", expected 1,\"text\"!\n",
+ node->value.text.whitespace,
+ node->value.text.string ? node->value.text.string : "(null)");
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ for (i = 0; i < 4; i ++)
+ {
+ node = node->next;
+
+ if (!node)
+ {
+ fprintf(stderr, "ERROR: No group #%d child node in basic test!\n", i + 1);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ if (node->type != MXML_ELEMENT)
+ {
+ fprintf(stderr, "ERROR: Group child #%d has type %s (%d), expected MXML_ELEMENT!\n",
+ i + 1, node->type < MXML_ELEMENT || node->type > MXML_TEXT ?
+ "UNKNOWN" : types[node->type], node->type);
+ mxmlDelete(tree);
+ return (1);
+ }
+ }
+
+ /*
+ * Test indices...
+ */
+
+ ind = mxmlIndexNew(tree, NULL, NULL);
+ if (!ind)
+ {
+ fputs("ERROR: Unable to create index of all nodes!\n", stderr);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ if (ind->num_nodes != 5)
+ {
+ fprintf(stderr, "ERROR: Index of all nodes contains %d "
+ "nodes; expected 5!\n", ind->num_nodes);
+ mxmlIndexDelete(ind);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ mxmlIndexReset(ind);
+ if (!mxmlIndexFind(ind, "group", NULL))
+ {
+ fputs("ERROR: mxmlIndexFind for \"group\" failed!\n", stderr);
+ mxmlIndexDelete(ind);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ mxmlIndexDelete(ind);
+
+ ind = mxmlIndexNew(tree, "group", NULL);
+ if (!ind)
+ {
+ fputs("ERROR: Unable to create index of groups!\n", stderr);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ if (ind->num_nodes != 4)
+ {
+ fprintf(stderr, "ERROR: Index of groups contains %d "
+ "nodes; expected 4!\n", ind->num_nodes);
+ mxmlIndexDelete(ind);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ mxmlIndexReset(ind);
+ if (!mxmlIndexEnum(ind))
+ {
+ fputs("ERROR: mxmlIndexEnum failed!\n", stderr);
+ mxmlIndexDelete(ind);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ mxmlIndexDelete(ind);
+
+ ind = mxmlIndexNew(tree, NULL, "type");
+ if (!ind)
+ {
+ fputs("ERROR: Unable to create index of type attributes!\n", stderr);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ if (ind->num_nodes != 3)
+ {
+ fprintf(stderr, "ERROR: Index of type attributes contains %d "
+ "nodes; expected 3!\n", ind->num_nodes);
+ mxmlIndexDelete(ind);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ mxmlIndexReset(ind);
+ if (!mxmlIndexFind(ind, NULL, "string"))
+ {
+ fputs("ERROR: mxmlIndexFind for \"string\" failed!\n", stderr);
+ mxmlIndexDelete(ind);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ mxmlIndexDelete(ind);
+
+ ind = mxmlIndexNew(tree, "group", "type");
+ if (!ind)
+ {
+ fputs("ERROR: Unable to create index of elements and attributes!\n", stderr);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ if (ind->num_nodes != 3)
+ {
+ fprintf(stderr, "ERROR: Index of elements and attributes contains %d "
+ "nodes; expected 3!\n", ind->num_nodes);
+ mxmlIndexDelete(ind);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ mxmlIndexReset(ind);
+ if (!mxmlIndexFind(ind, "group", "string"))
+ {
+ fputs("ERROR: mxmlIndexFind for \"string\" failed!\n", stderr);
+ mxmlIndexDelete(ind);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ mxmlIndexDelete(ind);
+
+ /*
+ * Check the mxmlDelete() works properly...
+ */
+
+ for (i = 0; i < 8; i ++)
+ {
+ if (tree->child)
+ mxmlDelete(tree->child);
+ else
+ {
+ fprintf(stderr, "ERROR: Child pointer prematurely NULL on child #%d\n",
+ i + 1);
+ mxmlDelete(tree);
+ return (1);
+ }
+ }
+
+ if (tree->child)
+ {
+ fputs("ERROR: Child pointer not NULL after deleting all children!\n", stderr);
+ return (1);
+ }
+
+ if (tree->last_child)
+ {
+ fputs("ERROR: Last child pointer not NULL after deleting all children!\n", stderr);
+ return (1);
+ }
+
+ mxmlDelete(tree);
+
+ /*
+ * Open the file...
+ */
+
+ if (argv[1][0] == '<')
+ tree = mxmlLoadString(NULL, argv[1], type_cb);
+ else if ((fp = fopen(argv[1], "rb")) == NULL)
+ {
+ perror(argv[1]);
+ return (1);
+ }
+ else
+ {
+ /*
+ * Read the file...
+ */
+
+ tree = mxmlLoadFile(NULL, fp, type_cb);
+
+ fclose(fp);
+ }
+
+ if (!tree)
+ {
+ fputs("Unable to read XML file!\n", stderr);
+ return (1);
+ }
+
+ if (!strcmp(argv[1], "test.xml"))
+ {
+ /*
+ * Verify that mxmlFindElement() and indirectly mxmlWalkNext() work
+ * properly...
+ */
+
+ if ((node = mxmlFindElement(tree, tree, "choice", NULL, NULL,
+ MXML_DESCEND)) == NULL)
+ {
+ fputs("Unable to find first <choice> element in XML tree!\n", stderr);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ if (!mxmlFindElement(node, tree, "choice", NULL, NULL, MXML_NO_DESCEND))
+ {
+ fputs("Unable to find second <choice> element in XML tree!\n", stderr);
+ mxmlDelete(tree);
+ return (1);
+ }
+ }
+
+ /*
+ * Print the XML tree...
+ */
+
+ mxmlSaveFile(tree, stdout, whitespace_cb);
+
+ /*
+ * Save the XML tree to a string and print it...
+ */
+
+ if (mxmlSaveString(tree, buffer, sizeof(buffer), whitespace_cb) > 0)
+ fputs(buffer, stderr);
+
+ /*
+ * Delete the tree...
+ */
+
+ mxmlDelete(tree);
+
+ /*
+ * Read from/write to file descriptors...
+ */
+
+ if (argv[1][0] != '<')
+ {
+ /*
+ * Open the file again...
+ */
+
+ if ((fd = open(argv[1], O_RDONLY | O_BINARY)) < 0)
+ {
+ perror(argv[1]);
+ return (1);
+ }
+
+ /*
+ * Read the file...
+ */
+
+ tree = mxmlLoadFd(NULL, fd, type_cb);
+
+ close(fd);
+
+ /*
+ * Create filename.xmlfd...
+ */
+
+ snprintf(buffer, sizeof(buffer), "%sfd", argv[1]);
+
+ if ((fd = open(buffer, O_WRONLY | O_CREAT | O_TRUNC | O_BINARY, 0666)) < 0)
+ {
+ perror(buffer);
+ mxmlDelete(tree);
+ return (1);
+ }
+
+ /*
+ * Write the file...
+ */
+
+ mxmlSaveFd(tree, fd, whitespace_cb);
+
+ close(fd);
+
+ /*
+ * Delete the tree...
+ */
+
+ mxmlDelete(tree);
+ }
+
+ /*
+ * Test SAX methods...
+ */
+
+ memset(event_counts, 0, sizeof(event_counts));
+
+ if (argv[1][0] == '<')
+ mxmlSAXLoadString(NULL, argv[1], type_cb, sax_cb, NULL);
+ else if ((fp = fopen(argv[1], "rb")) == NULL)
+ {
+ perror(argv[1]);
+ return (1);
+ }
+ else
+ {
+ /*
+ * Read the file...
+ */
+
+ mxmlSAXLoadFile(NULL, fp, type_cb, sax_cb, NULL);
+
+ fclose(fp);
+ }
+
+ if (!strcmp(argv[1], "test.xml"))
+ {
+ if (event_counts[MXML_SAX_CDATA] != 1)
+ {
+ fprintf(stderr, "MXML_SAX_CDATA seen %d times, expected 1 times!\n",
+ event_counts[MXML_SAX_CDATA]);
+ return (1);
+ }
+
+ if (event_counts[MXML_SAX_COMMENT] != 1)
+ {
+ fprintf(stderr, "MXML_SAX_COMMENT seen %d times, expected 1 times!\n",
+ event_counts[MXML_SAX_COMMENT]);
+ return (1);
+ }
+
+ if (event_counts[MXML_SAX_DATA] != 61)
+ {
+ fprintf(stderr, "MXML_SAX_DATA seen %d times, expected 61 times!\n",
+ event_counts[MXML_SAX_DATA]);
+ return (1);
+ }
+
+ if (event_counts[MXML_SAX_DIRECTIVE] != 1)
+ {
+ fprintf(stderr, "MXML_SAX_DIRECTIVE seen %d times, expected 1 times!\n",
+ event_counts[MXML_SAX_DIRECTIVE]);
+ return (1);
+ }
+
+ if (event_counts[MXML_SAX_ELEMENT_CLOSE] != 20)
+ {
+ fprintf(stderr, "MXML_SAX_ELEMENT_CLOSE seen %d times, expected 20 times!\n",
+ event_counts[MXML_SAX_ELEMENT_CLOSE]);
+ return (1);
+ }
+
+ if (event_counts[MXML_SAX_ELEMENT_OPEN] != 20)
+ {
+ fprintf(stderr, "MXML_SAX_ELEMENT_OPEN seen %d times, expected 20 times!\n",
+ event_counts[MXML_SAX_ELEMENT_OPEN]);
+ return (1);
+ }
+ }
+
+ /*
+ * Return...
+ */
+
+ return (0);
+}
+
+
+/*
+ * 'sax_cb()' - Process nodes via SAX.
+ */
+
+void
+sax_cb(mxml_node_t *node, /* I - Current node */
+ mxml_sax_event_t event, /* I - SAX event */
+ void *data) /* I - SAX user data */
+{
+ /*
+ * This SAX callback just counts the different events.
+ */
+
+ event_counts[event] ++;
+}
+
+
+/*
+ * 'type_cb()' - XML data type callback for mxmlLoadFile()...
+ */
+
+mxml_type_t /* O - Data type */
+type_cb(mxml_node_t *node) /* I - Element node */
+{
+ const char *type; /* Type string */
+
+
+ /*
+ * You can lookup attributes and/or use the element name, hierarchy, etc...
+ */
+
+ if ((type = mxmlElementGetAttr(node, "type")) == NULL)
+ type = node->value.element.name;
+
+ if (!strcmp(type, "integer"))
+ return (MXML_INTEGER);
+ else if (!strcmp(type, "opaque") || !strcmp(type, "pre"))
+ return (MXML_OPAQUE);
+ else if (!strcmp(type, "real"))
+ return (MXML_REAL);
+ else
+ return (MXML_TEXT);
+}
+
+
+/*
+ * 'whitespace_cb()' - Let the mxmlSaveFile() function know when to insert
+ * newlines and tabs...
+ */
+
+const char * /* O - Whitespace string or NULL */
+whitespace_cb(mxml_node_t *node, /* I - Element node */
+ int where) /* I - Open or close tag? */
+{
+ mxml_node_t *parent; /* Parent node */
+ int level; /* Indentation level */
+ const char *name; /* Name of element */
+ static const char *tabs = "\t\t\t\t\t\t\t\t";
+ /* Tabs for indentation */
+
+
+ /*
+ * We can conditionally break to a new line before or after any element.
+ * These are just common HTML elements...
+ */
+
+ name = node->value.element.name;
+
+ if (!strcmp(name, "html") || !strcmp(name, "head") || !strcmp(name, "body") ||
+ !strcmp(name, "pre") || !strcmp(name, "p") ||
+ !strcmp(name, "h1") || !strcmp(name, "h2") || !strcmp(name, "h3") ||
+ !strcmp(name, "h4") || !strcmp(name, "h5") || !strcmp(name, "h6"))
+ {
+ /*
+ * Newlines before open and after close...
+ */
+
+ if (where == MXML_WS_BEFORE_OPEN || where == MXML_WS_AFTER_CLOSE)
+ return ("\n");
+ }
+ else if (!strcmp(name, "dl") || !strcmp(name, "ol") || !strcmp(name, "ul"))
+ {
+ /*
+ * Put a newline before and after list elements...
+ */
+
+ return ("\n");
+ }
+ else if (!strcmp(name, "dd") || !strcmp(name, "dt") || !strcmp(name, "li"))
+ {
+ /*
+ * Put a tab before <li>'s, <dd>'s, and <dt>'s, and a newline after them...
+ */
+
+ if (where == MXML_WS_BEFORE_OPEN)
+ return ("\t");
+ else if (where == MXML_WS_AFTER_CLOSE)
+ return ("\n");
+ }
+ else if (!strncmp(name, "?xml", 4))
+ {
+ if (where == MXML_WS_AFTER_OPEN)
+ return ("\n");
+ else
+ return (NULL);
+ }
+ else if (where == MXML_WS_BEFORE_OPEN ||
+ ((!strcmp(name, "choice") || !strcmp(name, "option")) &&
+ where == MXML_WS_BEFORE_CLOSE))
+ {
+ for (level = -1, parent = node->parent;
+ parent;
+ level ++, parent = parent->parent);
+
+ if (level > 8)
+ level = 8;
+ else if (level < 0)
+ level = 0;
+
+ return (tabs + 8 - level);
+ }
+ else if (where == MXML_WS_AFTER_CLOSE ||
+ ((!strcmp(name, "group") || !strcmp(name, "option") ||
+ !strcmp(name, "choice")) &&
+ where == MXML_WS_AFTER_OPEN))
+ return ("\n");
+ else if (where == MXML_WS_AFTER_OPEN && !node->child)
+ return ("\n");
+
+ /*
+ * Return NULL for no added whitespace...
+ */
+
+ return (NULL);
+}
+
+
+/*
+ * End of "$Id: testmxml.c 381 2009-02-05 06:06:11Z mike $".
+ */
diff -Naur mxml-2.6/vcnet/config.h mxml-2.6-haiku/vcnet/config.h
--- mxml-2.6/vcnet/config.h 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/vcnet/config.h 2009-04-18 17:05:52.000000000 +0000
@@ -0,0 +1,125 @@
+/*
+ * "$Id: config.h 387 2009-04-18 17:05:52Z mike $"
+ *
+ * Configuration file for Mini-XML, a small XML-like file parsing library.
+ *
+ * Copyright 2003-2009 by Michael Sweet.
+ *
+ * This program is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU Library General Public
+ * License as published by the Free Software Foundation; either
+ * version 2, or (at your option) any later version.
+ *
+ * This program is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
+ * GNU General Public License for more details.
+ */
+
+/*
+ * Beginning with VC2005, Microsoft breaks ISO C and POSIX conformance
+ * by deprecating a number of functions in the name of security, even
+ * when many of the affected functions are otherwise completely secure.
+ * The _CRT_SECURE_NO_DEPRECATE definition ensures that we won't get
+ * warnings from their use...
+ *
+ * Then Microsoft decided that they should ignore this in VC2008 and use
+ * yet another define (_CRT_SECURE_NO_WARNINGS) instead. Bastards.
+ */
+
+#define _CRT_SECURE_NO_DEPRECATE
+#define _CRT_SECURE_NO_WARNINGS
+
+
+/*
+ * Include necessary headers...
+ */
+
+#include <stdio.h>
+#include <stdlib.h>
+#include <string.h>
+#include <stdarg.h>
+#include <ctype.h>
+#include <io.h>
+
+
+/*
+ * Microsoft also renames the POSIX functions to _name, and introduces
+ * a broken compatibility layer using the original names. As a result,
+ * random crashes can occur when, for example, strdup() allocates memory
+ * from a different heap than used by malloc() and free().
+ *
+ * To avoid moronic problems like this, we #define the POSIX function
+ * names to the corresponding non-standard Microsoft names.
+ */
+
+#define close _close
+#define open _open
+#define read _read
+#define snprintf _snprintf
+#define strdup _strdup
+#define vsnprintf _vsnprintf
+#define write _write
+
+
+/*
+ * Version number...
+ */
+
+#define MXML_VERSION "Mini-XML v2.6"
+
+
+/*
+ * Inline function support...
+ */
+
+#define inline _inline
+
+
+/*
+ * Long long support...
+ */
+
+#define HAVE_LONG_LONG 1
+
+
+/*
+ * Do we have the snprintf() and vsnprintf() functions?
+ */
+
+#define HAVE_SNPRINTF 1
+#define HAVE_VSNPRINTF 1
+
+
+/*
+ * Do we have the strXXX() functions?
+ */
+
+#define HAVE_STRDUP 1
+
+
+/*
+ * Define prototypes for string functions as needed...
+ */
+
+# ifndef HAVE_STRDUP
+extern char *_mxml_strdup(const char *);
+# define strdup _mxml_strdup
+# endif /* !HAVE_STRDUP */
+
+extern char *_mxml_strdupf(const char *, ...);
+extern char *_mxml_vstrdupf(const char *, va_list);
+
+# ifndef HAVE_SNPRINTF
+extern int _mxml_snprintf(char *, size_t, const char *, ...);
+# define snprintf _mxml_snprintf
+# endif /* !HAVE_SNPRINTF */
+
+# ifndef HAVE_VSNPRINTF
+extern int _mxml_vsnprintf(char *, size_t, const char *, va_list);
+# define vsnprintf _mxml_vsnprintf
+# endif /* !HAVE_VSNPRINTF */
+
+/*
+ * End of "$Id: config.h 387 2009-04-18 17:05:52Z mike $".
+ */
diff -Naur mxml-2.6/vcnet/mxml.sln mxml-2.6-haiku/vcnet/mxml.sln
--- mxml-2.6/vcnet/mxml.sln 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/vcnet/mxml.sln 2009-05-17 16:10:38.000000000 +0000
@@ -0,0 +1,37 @@
+Microsoft Visual Studio Solution File, Format Version 10.00
+# Visual Studio 2008
+Project("{8BC9CEB8-8B4A-11D0-8D11-00A0C91BC942}") = "mxmldoc", "mxmldoc.vcproj", "{D909892E-520A-4322-9A47-DAEBDA9CC7A7}"
+ ProjectSection(ProjectDependencies) = postProject
+ {E5AA9476-9751-4654-8109-B1A2112D5E73} = {E5AA9476-9751-4654-8109-B1A2112D5E73}
+ EndProjectSection
+EndProject
+Project("{8BC9CEB8-8B4A-11D0-8D11-00A0C91BC942}") = "mxml1", "mxml1.vcproj", "{E5AA9476-9751-4654-8109-B1A2112D5E73}"
+EndProject
+Project("{8BC9CEB8-8B4A-11D0-8D11-00A0C91BC942}") = "testmxml", "testmxml.vcproj", "{75CAC6C4-A6BC-4935-A3C9-8F0AE0744227}"
+ ProjectSection(ProjectDependencies) = postProject
+ {E5AA9476-9751-4654-8109-B1A2112D5E73} = {E5AA9476-9751-4654-8109-B1A2112D5E73}
+ EndProjectSection
+EndProject
+Global
+ GlobalSection(SolutionConfigurationPlatforms) = preSolution
+ Debug|Win32 = Debug|Win32
+ Release|Win32 = Release|Win32
+ EndGlobalSection
+ GlobalSection(ProjectConfigurationPlatforms) = postSolution
+ {D909892E-520A-4322-9A47-DAEBDA9CC7A7}.Debug|Win32.ActiveCfg = Debug|Win32
+ {D909892E-520A-4322-9A47-DAEBDA9CC7A7}.Debug|Win32.Build.0 = Debug|Win32
+ {D909892E-520A-4322-9A47-DAEBDA9CC7A7}.Release|Win32.ActiveCfg = Release|Win32
+ {D909892E-520A-4322-9A47-DAEBDA9CC7A7}.Release|Win32.Build.0 = Release|Win32
+ {E5AA9476-9751-4654-8109-B1A2112D5E73}.Debug|Win32.ActiveCfg = Debug|Win32
+ {E5AA9476-9751-4654-8109-B1A2112D5E73}.Debug|Win32.Build.0 = Debug|Win32
+ {E5AA9476-9751-4654-8109-B1A2112D5E73}.Release|Win32.ActiveCfg = Release|Win32
+ {E5AA9476-9751-4654-8109-B1A2112D5E73}.Release|Win32.Build.0 = Release|Win32
+ {75CAC6C4-A6BC-4935-A3C9-8F0AE0744227}.Debug|Win32.ActiveCfg = Debug|Win32
+ {75CAC6C4-A6BC-4935-A3C9-8F0AE0744227}.Debug|Win32.Build.0 = Debug|Win32
+ {75CAC6C4-A6BC-4935-A3C9-8F0AE0744227}.Release|Win32.ActiveCfg = Release|Win32
+ {75CAC6C4-A6BC-4935-A3C9-8F0AE0744227}.Release|Win32.Build.0 = Release|Win32
+ EndGlobalSection
+ GlobalSection(SolutionProperties) = preSolution
+ HideSolutionNode = FALSE
+ EndGlobalSection
+EndGlobal
diff -Naur mxml-2.6/vcnet/mxml1.def mxml-2.6-haiku/vcnet/mxml1.def
--- mxml-2.6/vcnet/mxml1.def 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/vcnet/mxml1.def 2007-12-06 06:07:50.000000000 +0000
@@ -0,0 +1,59 @@
+LIBRARY "MXML1"
+EXPORTS
+ _mxml_strdupf
+ _mxml_vstrdupf
+ mxml_ignore_cb
+ mxml_integer_cb
+ mxml_opaque_cb
+ mxml_real_cb
+ mxmlAdd
+ mxmlDelete
+ mxmlElementDeleteAttr
+ mxmlElementGetAttr
+ mxmlElementSetAttr
+ mxmlElementSetAttrf
+ mxmlEntityAddCallback
+ mxmlEntityGetName
+ mxmlEntityGetValue
+ mxmlEntityRemoveCallback
+ mxmlFindElement
+ mxmlIndexDelete
+ mxmlIndexEnum
+ mxmlIndexFind
+ mxmlIndexNew
+ mxmlIndexReset
+ mxmlLoadFd
+ mxmlLoadFile
+ mxmlLoadString
+ mxmlNewCDATA
+ mxmlNewCustom
+ mxmlNewElement
+ mxmlNewInteger
+ mxmlNewOpaque
+ mxmlNewReal
+ mxmlNewText
+ mxmlNewTextf
+ mxmlNewXML
+ mxmlRelease
+ mxmlRemove
+ mxmlRetain
+ mxmlSaveAllocString
+ mxmlSaveFd
+ mxmlSaveFile
+ mxmlSaveString
+ mxmlSAXLoadFd
+ mxmlSAXLoadFile
+ mxmlSAXLoadString
+ mxmlSetCDATA
+ mxmlSetCustom
+ mxmlSetCustomHandlers
+ mxmlSetElement
+ mxmlSetErrorCallback
+ mxmlSetInteger
+ mxmlSetOpaque
+ mxmlSetReal
+ mxmlSetText
+ mxmlSetTextf
+ mxmlSetWrapMargin
+ mxmlWalkNext
+ mxmlWalkPrev
diff -Naur mxml-2.6/vcnet/mxml1.vcproj mxml-2.6-haiku/vcnet/mxml1.vcproj
--- mxml-2.6/vcnet/mxml1.vcproj 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/vcnet/mxml1.vcproj 2008-10-26 19:44:57.000000000 +0000
@@ -0,0 +1,255 @@
+<?xml version="1.0" encoding="Windows-1252"?>
+<VisualStudioProject
+ ProjectType="Visual C++"
+ Version="9.00"
+ Name="mxml1"
+ ProjectGUID="{E5AA9476-9751-4654-8109-B1A2112D5E73}"
+ Keyword="Win32Proj"
+ TargetFrameworkVersion="131072"
+ >
+ <Platforms>
+ <Platform
+ Name="Win32"
+ />
+ </Platforms>
+ <ToolFiles>
+ </ToolFiles>
+ <Configurations>
+ <Configuration
+ Name="Debug|Win32"
+ OutputDirectory="Debug"
+ IntermediateDirectory="Debug"
+ ConfigurationType="2"
+ InheritedPropertySheets="$(VCInstallDir)VCProjectDefaults\UpgradeFromVC71.vsprops"
+ CharacterSet="2"
+ >
+ <Tool
+ Name="VCPreBuildEventTool"
+ />
+ <Tool
+ Name="VCCustomBuildTool"
+ />
+ <Tool
+ Name="VCXMLDataGeneratorTool"
+ />
+ <Tool
+ Name="VCWebServiceProxyGeneratorTool"
+ />
+ <Tool
+ Name="VCMIDLTool"
+ />
+ <Tool
+ Name="VCCLCompilerTool"
+ Optimization="0"
+ AdditionalIncludeDirectories="..\vcnet;.."
+ PreprocessorDefinitions="WIN32;_DEBUG;_WINDOWS;_USRDLL;MXML1_EXPORTS"
+ MinimalRebuild="true"
+ BasicRuntimeChecks="3"
+ RuntimeLibrary="3"
+ UsePrecompiledHeader="0"
+ WarningLevel="1"
+ Detect64BitPortabilityProblems="false"
+ DebugInformationFormat="4"
+ />
+ <Tool
+ Name="VCManagedResourceCompilerTool"
+ />
+ <Tool
+ Name="VCResourceCompilerTool"
+ />
+ <Tool
+ Name="VCPreLinkEventTool"
+ />
+ <Tool
+ Name="VCLinkerTool"
+ OutputFile="mxml1.dll"
+ LinkIncremental="2"
+ IgnoreDefaultLibraryNames="oldnames.lib"
+ ModuleDefinitionFile=".\mxml1.def"
+ GenerateDebugInformation="true"
+ ProgramDatabaseFile="$(OutDir)/mxml1.pdb"
+ SubSystem="2"
+ RandomizedBaseAddress="1"
+ DataExecutionPrevention="0"
+ ImportLibrary="mxml1.lib"
+ TargetMachine="1"
+ />
+ <Tool
+ Name="VCALinkTool"
+ />
+ <Tool
+ Name="VCManifestTool"
+ />
+ <Tool
+ Name="VCXDCMakeTool"
+ />
+ <Tool
+ Name="VCBscMakeTool"
+ />
+ <Tool
+ Name="VCFxCopTool"
+ />
+ <Tool
+ Name="VCAppVerifierTool"
+ />
+ <Tool
+ Name="VCPostBuildEventTool"
+ />
+ </Configuration>
+ <Configuration
+ Name="Release|Win32"
+ OutputDirectory="Release"
+ IntermediateDirectory="Release"
+ ConfigurationType="2"
+ InheritedPropertySheets="$(VCInstallDir)VCProjectDefaults\UpgradeFromVC71.vsprops"
+ CharacterSet="2"
+ >
+ <Tool
+ Name="VCPreBuildEventTool"
+ />
+ <Tool
+ Name="VCCustomBuildTool"
+ />
+ <Tool
+ Name="VCXMLDataGeneratorTool"
+ />
+ <Tool
+ Name="VCWebServiceProxyGeneratorTool"
+ />
+ <Tool
+ Name="VCMIDLTool"
+ />
+ <Tool
+ Name="VCCLCompilerTool"
+ AdditionalIncludeDirectories="..\vcnet;.."
+ PreprocessorDefinitions="WIN32;NDEBUG;_WINDOWS;_USRDLL;MXML1_EXPORTS"
+ RuntimeLibrary="2"
+ UsePrecompiledHeader="0"
+ WarningLevel="1"
+ Detect64BitPortabilityProblems="false"
+ DebugInformationFormat="3"
+ />
+ <Tool
+ Name="VCManagedResourceCompilerTool"
+ />
+ <Tool
+ Name="VCResourceCompilerTool"
+ />
+ <Tool
+ Name="VCPreLinkEventTool"
+ />
+ <Tool
+ Name="VCLinkerTool"
+ OutputFile="mxml1.dll"
+ LinkIncremental="1"
+ IgnoreDefaultLibraryNames="oldnames.lib"
+ ModuleDefinitionFile=".\mxml1.def"
+ GenerateDebugInformation="false"
+ SubSystem="2"
+ OptimizeReferences="2"
+ EnableCOMDATFolding="2"
+ RandomizedBaseAddress="1"
+ DataExecutionPrevention="0"
+ ImportLibrary="mxml1.lib"
+ TargetMachine="1"
+ />
+ <Tool
+ Name="VCALinkTool"
+ />
+ <Tool
+ Name="VCManifestTool"
+ />
+ <Tool
+ Name="VCXDCMakeTool"
+ />
+ <Tool
+ Name="VCBscMakeTool"
+ />
+ <Tool
+ Name="VCFxCopTool"
+ />
+ <Tool
+ Name="VCAppVerifierTool"
+ />
+ <Tool
+ Name="VCPostBuildEventTool"
+ />
+ </Configuration>
+ </Configurations>
+ <References>
+ </References>
+ <Files>
+ <Filter
+ Name="Source Files"
+ Filter="cpp;c;cxx;def;odl;idl;hpj;bat;asm;asmx"
+ UniqueIdentifier="{4FC737F1-C7A5-4376-A066-2A32D752A2FF}"
+ >
+ <File
+ RelativePath="..\mxml-attr.c"
+ >
+ </File>
+ <File
+ RelativePath="..\mxml-entity.c"
+ >
+ </File>
+ <File
+ RelativePath="..\mxml-file.c"
+ >
+ </File>
+ <File
+ RelativePath="..\mxml-index.c"
+ >
+ </File>
+ <File
+ RelativePath="..\mxml-node.c"
+ >
+ </File>
+ <File
+ RelativePath="..\mxml-private.c"
+ >
+ </File>
+ <File
+ RelativePath="..\mxml-search.c"
+ >
+ </File>
+ <File
+ RelativePath="..\mxml-set.c"
+ >
+ </File>
+ <File
+ RelativePath="..\mxml-string.c"
+ >
+ </File>
+ </Filter>
+ <Filter
+ Name="Header Files"
+ Filter="h;hpp;hxx;hm;inl;inc;xsd"
+ UniqueIdentifier="{93995380-89BD-4b04-88EB-625FBE52EBFB}"
+ >
+ <File
+ RelativePath="..\vcnet\config.h"
+ >
+ </File>
+ <File
+ RelativePath="..\mxml-private.h"
+ >
+ </File>
+ <File
+ RelativePath="..\mxml.h"
+ >
+ </File>
+ </Filter>
+ <Filter
+ Name="Resource Files"
+ Filter="rc;ico;cur;bmp;dlg;rc2;rct;bin;rgs;gif;jpg;jpeg;jpe;resx"
+ UniqueIdentifier="{67DA6AB6-F800-4c08-8B7A-83BB121AAD01}"
+ >
+ <File
+ RelativePath=".\mxml1.def"
+ >
+ </File>
+ </Filter>
+ </Files>
+ <Globals>
+ </Globals>
+</VisualStudioProject>
diff -Naur mxml-2.6/vcnet/mxmldoc.vcproj mxml-2.6-haiku/vcnet/mxmldoc.vcproj
--- mxml-2.6/vcnet/mxmldoc.vcproj 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/vcnet/mxmldoc.vcproj 2008-10-26 19:44:57.000000000 +0000
@@ -0,0 +1,203 @@
+<?xml version="1.0" encoding="Windows-1252"?>
+<VisualStudioProject
+ ProjectType="Visual C++"
+ Version="9.00"
+ Name="mxmldoc"
+ ProjectGUID="{D909892E-520A-4322-9A47-DAEBDA9CC7A7}"
+ Keyword="Win32Proj"
+ TargetFrameworkVersion="131072"
+ >
+ <Platforms>
+ <Platform
+ Name="Win32"
+ />
+ </Platforms>
+ <ToolFiles>
+ </ToolFiles>
+ <Configurations>
+ <Configuration
+ Name="Debug|Win32"
+ OutputDirectory="Debug"
+ IntermediateDirectory="Debug"
+ ConfigurationType="1"
+ InheritedPropertySheets="$(VCInstallDir)VCProjectDefaults\UpgradeFromVC71.vsprops"
+ CharacterSet="2"
+ >
+ <Tool
+ Name="VCPreBuildEventTool"
+ />
+ <Tool
+ Name="VCCustomBuildTool"
+ />
+ <Tool
+ Name="VCXMLDataGeneratorTool"
+ />
+ <Tool
+ Name="VCWebServiceProxyGeneratorTool"
+ />
+ <Tool
+ Name="VCMIDLTool"
+ />
+ <Tool
+ Name="VCCLCompilerTool"
+ Optimization="0"
+ AdditionalIncludeDirectories="../vcnet,.."
+ PreprocessorDefinitions="WIN32;_DEBUG;_CONSOLE"
+ MinimalRebuild="true"
+ BasicRuntimeChecks="3"
+ RuntimeLibrary="3"
+ UsePrecompiledHeader="0"
+ WarningLevel="3"
+ Detect64BitPortabilityProblems="false"
+ DebugInformationFormat="4"
+ />
+ <Tool
+ Name="VCManagedResourceCompilerTool"
+ />
+ <Tool
+ Name="VCResourceCompilerTool"
+ />
+ <Tool
+ Name="VCPreLinkEventTool"
+ />
+ <Tool
+ Name="VCLinkerTool"
+ OutputFile="../mxmldoc.exe"
+ LinkIncremental="2"
+ IgnoreDefaultLibraryNames="oldnames.lib"
+ GenerateDebugInformation="true"
+ ProgramDatabaseFile="$(OutDir)/mxmldoc.pdb"
+ SubSystem="1"
+ RandomizedBaseAddress="1"
+ DataExecutionPrevention="0"
+ TargetMachine="1"
+ />
+ <Tool
+ Name="VCALinkTool"
+ />
+ <Tool
+ Name="VCManifestTool"
+ />
+ <Tool
+ Name="VCXDCMakeTool"
+ />
+ <Tool
+ Name="VCBscMakeTool"
+ />
+ <Tool
+ Name="VCFxCopTool"
+ />
+ <Tool
+ Name="VCAppVerifierTool"
+ />
+ <Tool
+ Name="VCPostBuildEventTool"
+ />
+ </Configuration>
+ <Configuration
+ Name="Release|Win32"
+ OutputDirectory="Release"
+ IntermediateDirectory="Release"
+ ConfigurationType="1"
+ InheritedPropertySheets="$(VCInstallDir)VCProjectDefaults\UpgradeFromVC71.vsprops"
+ CharacterSet="2"
+ >
+ <Tool
+ Name="VCPreBuildEventTool"
+ />
+ <Tool
+ Name="VCCustomBuildTool"
+ />
+ <Tool
+ Name="VCXMLDataGeneratorTool"
+ />
+ <Tool
+ Name="VCWebServiceProxyGeneratorTool"
+ />
+ <Tool
+ Name="VCMIDLTool"
+ />
+ <Tool
+ Name="VCCLCompilerTool"
+ AdditionalIncludeDirectories="../vcnet,.."
+ PreprocessorDefinitions="WIN32;NDEBUG;_CONSOLE"
+ RuntimeLibrary="2"
+ UsePrecompiledHeader="0"
+ WarningLevel="3"
+ Detect64BitPortabilityProblems="false"
+ DebugInformationFormat="3"
+ />
+ <Tool
+ Name="VCManagedResourceCompilerTool"
+ />
+ <Tool
+ Name="VCResourceCompilerTool"
+ />
+ <Tool
+ Name="VCPreLinkEventTool"
+ />
+ <Tool
+ Name="VCLinkerTool"
+ OutputFile="../mxmldoc.exe"
+ LinkIncremental="1"
+ IgnoreDefaultLibraryNames="oldnames.lib"
+ GenerateDebugInformation="true"
+ SubSystem="1"
+ OptimizeReferences="2"
+ EnableCOMDATFolding="2"
+ RandomizedBaseAddress="1"
+ DataExecutionPrevention="0"
+ TargetMachine="1"
+ />
+ <Tool
+ Name="VCALinkTool"
+ />
+ <Tool
+ Name="VCManifestTool"
+ />
+ <Tool
+ Name="VCXDCMakeTool"
+ />
+ <Tool
+ Name="VCBscMakeTool"
+ />
+ <Tool
+ Name="VCFxCopTool"
+ />
+ <Tool
+ Name="VCAppVerifierTool"
+ />
+ <Tool
+ Name="VCPostBuildEventTool"
+ />
+ </Configuration>
+ </Configurations>
+ <References>
+ </References>
+ <Files>
+ <Filter
+ Name="Source Files"
+ Filter="cpp;c;cxx;def;odl;idl;hpj;bat;asm;asmx"
+ UniqueIdentifier="{4FC737F1-C7A5-4376-A066-2A32D752A2FF}"
+ >
+ <File
+ RelativePath="..\mxmldoc.c"
+ >
+ </File>
+ </Filter>
+ <Filter
+ Name="Header Files"
+ Filter="h;hpp;hxx;hm;inl;inc;xsd"
+ UniqueIdentifier="{93995380-89BD-4b04-88EB-625FBE52EBFB}"
+ >
+ </Filter>
+ <Filter
+ Name="Resource Files"
+ Filter="rc;ico;cur;bmp;dlg;rc2;rct;bin;rgs;gif;jpg;jpeg;jpe;resx"
+ UniqueIdentifier="{67DA6AB6-F800-4c08-8B7A-83BB121AAD01}"
+ >
+ </Filter>
+ </Files>
+ <Globals>
+ </Globals>
+</VisualStudioProject>
diff -Naur mxml-2.6/vcnet/testmxml.vcproj mxml-2.6-haiku/vcnet/testmxml.vcproj
--- mxml-2.6/vcnet/testmxml.vcproj 1970-01-01 00:00:00.000000000 +0000
+++ mxml-2.6-haiku/vcnet/testmxml.vcproj 2008-10-26 19:44:57.000000000 +0000
@@ -0,0 +1,203 @@
+<?xml version="1.0" encoding="Windows-1252"?>
+<VisualStudioProject
+ ProjectType="Visual C++"
+ Version="9.00"
+ Name="testmxml"
+ ProjectGUID="{75CAC6C4-A6BC-4935-A3C9-8F0AE0744227}"
+ Keyword="Win32Proj"
+ TargetFrameworkVersion="131072"
+ >
+ <Platforms>
+ <Platform
+ Name="Win32"
+ />
+ </Platforms>
+ <ToolFiles>
+ </ToolFiles>
+ <Configurations>
+ <Configuration
+ Name="Debug|Win32"
+ OutputDirectory="Debug"
+ IntermediateDirectory="Debug"
+ ConfigurationType="1"
+ InheritedPropertySheets="$(VCInstallDir)VCProjectDefaults\UpgradeFromVC71.vsprops"
+ CharacterSet="2"
+ >
+ <Tool
+ Name="VCPreBuildEventTool"
+ />
+ <Tool
+ Name="VCCustomBuildTool"
+ />
+ <Tool
+ Name="VCXMLDataGeneratorTool"
+ />
+ <Tool
+ Name="VCWebServiceProxyGeneratorTool"
+ />
+ <Tool
+ Name="VCMIDLTool"
+ />
+ <Tool
+ Name="VCCLCompilerTool"
+ Optimization="0"
+ AdditionalIncludeDirectories="../vcnet,.."
+ PreprocessorDefinitions="WIN32;_DEBUG;_CONSOLE"
+ MinimalRebuild="true"
+ BasicRuntimeChecks="3"
+ RuntimeLibrary="3"
+ UsePrecompiledHeader="0"
+ WarningLevel="3"
+ Detect64BitPortabilityProblems="false"
+ DebugInformationFormat="4"
+ />
+ <Tool
+ Name="VCManagedResourceCompilerTool"
+ />
+ <Tool
+ Name="VCResourceCompilerTool"
+ />
+ <Tool
+ Name="VCPreLinkEventTool"
+ />
+ <Tool
+ Name="VCLinkerTool"
+ OutputFile="../testmxml.exe"
+ LinkIncremental="2"
+ IgnoreDefaultLibraryNames="oldnames.lib"
+ GenerateDebugInformation="true"
+ ProgramDatabaseFile="$(OutDir)/testmxml.pdb"
+ SubSystem="1"
+ RandomizedBaseAddress="1"
+ DataExecutionPrevention="0"
+ TargetMachine="1"
+ />
+ <Tool
+ Name="VCALinkTool"
+ />
+ <Tool
+ Name="VCManifestTool"
+ />
+ <Tool
+ Name="VCXDCMakeTool"
+ />
+ <Tool
+ Name="VCBscMakeTool"
+ />
+ <Tool
+ Name="VCFxCopTool"
+ />
+ <Tool
+ Name="VCAppVerifierTool"
+ />
+ <Tool
+ Name="VCPostBuildEventTool"
+ />
+ </Configuration>
+ <Configuration
+ Name="Release|Win32"
+ OutputDirectory="Release"
+ IntermediateDirectory="Release"
+ ConfigurationType="1"
+ InheritedPropertySheets="$(VCInstallDir)VCProjectDefaults\UpgradeFromVC71.vsprops"
+ CharacterSet="2"
+ >
+ <Tool
+ Name="VCPreBuildEventTool"
+ />
+ <Tool
+ Name="VCCustomBuildTool"
+ />
+ <Tool
+ Name="VCXMLDataGeneratorTool"
+ />
+ <Tool
+ Name="VCWebServiceProxyGeneratorTool"
+ />
+ <Tool
+ Name="VCMIDLTool"
+ />
+ <Tool
+ Name="VCCLCompilerTool"
+ AdditionalIncludeDirectories="../vcnet,.."
+ PreprocessorDefinitions="WIN32;NDEBUG;_CONSOLE"
+ RuntimeLibrary="2"
+ UsePrecompiledHeader="0"
+ WarningLevel="3"
+ Detect64BitPortabilityProblems="false"
+ DebugInformationFormat="3"
+ />
+ <Tool
+ Name="VCManagedResourceCompilerTool"
+ />
+ <Tool
+ Name="VCResourceCompilerTool"
+ />
+ <Tool
+ Name="VCPreLinkEventTool"
+ />
+ <Tool
+ Name="VCLinkerTool"
+ OutputFile="../testmxml.exe"
+ LinkIncremental="1"
+ IgnoreDefaultLibraryNames="oldnames.lib"
+ GenerateDebugInformation="true"
+ SubSystem="1"
+ OptimizeReferences="2"
+ EnableCOMDATFolding="2"
+ RandomizedBaseAddress="1"
+ DataExecutionPrevention="0"
+ TargetMachine="1"
+ />
+ <Tool
+ Name="VCALinkTool"
+ />
+ <Tool
+ Name="VCManifestTool"
+ />
+ <Tool
+ Name="VCXDCMakeTool"
+ />
+ <Tool
+ Name="VCBscMakeTool"
+ />
+ <Tool
+ Name="VCFxCopTool"
+ />
+ <Tool
+ Name="VCAppVerifierTool"
+ />
+ <Tool
+ Name="VCPostBuildEventTool"
+ />
+ </Configuration>
+ </Configurations>
+ <References>
+ </References>
+ <Files>
+ <Filter
+ Name="Source Files"
+ Filter="cpp;c;cxx;def;odl;idl;hpj;bat;asm;asmx"
+ UniqueIdentifier="{4FC737F1-C7A5-4376-A066-2A32D752A2FF}"
+ >
+ <File
+ RelativePath="..\testmxml.c"
+ >
+ </File>
+ </Filter>
+ <Filter
+ Name="Header Files"
+ Filter="h;hpp;hxx;hm;inl;inc;xsd"
+ UniqueIdentifier="{93995380-89BD-4b04-88EB-625FBE52EBFB}"
+ >
+ </Filter>
+ <Filter
+ Name="Resource Files"
+ Filter="rc;ico;cur;bmp;dlg;rc2;rct;bin;rgs;gif;jpg;jpeg;jpe;resx"
+ UniqueIdentifier="{67DA6AB6-F800-4c08-8B7A-83BB121AAD01}"
+ >
+ </Filter>
+ </Files>
+ <Globals>
+ </Globals>
+</VisualStudioProject>
Reference in New Issue View Git Blame Copy Permalink